F319840

General Info

Members Datasets Scaffolds Average Seq Length
210 138 420 379

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000774|JGI25162J39368_10007743
Length 426
Sequence LFFDCTFCVINRHDGFIGVYTPQQIPIFNTLTYICYKLKELQDIVNAFNMAVKTGRQTALATVVLVEGSSYRRAGARMLVTDDGQLTGAISGGCLEGDALRKARLAMAHTRPMLVTYDTTDDDDAKFGVGLGCNGIIHILIEPIDPDKEDTPISLLKQFLSKREPVVLITMFSLKERQASQPGTCLLMCNDKQTRGSIPDNEIKTALLRDAAEVLANGNSVTKTYVYGNGYTCFIELLRPAVSLMIFGAGNDAIPLVQFANVLGWQVTLVDGRANYAVPQRFPSVNKILIAKPEQVLPQLYFDDRTVVVLMTHNYNYDMAMLQQLLPLQLPYVASLGPKKRLQRMLTELKDNGIIITTEQLNSIYGPAGIDIGSENADEIALSIIAEIQAVLNNRTVSSLRDKTSVHNRHIQQVLQQTDGEFKAFN

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
122 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
123 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
128 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
129 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
130 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
131 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
132 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
133 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
134 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
135 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
136 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
137 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
138 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.81
Metatranscriptomes 0.95
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.14
Nodule 0
Rhizoplane 0.48
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000774 3300002737 Bacteria 21551
2 JGI24737J22298_10003274 3300001990 Bacteria 5744
3 JGI24737J22298_10016020 3300001990 Bacteria 2420
4 JGI24735J21928_10000004 3300002067 Bacteria 381713
5 JGI25162J39368_1000292 3300002737 Bacteria 46381
6 JGI25154J39366_1000005 3300002738 Bacteria 345115
7 JGI25165J46597_1001445 3300003214 Bacteria 12601
8 JGI25153J46596_10016224 3300003215 Bacteria 2995
9 rootH1_10017068 3300003316 Bacteria 8847
10 rootH2_10005500 3300003320 Bacteria 68238
11 rootH2_10162172 3300003320 Bacteria 2565
12 rootH1_10009528 3300003323 Bacteria 31356
13 rootH1_10071763 3300003323 Bacteria 10790
14 rootH1_10108398 3300003323 Bacteria 2490
15 rootH1_10370954 3300003323 Bacteria 2306
16 JGI25160J50197_1017458 3300003354 Bacteria 2272
17 Ga0055526_1017841 3300003771 Bacteria 2685
18 Ga0055528_1000105 3300003790 Bacteria 67910
19 Ga0058863_11615853 3300004799 Bacteria 1424
20 Ga0058862_11959936 3300004803 Bacteria 1561
21 Ga0065165_1000168 3300005262 Bacteria 115574
22 Ga0065714_10004282 3300005288 Bacteria 6495
23 Ga0070658_10000073 3300005327 Bacteria 96498
24 Ga0070658_10016212 3300005327 Bacteria 5962
25 Ga0068869_100016079 3300005334 Bacteria 5037
26 Ga0070666_10000050 3300005335 Bacteria 100280
27 Ga0070674_100025331 3300005356 Bacteria 3861
28 Ga0070659_100000640 3300005366 Bacteria 25630
29 Ga0070659_100006161 3300005366 Bacteria 8658
30 Ga0070667_100049300 3300005367 Bacteria 3546
31 Ga0070681_10163995 3300005458 Bacteria 2146
32 Ga0070679_100041499 3300005530 Bacteria 4578
33 Ga0068855_100000226 3300005563 Bacteria 72130
34 Ga0068855_100008956 3300005563 Bacteria 12100
35 Ga0068855_100012697 3300005563 Bacteria 10164
