F319631

General Info

Members Datasets Scaffolds Average Seq Length
209 132 164 212

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0318940|Ga0501070_0318940_248_880
Length 210
Sequence MADDFHKPTLFGGREFEAFPGSFVDPAVSRRIAHDTARGLVARVRDSDDPEVLDRVVRFTDEHGLDAVAELWAMSGPNTLPGALWRIYLLRTMIRQDPDGVALLFQRGTETLVTIDPVIAGAPSPAGPDEVLELSDRILRGVFDGDLAHALERASAFCRVEASGAASIADDQEGAAPERSTELTTRAGRLTTVAEELAMCARLARDDALE

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221575 Microbacterium sp. Root61 Isolate Unclassified
7 2643221597 Microbacterium sp. Root180 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
11 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
12 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
13 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
14 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
15 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
16 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
17 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
18 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
19 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
20 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
21 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
22 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
23 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
24 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
25 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
26 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
27 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
28 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
29 2919069694 Microbacterium sp. 1154 Isolate Unclassified
30 2919395869 Microbacterium resistens 2980 Isolate Unclassified
31 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
32 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
33 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
34 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
35 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
36 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
37 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
38 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
39 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
40 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
41 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
78 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
130 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
131 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
132 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.03
Metatranscriptomes 1.44
Isolates 21.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 11.96
Rhizosphere 40.19
Stem 0
Stem Tuber 0
Unclassified 39.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1004108 3300002738 Bacteria 2745
2 Ga0006562J51391_1023980 3300003578 Bacteria 11050
3 Ga0070658_10251265 3300005327 Bacteria 1500
4 Ga0070668_100387755 3300005347 Bacteria 1190
5 Ga0070665_100147661 3300005548 Bacteria 2354
