F319873
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 210 | 155 | 420 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10014720|Ga0055531_100147203 |
| Length | 254 |
| Sequence | VQMRWRYPTPALAQTHPNAAAQPAERLMRILMVLTSHDTLGNTGHKTGFWLEEFASPYYVFTDAGVSVTVVSPKGGQPPIDPKSDDPNNQTEAQTRFKADRKALEVLANTLRLDSVSAEDFDTVFYPGGHGPMWDLAEDPHSIKLIESFYDSGKPVAAVCHAPGVLRHVKHKGEPIVKGKRVAGFTNTEEAEVQLTDVVPFLVEDELKRLGGLYQKTDNWYPFAVVDGRLITGQNPSSSTITAETLLRLMKSLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 36 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 47 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 49 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 70 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 71 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 72 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 73 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 74 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 75 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 76 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 77 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 78 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 79 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 80 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 81 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 82 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 83 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 84 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 85 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 86 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 109 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 110 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 113 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 114 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 115 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 116 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 117 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 118 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 119 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 120 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 121 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 122 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 123 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 126 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 127 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 132 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 133 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 134 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 135 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 136 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 137 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 138 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 139 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 140 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 141 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 142 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 143 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 144 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 145 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 146 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 147 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 148 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 149 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 150 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 151 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 152 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 153 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 154 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 155 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.57 |