36 Ga0068855_100055810 3300005563 Bacteria 4637
37 Ga0068855_100148189 3300005563 Unclassified 2670
38 Ga0068857_100021988 3300005577 Bacteria 5613
39 Ga0068854_100044792 3300005578 Bacteria 3143
40 Ga0068856_100000044 3300005614 Bacteria 111437
41 Ga0068856_100015723 3300005614 Bacteria 7317
42 Ga0068852_100003986 3300005616 Bacteria 10377
43 Ga0068859_100000025 3300005617 Bacteria 191679
44 Ga0068864_100012580 3300005618 Bacteria 6996
45 Ga0068863_100063617 3300005841 Bacteria 3489
46 Ga0068858_100018416 3300005842 Bacteria 6537
47 Ga0075366_10000123 3300006195 Bacteria 32043
48 Ga0075366_10000490 3300006195 Bacteria 18314
49 Ga0097621_100030922 3300006237 Bacteria 4242
50 Ga0068871_100002075 3300006358 Bacteria 13555
51 Ga0097620_100000025 3300006931 Bacteria 191679
52 Ga0105240_10010268 3300009093 Bacteria 13181
53 Ga0105240_10065114 3300009093 Bacteria 4525
54 Ga0105240_10185199 3300009093 Bacteria 2453
55 Ga0105247_10005807 3300009101 Bacteria 7719
56 Ga0105241_10005149 3300009174 Bacteria 9644
57 Ga0105237_10005071 3300009545 Bacteria 14963
58 Ga0105237_10009007 3300009545 Bacteria 10732
59 Ga0105237_10014702 3300009545 Bacteria 8172
60 Ga0105237_10022673 3300009545 Bacteria 6441
61 Ga0105249_10006762 3300009553 Bacteria 9991
62 Ga0105239_10000012 3300010375 Bacteria 332279
63 Ga0105239_10000305 3300010375 Bacteria 72644
64 Ga0105239_10000959 3300010375 Bacteria 40551
65 Ga0157373_10000249 3300013100 Bacteria 44077
66 Ga0157373_10000464 3300013100 Bacteria 32220
67 Ga0157371_10000617 3300013102 Bacteria 42318
68 Ga0157371_10012452 3300013102 Bacteria 6501
69 Ga0157371_10175633 3300013102 Bacteria 1531
70 Ga0157370_10104123 3300013104 Unclassified 2656
71 Ga0157369_10009731 3300013105 Bacteria 10993
72 Ga0163162_10000344 3300013306 Bacteria 42218
73 Ga0163162_10002223 3300013306 Bacteria 18226
74 Ga0163162_10005913 3300013306 Bacteria 11836
75 Ga0163162_10016706 3300013306 Bacteria 7174
76 Ga0157372_10000483 3300013307 Bacteria 44004
77 Ga0157372_10003543 3300013307 Bacteria 16828
78 Ga0157372_10041160 3300013307 Bacteria 5108
79 Ga0157376_10007363 3300014969 Bacteria 7848
80 Ga0207427_100766 3300025231 Bacteria 14625
81 Ga0209437_100041 3300025233 Bacteria 444465
82 Ga0209437_100052 3300025233 Bacteria 380548
83 Ga0209646_1000017 3300025246 Bacteria 488265
84 Ga0209026_1000279 3300025250 Bacteria 59283
85 Ga0209026_1000296 3300025250 Bacteria 54741
86 Ga0209026_1002658 3300025250 Bacteria 6493
87 Ga0209026_1003317 3300025250 Bacteria 5358
88 Ga0209129_1004915 3300025258 Bacteria 4984
89 Ga0209233_1000067 3300025261 Bacteria 380554
90 Ga0209673_1000107 3300025273 Bacteria 184825
91 Ga0209564_1003679 3300025295 Bacteria 10121
92 Ga0209564_1005434 3300025295 Bacteria 7281
93 Ga0209758_1003306 3300025297 Bacteria 14924
94 Ga0209758_1008369 3300025297 Bacteria 6726
95 Ga0209758_1009784 3300025297 Bacteria 5875
96 Ga0209050_1000476 3300025298 Bacteria 70845
97 Ga0207426_1001102 3300025302 Bacteria 24863
98 Ga0207426_1002505 3300025302 Bacteria 11575
99 Ga0207426_1009290 3300025302 Bacteria 3903
100 Ga0207680_10000086 3300025903 Bacteria 42622
101 Ga0207647_10000043 3300025904 Bacteria 91109
102 Ga0207647_10103032 3300025904 Bacteria 1692
103 Ga0207705_10000225 3300025909 Bacteria 56142
104 Ga0207707_10033953 3300025912 Bacteria 4465