6 Ga0075365_10023426 3300006038 Bacteria 3883
7 Ga0075368_10088513 3300006042 Bacteria 1265
8 Ga0075363_100341165 3300006048 Bacteria 874
9 Ga0075364_10041879 3300006051 Bacteria 2974
10 Ga0075364_10150419 3300006051 Bacteria 1569
11 Ga0075367_10064230 3300006178 Bacteria 2195
12 Ga0075369_10093857 3300006186 Bacteria 1341
13 Ga0075370_10372381 3300006353 Bacteria 855
14 Ga0105244_10243174 3300009036 Bacteria 840
15 Ga0105244_10243664 3300009036 Bacteria 839
16 Ga0105237_10169346 3300009545 Bacteria 2184
17 Ga0105239_10146845 3300010375 Bacteria 2631
18 Ga0157370_10055095 3300013104 Bacteria 3790
19 Ga0171462_1004 3300013250 Bacteria 678877
20 Ga0163162_10026226 3300013306 Bacteria 5760
21 Ga0163162_10528992 3300013306 Bacteria 1308
22 Ga0163162_11042217 3300013306 Bacteria 926
23 Ga0206352_11043788 3300020078 Bacteria 1071
24 Ga0224712_10109121 3300022467 Bacteria 1185
25 Ga0209646_1000013 3300025246 Bacteria 565830
26 Ga0207655_1000478 3300025728 Bacteria 51594
27 Ga0207655_1124898 3300025728 Bacteria 847
28 Ga0207671_10157521 3300025914 Bacteria 1757
29 Ga0207709_10014257 3300025935 Bacteria 4386
30 Ga0209813_10075036 3300027866 Bacteria 1107
31 Ga0307408_100080898 3300031548 Bacteria 2428
32 Ga0307405_10687646 3300031731 Bacteria 846
33 Ga0307413_10127299 3300031824 Bacteria 1737
34 Ga0307406_10000031 3300031901 Bacteria 87391
35 Ga0307406_10003261 3300031901 Bacteria 8843
36 Ga0307406_10024974 3300031901 Bacteria 3573
37 Ga0307406_10040143 3300031901 Bacteria 2908
38 Ga0307412_10116302 3300031911 Bacteria 1918
39 Ga0307409_100449512 3300031995 Bacteria 1243
40 Ga0307414_10348581 3300032004 Bacteria 1270
41 Ga0307415_100110484 3300032126 Bacteria 2039
42 Ga0307415_100414620 3300032126 Bacteria 1154
43 Ga0395900_0285214 3300037418 Bacteria 1642
44 Ga0395898_0111819 3300037466 Bacteria 2617
45 Ga0451789_0266319 3300041443 Bacteria 735
46 Ga0451795_0608337 3300041456 Bacteria 1292
47 Ga0451841_1325375 3300041498 Bacteria 1481
48 Ga0466972_0149871 3300044658 Bacteria 1097
49 Ga0466965_0000006 3300044683 Bacteria 158069
50 Ga0466965_0051723 3300044683 Bacteria 2038
51 Ga0466965_0117574 3300044683 Bacteria 1371
52 Ga0495627_000281 3300046453 Bacteria 51226
53 Ga0495654_0036986 3300046530 Bacteria 2451
54 Ga0495645_0031958 3300046543 Bacteria 3838
55 Ga0495671_0114799 3300046692 Bacteria 1315
56 Ga0496100_0041800 3300048903 Bacteria 2924
57 Ga0496104_0131633 3300048907 Bacteria 2403
58 Ga0496104_0216586 3300048907 Bacteria 1827
59 Ga0496105_0110979 3300048908 Bacteria 2264
60 Ga0496105_0130351 3300048908 Bacteria 2073
61 Ga0496105_0331698 3300048908 Bacteria 1217
62 Ga0496106_0213107 3300048909 Bacteria 1539
63 Ga0496107_0082824 3300048910 Bacteria 2339
64 Ga0496108_0028052 3300048911 Bacteria 4657
65 Ga0496109_0176067 3300048912 Bacteria 2008
66 Ga0496109_0806746 3300048912 Bacteria 876
67 Ga0496110_0048313 3300048913 Bacteria 3730
68 Ga0496111_0133307 3300048914 Bacteria 1839
69 Ga0496112_0217914 3300048915 Bacteria 1865
70 Ga0496113_0208375 3300048916 Bacteria 1555
71 Ga0496113_0338244 3300048916 Bacteria 1207