| Metatranscriptomes | 0 |
| Isolates | 11.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.57 |
| Nodule | 0.95 |
| Rhizoplane | 7.14 |
| Rhizosphere | 50 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10014720 | 3300003794 | Bacteria | 3503 |
| 2 | SwRhRL2b_contig_2899781 | 2162886007 | Bacteria | 3945 |
| 3 | SwRhRL2b_contig_719850 | 2162886007 | Bacteria | 4508 |
| 4 | JGI25156J39149_1000205 | 3300002705 | Bacteria | 40906 |
| 5 | JGI25163J39215_1000193 | 3300002771 | Bacteria | 23709 |
| 6 | JGI25164J39214_1000014 | 3300002772 | Bacteria | 219691 |
| 7 | rootH2_10047650 | 3300003320 | Bacteria | 2835 |
| 8 | rootH1_10048395 | 3300003323 | Bacteria | 8360 |
| 9 | Ga0055538_1000005 | 3300003751 | Bacteria | 575218 |
| 10 | Ga0055539_1000007 | 3300003752 | Bacteria | 575218 |
| 11 | Ga0055533_1000009 | 3300003756 | Bacteria | 575218 |
| 12 | Ga0055525_1000010 | 3300003759 | Bacteria | 575218 |
| 13 | Ga0055527_1005355 | 3300003760 | Bacteria | 1675 |
| 14 | Ga0055536_1000204 | 3300003781 | Bacteria | 48447 |
| 15 | Ga0055536_1008711 | 3300003781 | Bacteria | 4312 |
| 16 | Ga0055536_1014122 | 3300003781 | Bacteria | 2828 |
| 17 | Ga0055530_10010492 | 3300003791 | Bacteria | 3418 |
| 18 | Ga0055531_10015811 | 3300003794 | Bacteria | 3298 |
| 19 | Ga0055531_10051005 | 3300003794 | Bacteria | 1090 |
| 20 | Ga0055541_1000005 | 3300003841 | Bacteria | 575218 |
| 21 | Ga0058692_1000090 | 3300003856 | Bacteria | 62885 |
| 22 | Ga0065704_10000763 | 3300005289 | Bacteria | 34745 |
| 23 | Ga0065704_10070903 | 3300005289 | Bacteria | 14826 |
| 24 | Ga0065704_10080227 | 3300005289 | Bacteria | 3987 |
| 25 | Ga0070670_100000993 | 3300005331 | Bacteria | 22311 |
| 26 | Ga0070714_100527815 | 3300005435 | Bacteria | 1128 |
| 27 | Ga0070714_100700585 | 3300005435 | Bacteria | 977 |
| 28 | Ga0070663_100018754 | 3300005455 | Bacteria | 4544 |
| 29 | Ga0070679_100146938 | 3300005530 | Bacteria | 2335 |
| 30 | Ga0068855_101214901 | 3300005563 | Bacteria | 783 |
| 31 | Ga0070664_100308378 | 3300005564 | Bacteria | 1432 |
| 32 | Ga0070702_100604169 | 3300005615 | Bacteria | 823 |
| 33 | Ga0070715_10296645 | 3300006163 | Bacteria | 863 |
| 34 | Ga0075430_100036126 | 3300006846 | Bacteria | 4190 |
| 35 | Ga0075431_100042751 | 3300006847 | Bacteria | 4674 |
| 36 | Ga0075433_10130356 | 3300006852 | Bacteria | 2234 |
| 37 | Ga0075434_100796277 | 3300006871 | Bacteria | 961 |
| 38 | Ga0105251_10000272 | 3300009011 | Bacteria | 51783 |
| 39 | Ga0105244_10000194 | 3300009036 | Bacteria | 61396 |
| 40 | Ga0105243_10008468 | 3300009148 | Bacteria | 7895 |
| 41 | Ga0157371_10007508 | 3300013102 | Bacteria | 8821 |
| 42 | Ga0163162_10296741 | 3300013306 | Bacteria | 1748 |
| 43 | Ga0163162_10479839 | 3300013306 | Bacteria | 1375 |
| 44 | Ga0182006_1017511 | 3300015261 | Bacteria | 3042 |
| 45 | Ga0182005_1001045 | 3300015265 | Bacteria | 11706 |
| 46 | Ga0163161_10347116 | 3300017792 | Bacteria | 1179 |
| 47 | Ga0209760_100001 | 3300025207 | Bacteria | 348781 |