105 Ga0207695_10044060 3300025913 Bacteria 4749
106 Ga0207695_10235754 3300025913 Bacteria 1732
107 Ga0207671_10001801 3300025914 Bacteria 23958
108 Ga0207671_10003741 3300025914 Bacteria 14990
109 Ga0207671_10008467 3300025914 Bacteria 8720
110 Ga0207671_10014756 3300025914 Bacteria 6159
111 Ga0207657_10023212 3300025919 Bacteria 5782
112 Ga0207652_10036142 3300025921 Bacteria 4176
113 Ga0207690_10001736 3300025932 Bacteria 13382
114 Ga0207690_10024039 3300025932 Bacteria 3812
115 Ga0207689_10003687 3300025942 Bacteria 13959
116 Ga0207667_10000039 3300025949 Bacteria 278843
117 Ga0207667_10022290 3300025949 Bacteria 7000
118 Ga0207667_10053257 3300025949 Bacteria 4259
119 Ga0207667_10148144 3300025949 Unclassified 2416
120 Ga0207651_10100539 3300025960 Unclassified 2144
121 Ga0207712_10003644 3300025961 Bacteria 9703
122 Ga0207668_10014591 3300025972 Bacteria 4864
123 Ga0207640_10097344 3300025981 Bacteria 2054
124 Ga0207703_10010342 3300026035 Bacteria 7304
125 Ga0207702_10000140 3300026078 Bacteria 87544
126 Ga0207641_10000661 3300026088 Bacteria 37590
127 Ga0207676_10009979 3300026095 Bacteria 6756
128 Ga0207674_10059818 3300026116 Unclassified 3854
129 Ga0207698_10002995 3300026142 Bacteria 10135
130 Ga0268264_10002545 3300028381 Bacteria 15994
131 Ga0307515_10000162 3300028794 Bacteria 163720
132 Ga0307515_10000280 3300028794 Bacteria 125330
133 Ga0307515_10000353 3300028794 Bacteria 112876
134 Ga0265338_10126463 3300028800 Bacteria 2027
135 Ga0265327_10064600 3300031251 Bacteria 1854
136 Ga0307513_10075983 3300031456 Bacteria 3486
137 Ga0307509_10081127 3300031507 Bacteria 3352
138 Ga0307412_10050853 3300031911 Bacteria 2737
139 Ga0307414_10025091 3300032004 Bacteria 3811
140 Ga0307507_10000345 3300033179 Bacteria 94462
141 Ga0395899_0000001 3300037312 Bacteria 1750322
142 Ga0395901_0016117 3300038443 Bacteria 7613
143 Ga0466972_0005413 3300044658 Bacteria 6394
144 Ga0495650_0000023 3300046471 Bacteria 527763
145 Ga0495650_0000238 3300046471 Bacteria 110217
146 Ga0495585_0000071 3300046492 Bacteria 105916
147 Ga0495585_0003481 3300046492 Bacteria 10626
148 Ga0495583_0056799 3300046506 Bacteria 1763
149 Ga0495606_0000008 3300046507 Bacteria 321373
150 Ga0495606_0016272 3300046507 Bacteria 5679
151 Ga0495606_0033866 3300046507 Bacteria 3516
152 Ga0495610_0000880 3300046512 Bacteria 27919
153 Ga0495610_0070995 3300046512 Bacteria 1625
154 Ga0495616_0005811 3300046513 Bacteria 7538
155 Ga0495616_0008349 3300046513 Bacteria 6142
156 Ga0495644_0009348 3300046523 Bacteria 3780
157 Ga0495648_0017465 3300046524 Bacteria 5126
158 Ga0495648_0077957 3300046524 Bacteria 1897
159 Ga0495609_0008924 3300046538 Bacteria 4877
160 Ga0495633_0000029 3300046558 Bacteria 200381
161 Ga0495633_0015641 3300046558 Bacteria 3933
162 Ga0495668_0000070 3300046616 Bacteria 174051
163 Ga0495668_0000658 3300046616 Bacteria 41497
164 Ga0495625_0000017 3300046660 Bacteria 299728
165 Ga0495625_0000018 3300046660 Bacteria 299567
166 Ga0495625_0001080 3300046660 Bacteria 35353
167 Ga0495625_0001647 3300046660 Bacteria 26189
168 Ga0495625_0022364 3300046660 Bacteria 4849
169 Ga0495625_0053307 3300046660 Bacteria 2893
170 Ga0495661_0001270 3300046665 Bacteria 21694
171 Ga0495661_0013013 3300046665 Bacteria 5605
172 Ga0495661_0017370 3300046665 Bacteria 4753