72 Ga0496114_0025572 3300048917 Bacteria 4826
73 Ga0496114_0071194 3300048917 Bacteria 2922
74 Ga0496114_0210134 3300048917 Bacteria 1707
75 Ga0496114_0218256 3300048917 Bacteria 1674
76 Ga0496114_0516870 3300048917 Bacteria 1056
77 Ga0496115_0106145 3300048918 Bacteria 2306
78 Ga0496115_0254667 3300048918 Bacteria 1444
79 Ga0496116_0144400 3300048919 Bacteria 1332
80 Ga0496117_0000726 3300048920 Bacteria 51736
81 Ga0496117_0001389 3300048920 Bacteria 35115
82 Ga0496117_0002459 3300048920 Bacteria 23346
83 Ga0496117_0081806 3300048920 Bacteria 2117
84 Ga0496118_0020592 3300048921 Bacteria 5843
85 Ga0496118_0025514 3300048921 Bacteria 5064
86 Ga0496118_0026409 3300048921 Bacteria 4949
87 Ga0496118_0239269 3300048921 Bacteria 1041
88 Ga0496119_0000295 3300048922 Bacteria 69951
89 Ga0496119_0001555 3300048922 Bacteria 27348
90 Ga0496119_0002906 3300048922 Bacteria 18278
91 Ga0496119_0011906 3300048922 Bacteria 7137
92 Ga0496119_0047956 3300048922 Bacteria 2653
93 Ga0496119_0069581 3300048922 Bacteria 2068
94 Ga0496119_0223557 3300048922 Bacteria 962
95 Ga0496119_0261499 3300048922 Bacteria 868
96 Ga0496120_0000878 3300048923 Bacteria 42397
97 Ga0496120_0002390 3300048923 Bacteria 19120
98 Ga0496120_0021329 3300048923 Bacteria 4095
99 Ga0496120_0031366 3300048923 Bacteria 3219
100 Ga0496121_0199616 3300048924 Bacteria 1427
101 Ga0496122_0000096 3300048925 Bacteria 200503
102 Ga0496122_0000420 3300048925 Bacteria 89921
103 Ga0496122_0012766 3300048925 Bacteria 8313
104 Ga0496122_0015818 3300048925 Bacteria 7187
105 Ga0496122_0043185 3300048925 Bacteria 3535
106 Ga0496122_0073910 3300048925 Bacteria 2414
107 Ga0496123_0000031 3300048926 Bacteria 287596
108 Ga0496123_0000354 3300048926 Bacteria 86153
109 Ga0496123_0005208 3300048926 Bacteria 13209
110 Ga0496123_0074561 3300048926 Bacteria 2100
111 Ga0496124_0003278 3300048927 Bacteria 19991
112 Ga0496124_0003766 3300048927 Bacteria 18240
113 Ga0496124_0031425 3300048927 Bacteria 4700
114 Ga0496124_0066529 3300048927 Bacteria 3001
115 Ga0496124_0249178 3300048927 Bacteria 1315
116 Ga0496124_0264725 3300048927 Bacteria 1263
117 Ga0496125_0001190 3300048928 Bacteria 39358
118 Ga0496125_0001500 3300048928 Bacteria 33438
119 Ga0496125_0006242 3300048928 Bacteria 12963
120 Ga0496125_0009810 3300048928 Bacteria 9757
121 Ga0496125_0016274 3300048928 Bacteria 7148
122 Ga0496125_0044776 3300048928 Bacteria 3735
123 Ga0496125_0219203 3300048928 Bacteria 1227
124 Ga0496126_0001649 3300048929 Bacteria 33603
125 Ga0496126_0012317 3300048929 Bacteria 8774
126 Ga0496126_0022893 3300048929 Bacteria 6065
127 Ga0496126_0027957 3300048929 Bacteria 5378
128 Ga0496126_0037732 3300048929 Bacteria 4505
129 Ga0496126_0091194 3300048929 Bacteria 2680
130 Ga0501032_0024056 3300049569 Bacteria 4207
131 Ga0501032_0049305 3300049569 Bacteria 2840
132 Ga0501033_0101099 3300049570 Bacteria 2103
133 Ga0501033_0714188 3300049570 Bacteria 681
134 Ga0501034_0022593 3300049571 Bacteria 6408
135 Ga0501034_0031429 3300049571 Bacteria 5392
136 Ga0501034_0066619 3300049571 Bacteria 3614
137 Ga0501034_0068282 3300049571 Bacteria 3565