| 48 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 49 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 50 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 51 | Ga0209672_100675 | 3300025228 | Bacteria | 17217 |
| 52 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 53 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 54 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 55 | Ga0209026_1005469 | 3300025250 | Bacteria | 3414 |
| 56 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 57 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 58 | Ga0209233_1016217 | 3300025261 | Bacteria | 2057 |
| 59 | Ga0209455_1004719 | 3300025272 | Bacteria | 4382 |
| 60 | Ga0209130_1013781 | 3300025284 | Bacteria | 2058 |
| 61 | Ga0209675_1013192 | 3300025291 | Bacteria | 2603 |
| 62 | Ga0209676_1000075 | 3300025292 | Bacteria | 303609 |
| 63 | Ga0209676_1000674 | 3300025292 | Bacteria | 48485 |
| 64 | Ga0209676_1015206 | 3300025292 | Bacteria | 2844 |
| 65 | Ga0209025_1004950 | 3300025294 | Bacteria | 11174 |
| 66 | Ga0209025_1092935 | 3300025294 | Bacteria | 980 |
| 67 | Ga0209564_1005110 | 3300025295 | Bacteria | 7635 |
| 68 | Ga0209050_1004450 | 3300025298 | Bacteria | 9458 |
| 69 | Ga0209051_1010105 | 3300025303 | Bacteria | 4801 |
| 70 | Ga0209257_1000498 | 3300025304 | Bacteria | 70112 |
| 71 | Ga0209257_1003504 | 3300025304 | Bacteria | 13364 |
| 72 | Ga0209257_1042518 | 3300025304 | Bacteria | 1340 |
| 73 | Ga0207696_1000444 | 3300025711 | Bacteria | 36917 |
| 74 | Ga0207655_1000157 | 3300025728 | Bacteria | 124885 |
| 75 | Ga0207713_1000379 | 3300025735 | Bacteria | 48102 |
| 76 | Ga0207692_10215810 | 3300025898 | Bacteria | 1135 |
| 77 | Ga0207660_10514112 | 3300025917 | Bacteria | 972 |
| 78 | Ga0207652_10111408 | 3300025921 | Bacteria | 2427 |
| 79 | Ga0207650_10005735 | 3300025925 | Bacteria | 8471 |
| 80 | Ga0207709_10009937 | 3300025935 | Bacteria | 5240 |
| 81 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 82 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 83 | Ga0265331_10186423 | 3300031250 | Bacteria | 936 |
| 84 | Ga0307513_10306500 | 3300031456 | Bacteria | 1352 |
| 85 | Ga0316576_10069442 | 3300031727 | Bacteria | 2598 |
| 86 | Ga0316576_10195308 | 3300031727 | Bacteria | 1525 |
| 87 | Ga0307406_10206497 | 3300031901 | Bacteria | 1450 |
| 88 | Ga0307414_10025387 | 3300032004 | Bacteria | 3795 |
| 89 | Ga0307414_10029627 | 3300032004 | Bacteria | 3565 |
| 90 | Ga0316584_0037655 | 3300036712 | Bacteria | 3595 |
| 91 | Ga0395905_0255997 | 3300037471 | Bacteria | 1635 |
| 92 | Ga0395905_0528627 | 3300037471 | Bacteria | 1080 |
| 93 | Ga0439436_0011733 | 3300041404 | Bacteria | 2661 |
| 94 | Ga0451791_1345811 | 3300041451 | Bacteria | 1003 |
| 95 | Ga0451800_1161449 | 3300041459 | Bacteria | 1137 |
| 96 | Ga0451851_0773014 | 3300041507 | Bacteria | 1057 |
| 97 | Ga0439449_0004160 | 3300042007 | Bacteria | 5596 |
| 98 | Ga0439452_021323 | 3300042010 | Bacteria | 1690 |
| 99 | Ga0451577_0000118 | 3300042876 | Bacteria | 174137 |
| 100 | Ga0451577_0035509 | 3300042876 | Bacteria | 4490 |
| 101 | Ga0451577_0054256 | 3300042876 | Bacteria | 3578 |
| 102 | Ga0451577_0081668 | 3300042876 | Bacteria | 2883 |
| 103 | Ga0451577_0616374 | 3300042876 | Bacteria | 984 |
| 104 | Ga0451577_0862709 | 3300042876 | Bacteria | 816 |
| 105 | Ga0453683_0000027 | 3300044673 | Bacteria | 248505 |
| 106 | Ga0453683_0000036 | 3300044673 | Bacteria | 232009 |