173 Ga0495649_0000008 3300046694 Bacteria 483706
174 Ga0495649_0000015 3300046694 Bacteria 246431
175 Ga0495660_0011741 3300046810 Bacteria 5079
176 Ga0495683_0069256 3300047323 Bacteria 1734
177 Ga0495687_000631 3300047443 Bacteria 40299
178 Ga0495687_045006 3300047443 Bacteria 1914
179 Ga0495686_0000106 3300047472 Bacteria 175852
180 Ga0495686_0012722 3300047472 Bacteria 5875
181 Ga0495686_0137520 3300047472 Bacteria 1444
182 Ga0495678_014950 3300049459 Bacteria 3591
183 Ga0495682_0032204 3300049460 Bacteria 1937
184 Ga0501033_0064647 3300049570 Unclassified 2692
185 Ga0501037_0132122 3300049573 Bacteria 1790
186 Ga0501223_000898 3300049663 Bacteria 7051
187 Ga0501035_0040333 3300049822 Bacteria 4220
188 Ga0501044_0068085 3300049823 Bacteria 3627
189 nmdc:mga0k408_128_c1 3300050493 Bacteria 37793
190 nmdc:mga0k408_16453_c1 3300050493 Bacteria 4105
191 nmdc:mga0k408_171_c1 3300050493 Bacteria 34186
192 Ga0500635_0000259 3300053080 Bacteria 21533
193 Ga0500635_0020833 3300053080 Bacteria 2013
194 Ga0500608_000134 3300053122 Bacteria 30077
195 Ga0500618_000037 3300053125 Bacteria 117320
196 Ga0500616_0000833 3300053153 Bacteria 34656
197 Ga0500622_0000844 3300053156 Bacteria 26216
198 Ga0500624_000177 3300053157 Bacteria 25324
199 Ga0500645_000279 3300053730 Bacteria 36588
200 2599480864 2599185184 Bacteria 6430550
201 2840679440 2840677318 Bacteria 2664183
202 2852623776 2852623160 Bacteria 4376875
203 2884937318 2884933994 Bacteria 4535041
204 2896087251 2896085136 Bacteria 6129793
205 2919438956 2919437846 Bacteria 6199444
206 2928080780 2928078545 Bacteria 6534839
207 2928151002 2928147474 Bacteria 6512076
208 2929925634 2929921140 Bacteria 8649150
209 2932087645 2932082852 Bacteria 6563563
210 8003153396 8003151029 Bacteria 8187759
211 JGI25162J39368_1000774
212 JGI24737J22298_10003274
213 JGI24737J22298_10016020
214 JGI24735J21928_10000004
215 JGI25162J39368_1000292
216 JGI25154J39366_1000005
217 JGI25165J46597_1001445
218 JGI25153J46596_10016224
219 rootH1_10017068
220 rootH2_10005500
221 rootH2_10162172
222 rootH1_10009528
223 rootH1_10071763
224 rootH1_10108398
225 rootH1_10370954
226 JGI25160J50197_1017458
227 Ga0055526_1017841
228 Ga0055528_1000105
229 Ga0058863_11615853
230 Ga0058862_11959936
231 Ga0065165_1000168
232 Ga0065714_10004282
233 Ga0070658_10000073
234 Ga0070658_10016212
235 Ga0068869_100016079
236 Ga0070666_10000050
237 Ga0070674_100025331
238 Ga0070659_100000640
239 Ga0070659_100006161
240 Ga0070667_100049300
241 Ga0070681_10163995
242 Ga0070679_100041499
243 Ga0068855_100000226
244 Ga0068855_100008956
245 Ga0068855_100012697
246 Ga0068855_100055810
247 Ga0068855_100148189
248 Ga0068857_100021988
249 Ga0068854_100044792
250 Ga0068856_100000044
251 Ga0068856_100015723
252 Ga0068852_100003986
253 Ga0068859_100000025
254 Ga0068864_100012580
255 Ga0068863_100063617
256 Ga0068858_100018416
257 Ga0075366_10000123
258 Ga0075366_10000490
259 Ga0097621_100030922
260 Ga0068871_100002075
261 Ga0097620_100000025
262 Ga0105240_10010268
263 Ga0105240_10065114
264 Ga0105240_10185199
265 Ga0105247_10005807
266 Ga0105241_10005149
267 Ga0105237_10005071
268 Ga0105237_10009007
269 Ga0105237_10014702
270 Ga0105237_10022673
271 Ga0105249_10006762
272 Ga0105239_10000012
273 Ga0105239_10000305