138 Ga0501034_0313650 3300049571 Bacteria 1502
139 Ga0501034_0387110 3300049571 Bacteria 1322
140 Ga0501036_0148749 3300049572 Bacteria 1975
141 Ga0501037_0022491 3300049573 Bacteria 4664
142 Ga0501037_0269106 3300049573 Bacteria 1189
143 Ga0501038_0018869 3300049574 Bacteria 6226
144 Ga0501038_0026773 3300049574 Bacteria 5133
145 Ga0501038_0049840 3300049574 Bacteria 3619
146 Ga0501038_0070777 3300049574 Bacteria 2960
147 Ga0501038_0177554 3300049574 Bacteria 1720
148 Ga0501039_0329653 3300049575 Bacteria 1200
149 Ga0501039_0354879 3300049575 Bacteria 1152
150 Ga0501043_0121552 3300049579 Bacteria 2048
151 Ga0501043_0702393 3300049579 Bacteria 739
152 Ga0501067_0177287 3300049583 Bacteria 1187
153 Ga0501068_0287746 3300049584 Bacteria 1051
154 Ga0501070_0024033 3300049586 Bacteria 5110
155 Ga0501070_0318940 3300049586 Bacteria 1264
156 Ga0501035_0428057 3300049822 Bacteria 1098
157 Ga0501044_0109260 3300049823 Bacteria 2775
158 Ga0501045_0590216 3300049824 Bacteria 823
159 nmdc:mga00v17_134182_c1 3300050491 Bacteria 1584
160 nmdc:mga00v17_257214_c1 3300050491 Bacteria 1132
161 nmdc:mga0yw44_108040_c1 3300050492 Bacteria 1780
162 nmdc:mga07m45_148639_c1 3300050496 Bacteria 1033
163 Ga0500593_091834 3300053117 Bacteria 1283
164 Ga0500568_0000337 3300053139 Bacteria 36917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0313650 Ga0501034_0313650_759_1400 187
2 3300044683 Ga0466965_0000006 Ga0466965_0000006_40183_40824 189
3 3300049571 Ga0501034_0031429 Ga0501034_0031429_4203_4844 189
4 3300049574 Ga0501038_0018869 Ga0501038_0018869_2179_2820 189
5 3300049569 Ga0501032_0049305 Ga0501032_0049305_1639_2280 190
6 3300049571 Ga0501034_0066619 Ga0501034_0066619_1676_2317 190
7 3300049574 Ga0501038_0177554 Ga0501038_0177554_456_1097 190
8 3300049823 Ga0501044_0109260 Ga0501044_0109260_1131_1772 190
9 3300053139 Ga0500568_0000337 Ga0500568_0000337_4834_5466 191
10 3300049569 Ga0501032_0024056 Ga0501032_0024056_515_1147 196
11 3300049570 Ga0501033_0101099 Ga0501033_0101099_817_1449 196
12 3300049571 Ga0501034_0387110 Ga0501034_0387110_407_1039 196
13 3300049572 Ga0501036_0148749 Ga0501036_0148749_888_1520 196
14 3300049573 Ga0501037_0022491 Ga0501037_0022491_3349_3981 196
15 3300049574 Ga0501038_0070777 Ga0501038_0070777_448_1080 196
16 3300049575 Ga0501039_0354879 Ga0501039_0354879_423_1055 196
17 3300049579 Ga0501043_0121552 Ga0501043_0121552_1179_1811 196
18 3300049583 Ga0501067_0177287 Ga0501067_0177287_369_1001 196
19 3300049584 Ga0501068_0287746 Ga0501068_0287746_26_658 196
20 3300049822 Ga0501035_0428057 Ga0501035_0428057_270_902 196
21 3300049824 Ga0501045_0590216 Ga0501045_0590216_71_703 196
22 3300032126 Ga0307415_100414620 Ga0307415_1004146202 201
23 3300048924 Ga0496121_0199616 Ga0496121_0199616_20_625 201
24 iso_pu_bacteria 2946041624 2946045051 204
25 iso_pu_bacteria 2585428157 2588109256 205
26 iso_pu_bacteria 2643221542 2643732410 205
27 iso_pu_bacteria 2643221546 2643754403 205
28 iso_pu_bacteria 2643221553 2643786483 205
29 iso_pu_bacteria 2643221575 2643886333 205
30 iso_pu_bacteria 2643221597 2643995172 205
31 iso_pu_bacteria 2643221630 2644171230 205
32 iso_pu_bacteria 2643221724 2644681182 205
33 iso_pu_bacteria 2728369380 2730230385 205
34 iso_pu_bacteria 2747842429 2747952236 205
35 iso_pu_bacteria 2757320536 2758226788 205
36 iso_pu_bacteria 2773857758 2774380831 205
37 iso_pu_bacteria 2808606306 2808630461 205
38 iso_pu_bacteria 2808606368 2808883412 205
39 iso_pu_bacteria 2808606447 2809228062 205
40 iso_pu_bacteria 2833709550 2833711792 205
41 iso_pu_bacteria 2852632344 2852634771 205
42 iso_pu_bacteria 2852646457 2852648991 205
43 iso_pu_bacteria 2852663356 2852664251 205
44 iso_pu_bacteria 2857720070 2857720653 205
45 iso_pu_bacteria 2857723135 2857724790 205
46 iso_pu_bacteria 2870628048 2870631014 205
47 iso_pu_bacteria 2904509784 2904511283 205
48 iso_pu_bacteria 2906799679 2906801896 205
49 iso_pu_bacteria 2908678064 2908679996 205
50 iso_pu_bacteria 2919069694 2919072174 205
51 iso_pu_bacteria 2919395869 2919398095 205
52 iso_pu_bacteria 2928090899 2928091432 205
53 iso_pu_bacteria 2946033335 2946036735 205
54 iso_pu_bacteria 2946080515 2946084198 205
55 iso_pu_bacteria 2974294766 2974296650 205
56 iso_pu_bacteria 2974324384 2974327115 205
57 iso_pu_bacteria 2977228692 2977228777 205
58 iso_pu_bacteria 2977236895 2977237605 205
59 iso_pu_bacteria 2977264416 2977267469 205
60 iso_pu_bacteria 2984542743 2984544611 205
61 iso_pu_bacteria 2984580707 2984581823 205
62 iso_pu_bacteria 8004182704 8004184667 205
63 iso_pu_bacteria 8004212874 8004214804 205
64 iso_pu_bacteria 8016254467 8016256864 205
65 3300031901 Ga0307406_10024974 Ga0307406_100249741 208
66 3300032004 Ga0307414_10348581 Ga0307414_103485812 208
67 3300044683 Ga0466965_0117574 Ga0466965_0117574_589_1221 208
68 3300049586 Ga0501070_0318940 Ga0501070_0318940_248_880 208
69 3300002738 JGI25154J39366_1004108 JGI25154J39366_10041082 209
70 3300003578 Ga0006562J51391_1023980 Ga0006562J51391_10239804 209
71 3300005327 Ga0070658_10251265 Ga0070658_102512651 209
72 3300005347 Ga0070668_100387755 Ga0070668_1003877551 209
73 3300005548 Ga0070665_100147661 Ga0070665_1001476614 209
74 3300006038 Ga0075365_10023426 Ga0075365_100234262 209
75 3300006042 Ga0075368_10088513 Ga0075368_100885132 209
76 3300006048 Ga0075363_100341165 Ga0075363_1003411651 209
77 3300006051 Ga0075364_10041879 Ga0075364_100418794 209
78 3300006051 Ga0075364_10150419 Ga0075364_101504192 209
79 3300006178 Ga0075367_10064230 Ga0075367_100642302 209
80 3300006186 Ga0075369_10093857 Ga0075369_100938572 209
81 3300006353 Ga0075370_10372381 Ga0075370_103723812 209
82 3300009036 Ga0105244_10243174 Ga0105244_102431742 209
83 3300009036 Ga0105244_10243664 Ga0105244_102436642 209
84 3300009545 Ga0105237_10169346 Ga0105237_101693462 209
85 3300010375 Ga0105239_10146845 Ga0105239_101468451 209
86 3300013104 Ga0157370_10055095 Ga0157370_100550952 209
87 3300013250 Ga0171462_1004 Ga0171462_1004371 209
88 3300013306 Ga0163162_10026226 Ga0163162_100262264 209
89 3300013306 Ga0163162_10528992 Ga0163162_105289922 209
90 3300013306 Ga0163162_11042217 Ga0163162_110422171 209