274 Ga0105239_10000959
275 Ga0157373_10000249
276 Ga0157373_10000464
277 Ga0157371_10000617
278 Ga0157371_10012452
279 Ga0157371_10175633
280 Ga0157370_10104123
281 Ga0157369_10009731
282 Ga0163162_10000344
283 Ga0163162_10002223
284 Ga0163162_10005913
285 Ga0163162_10016706
286 Ga0157372_10000483
287 Ga0157372_10003543
288 Ga0157372_10041160
289 Ga0157376_10007363
290 Ga0207427_100766
291 Ga0209437_100041
292 Ga0209437_100052
293 Ga0209646_1000017
294 Ga0209026_1000279
295 Ga0209026_1000296
296 Ga0209026_1002658
297 Ga0209026_1003317
298 Ga0209129_1004915
299 Ga0209233_1000067
300 Ga0209673_1000107
301 Ga0209564_1003679
302 Ga0209564_1005434
303 Ga0209758_1003306
304 Ga0209758_1008369
305 Ga0209758_1009784
306 Ga0209050_1000476
307 Ga0207426_1001102
308 Ga0207426_1002505
309 Ga0207426_1009290
310 Ga0207680_10000086
311 Ga0207647_10000043
312 Ga0207647_10103032
313 Ga0207705_10000225
314 Ga0207707_10033953
315 Ga0207695_10044060
316 Ga0207695_10235754
317 Ga0207671_10001801
318 Ga0207671_10003741
319 Ga0207671_10008467
320 Ga0207671_10014756
321 Ga0207657_10023212
322 Ga0207652_10036142
323 Ga0207690_10001736
324 Ga0207690_10024039
325 Ga0207689_10003687
326 Ga0207667_10000039
327 Ga0207667_10022290
328 Ga0207667_10053257
329 Ga0207667_10148144
330 Ga0207651_10100539
331 Ga0207712_10003644
332 Ga0207668_10014591
333 Ga0207640_10097344
334 Ga0207703_10010342
335 Ga0207702_10000140
336 Ga0207641_10000661
337 Ga0207676_10009979
338 Ga0207674_10059818
339 Ga0207698_10002995
340 Ga0268264_10002545
341 Ga0307515_10000162
342 Ga0307515_10000280
343 Ga0307515_10000353
344 Ga0265338_10126463
345 Ga0265327_10064600
346 Ga0307513_10075983
347 Ga0307509_10081127
348 Ga0307412_10050853
349 Ga0307414_10025091
350 Ga0307507_10000345
351 Ga0395899_0000001
352 Ga0395901_0016117
353 Ga0466972_0005413
354 Ga0495650_0000023
355 Ga0495650_0000238
356 Ga0495585_0000071
357 Ga0495585_0003481
358 Ga0495583_0056799
359 Ga0495606_0000008
360 Ga0495606_0016272
361 Ga0495606_0033866
362 Ga0495610_0000880
363 Ga0495610_0070995
364 Ga0495616_0005811
365 Ga0495616_0008349
366 Ga0495644_0009348
367 Ga0495648_0017465
368 Ga0495648_0077957
369 Ga0495609_0008924
370 Ga0495633_0000029
371 Ga0495633_0015641
372 Ga0495668_0000070
373 Ga0495668_0000658
374 Ga0495625_0000017
375 Ga0495625_0000018
376 Ga0495625_0001080
377 Ga0495625_0001647
378 Ga0495625_0022364
379 Ga0495625_0053307
380 Ga0495661_0001270
381 Ga0495661_0013013
382 Ga0495661_0017370
383 Ga0495649_0000008
384 Ga0495649_0000015
385 Ga0495660_0011741
386 Ga0495683_0069256
387 Ga0495687_000631
388 Ga0495687_045006
389 Ga0495686_0000106
390 Ga0495686_0012722
391 Ga0495686_0137520
392 Ga0495678_014950
393 Ga0495682_0032204
394 Ga0501033_0064647
395 Ga0501037_0132122
396 Ga0501223_000898
397 Ga0501035_0040333
398 Ga0501044_0068085
399 nmdc:mga0k408_128_c1
400 nmdc:mga0k408_16453_c1
401 nmdc:mga0k408_171_c1
402 Ga0500635_0000259
403 Ga0500635_0020833
404 Ga0500608_000134
405 Ga0500618_000037
406 Ga0500616_0000833
407 Ga0500622_0000844
408 Ga0500624_000177
409 Ga0500645_000279
410 2599480864
411 2840679440
412 2852623776
413 2884937318
414 2896087251
415 2919438956
416 2928080780
417 2928151002
418 2929925634
419 2932087645
420 8003153396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