91 3300020078 Ga0206352_11043788 Ga0206352_110437881 209
92 3300022467 Ga0224712_10109121 Ga0224712_101091211 209
93 3300025246 Ga0209646_1000013 Ga0209646_1000013123 209
94 3300025728 Ga0207655_1000478 Ga0207655_10004784 209
95 3300025728 Ga0207655_1124898 Ga0207655_11248981 209
96 3300025914 Ga0207671_10157521 Ga0207671_101575212 209
97 3300025935 Ga0207709_10014257 Ga0207709_100142572 209
98 3300027866 Ga0209813_10075036 Ga0209813_100750362 209
99 3300031548 Ga0307408_100080898 Ga0307408_1000808983 209
100 3300031731 Ga0307405_10687646 Ga0307405_106876461 209
101 3300031824 Ga0307413_10127299 Ga0307413_101272992 209
102 3300031901 Ga0307406_10000031 Ga0307406_1000003158 209
103 3300031901 Ga0307406_10003261 Ga0307406_100032616 209
104 3300031901 Ga0307406_10040143 Ga0307406_100401435 209
105 3300031911 Ga0307412_10116302 Ga0307412_101163022 209
106 3300031995 Ga0307409_100449512 Ga0307409_1004495121 209
107 3300032126 Ga0307415_100110484 Ga0307415_1001104844 209
108 3300037418 Ga0395900_0285214 Ga0395900_0285214_162_791 209
109 3300037466 Ga0395898_0111819 Ga0395898_0111819_104_733 209
110 3300041443 Ga0451789_0266319 Ga0451789_0266319_43_681 209
111 3300041456 Ga0451795_0608337 Ga0451795_0608337_156_794 209
112 3300041498 Ga0451841_1325375 Ga0451841_1325375_763_1392 209
113 3300044658 Ga0466972_0149871 Ga0466972_0149871_110_745 209
114 3300044683 Ga0466965_0051723 Ga0466965_0051723_840_1550 209
115 3300046453 Ga0495627_000281 Ga0495627_000281_46533_47162 209
116 3300046530 Ga0495654_0036986 Ga0495654_0036986_545_1183 209
117 3300046543 Ga0495645_0031958 Ga0495645_0031958_2461_3099 209
118 3300046692 Ga0495671_0114799 Ga0495671_0114799_372_1013 209
119 3300048903 Ga0496100_0041800 Ga0496100_0041800_1648_2340 209
120 3300048907 Ga0496104_0131633 Ga0496104_0131633_915_1553 209
121 3300048907 Ga0496104_0216586 Ga0496104_0216586_959_1597 209
122 3300048908 Ga0496105_0110979 Ga0496105_0110979_51_689 209
123 3300048908 Ga0496105_0130351 Ga0496105_0130351_1409_2047 209
124 3300048908 Ga0496105_0331698 Ga0496105_0331698_69_761 209
125 3300048909 Ga0496106_0213107 Ga0496106_0213107_249_941 209
126 3300048910 Ga0496107_0082824 Ga0496107_0082824_1210_1902 209
127 3300048911 Ga0496108_0028052 Ga0496108_0028052_1506_2144 209
128 3300048912 Ga0496109_0176067 Ga0496109_0176067_1270_1962 209
129 3300048912 Ga0496109_0806746 Ga0496109_0806746_63_701 209
130 3300048913 Ga0496110_0048313 Ga0496110_0048313_2007_2699 209
131 3300048914 Ga0496111_0133307 Ga0496111_0133307_77_769 209
132 3300048915 Ga0496112_0217914 Ga0496112_0217914_1117_1809 209
133 3300048916 Ga0496113_0208375 Ga0496113_0208375_645_1337 209
134 3300048916 Ga0496113_0338244 Ga0496113_0338244_369_1007 209
135 3300048917 Ga0496114_0025572 Ga0496114_0025572_1164_1802 209
136 3300048917 Ga0496114_0071194 Ga0496114_0071194_50_688 209
137 3300048917 Ga0496114_0210134 Ga0496114_0210134_89_781 209
138 3300048917 Ga0496114_0218256 Ga0496114_0218256_100_795 209
139 3300048917 Ga0496114_0516870 Ga0496114_0516870_395_1033 209
140 3300048918 Ga0496115_0106145 Ga0496115_0106145_84_722 209
141 3300048918 Ga0496115_0254667 Ga0496115_0254667_310_1002 209
142 3300048919 Ga0496116_0144400 Ga0496116_0144400_447_1085 209
143 3300048920 Ga0496117_0000726 Ga0496117_0000726_14181_14810 209
144 3300048920 Ga0496117_0001389 Ga0496117_0001389_3817_4455 209
145 3300048920 Ga0496117_0002459 Ga0496117_0002459_18699_19340 209
146 3300048920 Ga0496117_0081806 Ga0496117_0081806_576_1214 209
147 3300048921 Ga0496118_0020592 Ga0496118_0020592_3486_4124 209
148 3300048921 Ga0496118_0025514 Ga0496118_0025514_744_1385 209
149 3300048921 Ga0496118_0026409 Ga0496118_0026409_1897_2526 209
150 3300048921 Ga0496118_0239269 Ga0496118_0239269_337_975 209
151 3300048922 Ga0496119_0000295 Ga0496119_0000295_54549_55262 209
152 3300048922 Ga0496119_0001555 Ga0496119_0001555_14489_15130 209
153 3300048922 Ga0496119_0002906 Ga0496119_0002906_2363_3001 209
154 3300048922 Ga0496119_0011906 Ga0496119_0011906_2433_3071 209
155 3300048922 Ga0496119_0047956 Ga0496119_0047956_843_1535 209
156 3300048922 Ga0496119_0069581 Ga0496119_0069581_46_675 209
157 3300048922 Ga0496119_0223557 Ga0496119_0223557_124_762 209
158 3300048922 Ga0496119_0261499 Ga0496119_0261499_35_673 209
159 3300048923 Ga0496120_0000878 Ga0496120_0000878_18452_19090 209
160 3300048923 Ga0496120_0002390 Ga0496120_0002390_18191_18829 209
161 3300048923 Ga0496120_0021329 Ga0496120_0021329_1108_1746 209
162 3300048923 Ga0496120_0031366 Ga0496120_0031366_221_862 209
163 3300048925 Ga0496122_0000096 Ga0496122_0000096_62122_62760 209
164 3300048925 Ga0496122_0000420 Ga0496122_0000420_2398_3039 209
165 3300048925 Ga0496122_0012766 Ga0496122_0012766_5249_5878 209
166 3300048925 Ga0496122_0015818 Ga0496122_0015818_4112_4750 209
167 3300048925 Ga0496122_0043185 Ga0496122_0043185_897_1526 209
168 3300048925 Ga0496122_0073910 Ga0496122_0073910_497_1135 209
169 3300048926 Ga0496123_0000031 Ga0496123_0000031_93142_93780 209
170 3300048926 Ga0496123_0000354 Ga0496123_0000354_52099_52740 209
171 3300048926 Ga0496123_0005208 Ga0496123_0005208_10069_10707 209
172 3300048926 Ga0496123_0074561 Ga0496123_0074561_592_1230 209
173 3300048927 Ga0496124_0003278 Ga0496124_0003278_3278_3916 209
174 3300048927 Ga0496124_0003766 Ga0496124_0003766_4010_4651 209
175 3300048927 Ga0496124_0031425 Ga0496124_0031425_1733_2371 209
176 3300048927 Ga0496124_0066529 Ga0496124_0066529_1518_2156 209
177 3300048927 Ga0496124_0249178 Ga0496124_0249178_553_1182 209
178 3300048927 Ga0496124_0264725 Ga0496124_0264725_387_1025 209
179 3300048928 Ga0496125_0001190 Ga0496125_0001190_31923_32561 209
180 3300048928 Ga0496125_0001500 Ga0496125_0001500_1712_2350 209
181 3300048928 Ga0496125_0006242 Ga0496125_0006242_2467_3096 209
182 3300048928 Ga0496125_0009810 Ga0496125_0009810_6607_7245 209
183 3300048928 Ga0496125_0016274 Ga0496125_0016274_4033_4674 209
184 3300048928 Ga0496125_0044776 Ga0496125_0044776_1498_2127 209
185 3300048928 Ga0496125_0219203 Ga0496125_0219203_44_673 209
186 3300048929 Ga0496126_0001649 Ga0496126_0001649_30547_31185 209
187 3300048929 Ga0496126_0012317 Ga0496126_0012317_3074_3715 209