244

388

0.98

PF02625

XdhC_CoxI

XdhC and CoxI family

51

118

0.97

PF02625

XdhC_CoxI

XdhC and CoxI family

159

226

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9194 186 217
8gsm-assembly1.cif.gz_G crystal structure of vibmo1 0.9126 185 218
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9117 185 218
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.8984 187 218
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.8964 186 218
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9091 184 218 3.50.50.60
af_A0A1D6EF23_1_151_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9021 185 218 3.50.50.60
af_Q46808_105_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9018 188 337 3.40.50.720
2yquB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8978 187 218 3.50.50.60
af_Q54GT1_13_197_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8932 186 218 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0M3CJJ7-F1-model_v4 deleted 0.9751 232 352
AF-A0A1Q7FSA3-F1-model_v4 XdhC Rossmann domain-containing protein 0.9739 244 352
AF-A0A1I4UTJ0-F1-model_v4 Xanthine and CO dehydrogenase maturation factor, XdhC/CoxF family 0.9652 1 352
AF-R7ZVI7-F1-model_v4 Xanthine and CO dehydrogenase maturation factor, XdhC/CoxF family 0.9648 1 352
AF-A0A4Q1RWI6-F1-model_v4 XdhC Rossmann domain-containing protein 0.9572 190 283

Map