188 3300048929 Ga0496126_0022893 Ga0496126_0022893_2381_3010 209
189 3300048929 Ga0496126_0027957 Ga0496126_0027957_4313_4951 209
190 3300048929 Ga0496126_0037732 Ga0496126_0037732_720_1349 209
191 3300048929 Ga0496126_0091194 Ga0496126_0091194_1815_2444 209
192 3300049570 Ga0501033_0714188 Ga0501033_0714188_25_663 209
193 3300049571 Ga0501034_0022593 Ga0501034_0022593_2171_2800 209
194 3300049571 Ga0501034_0068282 Ga0501034_0068282_2093_2722 209
195 3300049573 Ga0501037_0269106 Ga0501037_0269106_327_956 209
196 3300049574 Ga0501038_0026773 Ga0501038_0026773_2616_3245 209
197 3300049574 Ga0501038_0049840 Ga0501038_0049840_2374_3003 209
198 3300049575 Ga0501039_0329653 Ga0501039_0329653_85_804 209
199 3300049579 Ga0501043_0702393 Ga0501043_0702393_23_718 209
200 3300049586 Ga0501070_0024033 Ga0501070_0024033_2626_3351 209
201 3300050491 nmdc:mga00v17_134182_c1 nmdc:mga00v17_134182_c1_208_837 209
202 3300050491 nmdc:mga00v17_257214_c1 nmdc:mga00v17_257214_c1_388_1017 209
203 3300050492 nmdc:mga0yw44_108040_c1 nmdc:mga0yw44_108040_c1_853_1491 209
204 3300050496 nmdc:mga07m45_148639_c1 nmdc:mga07m45_148639_c1_236_874 209
205 3300053117 Ga0500593_091834 Ga0500593_091834_333_971 209
206 iso_pu_bacteria 2643221566 2643848998 209
207 iso_pu_bacteria 2773857763 2774398653 209
208 iso_pu_bacteria 2811994872 2812324091 209
209 iso_pu_bacteria 8045830549 8045834375 209

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6o-assembly1.cif.gz_B crystal structure of human dlp1 in complex with gmp-pcp 0.6407 125 197
8d74-assembly1.cif.gz_D cryo-em structure of human cntf signaling complex: model containing the interaction core region 0.5649 77 204
5ww9-assembly1.cif.gz_A crystal structure of r73e mutant of the second dna-binding protein under starvation from mycobacterium smegmatis 0.4974 93 197
2z90-assembly1.cif.gz_C crystal structure of the second dps from mycobacterium smegmatis 0.496 92 197
4m34-assembly1.cif.gz_D crystal structure of gated-pore mutant d138h of second dna-binding protein under starvation from mycobacterium smegmatis 0.4937 92 197
ID Description Score Start End Superfamily
af_Q54M04_26_219_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9895 154 196 1.50.10.10
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.5701 85 197 1.20.1440.60
af_P20294_1_187_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.5613 82 204 1.20.1250.10
af_F4K786_323_434_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5584 126 206 1.25.40.10
2z90A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.5481 97 197 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A358DC07-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.9731 80 209 GO:0000428
AF-A0A1M3AL93-F1-model_v4 deleted 0.9603 23 209
AF-A0A358DC07-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.9586 80 209 GO:0000428
AF-A0A1M3AL93-F1-model_v4 deleted 0.9553 23 209
AF-A0A7W9DCC1-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.9477 32 209

Feature Viewer

pLDDT pTM Quality
87.14 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map