| 107 | Ga0453684_0000416 | 3300044712 | Bacteria | 174046 |
| 108 | Ga0453684_0001501 | 3300044712 | Bacteria | 65687 |
| 109 | Ga0453684_0002808 | 3300044712 | Bacteria | 41155 |
| 110 | Ga0453684_0003337 | 3300044712 | Bacteria | 36435 |
| 111 | Ga0453684_0038108 | 3300044712 | Bacteria | 6581 |
| 112 | Ga0453684_0044983 | 3300044712 | Bacteria | 5895 |
| 113 | Ga0453684_0371466 | 3300044712 | Bacteria | 1608 |
| 114 | Ga0451576_0000069 | 3300045051 | Bacteria | 259862 |
| 115 | Ga0451576_0000319 | 3300045051 | Bacteria | 116651 |
| 116 | Ga0451576_0000820 | 3300045051 | Bacteria | 60721 |
| 117 | Ga0451576_0452917 | 3300045051 | Bacteria | 1347 |
| 118 | Ga0495627_011558 | 3300046453 | Bacteria | 3165 |
| 119 | Ga0495638_0000112 | 3300046460 | Bacteria | 130876 |
| 120 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 121 | Ga0495650_0003484 | 3300046471 | Bacteria | 11433 |
| 122 | Ga0495606_0000134 | 3300046507 | Bacteria | 125913 |
| 123 | Ga0495606_0007844 | 3300046507 | Bacteria | 9424 |
| 124 | Ga0495610_0002433 | 3300046512 | Bacteria | 15661 |
| 125 | Ga0495631_0166197 | 3300046518 | Bacteria | 946 |
| 126 | Ga0495648_0011187 | 3300046524 | Bacteria | 6778 |
| 127 | Ga0495648_0050728 | 3300046524 | Bacteria | 2533 |
| 128 | Ga0495642_0065905 | 3300046528 | Bacteria | 1508 |
| 129 | Ga0495652_0321438 | 3300046529 | Bacteria | 1118 |
| 130 | Ga0495609_0093871 | 3300046538 | Bacteria | 1303 |
| 131 | Ga0495597_0043396 | 3300046542 | Bacteria | 2003 |
| 132 | Ga0495622_0003024 | 3300046557 | Bacteria | 7976 |
| 133 | Ga0495667_0154143 | 3300046559 | Bacteria | 1479 |
| 134 | Ga0495625_0015376 | 3300046660 | Bacteria | 6064 |
| 135 | Ga0495661_0053492 | 3300046665 | Bacteria | 2428 |
| 136 | Ga0495670_0286310 | 3300046691 | Bacteria | 882 |
| 137 | Ga0495649_0000173 | 3300046694 | Bacteria | 56514 |
| 138 | Ga0495660_0000007 | 3300046810 | Bacteria | 485295 |
| 139 | Ga0495680_0168613 | 3300047322 | Bacteria | 1586 |
| 140 | Ga0495681_0000986 | 3300047470 | Bacteria | 21800 |
| 141 | Ga0495615_0139437 | 3300048090 | Bacteria | 714 |
| 142 | Ga0495626_0054144 | 3300048091 | Bacteria | 1843 |
| 143 | Ga0496100_0005631 | 3300048903 | Bacteria | 6770 |
| 144 | Ga0496104_0423116 | 3300048907 | Bacteria | 1244 |
| 145 | Ga0496108_0052143 | 3300048911 | Bacteria | 3427 |
| 146 | Ga0496109_0389577 | 3300048912 | Bacteria | 1316 |
| 147 | Ga0496110_0029299 | 3300048913 | Bacteria | 4736 |
| 148 | Ga0496111_0023907 | 3300048914 | Bacteria | 4295 |
| 149 | Ga0496112_0011738 | 3300048915 | Bacteria | 8020 |
| 150 | Ga0496114_0000155 | 3300048917 | Bacteria | 49214 |
| 151 | Ga0496114_0423226 | 3300048917 | Bacteria | 1180 |
| 152 | Ga0496115_0000495 | 3300048918 | Bacteria | 31032 |
| 153 | Ga0496115_0007006 | 3300048918 | Bacteria | 8281 |
| 154 | Ga0496115_0086528 | 3300048918 | Bacteria | 2557 |
| 155 | Ga0496116_0000127 | 3300048919 | Bacteria | 158773 |
| 156 | Ga0496116_0025815 | 3300048919 | Bacteria | 4310 |
| 157 | Ga0496117_0000368 | 3300048920 | Bacteria | 78448 |
| 158 | Ga0496117_0004360 | 3300048920 | Bacteria | 15698 |
| 159 | Ga0496118_0001275 | 3300048921 | Bacteria | 38632 |
| 160 | Ga0496118_0087895 | 3300048921 | Bacteria | 2152 |
| 161 | Ga0496118_0133968 | 3300048921 | Bacteria | 1584 |
| 162 | Ga0496119_0000450 | 3300048922 | Bacteria | 56283 |
| 163 | Ga0496119_0000779 | 3300048922 | Bacteria | 42634 |
| 164 | Ga0496119_0034122 | 3300048922 | Bacteria | 3358 |
| 165 | Ga0496120_0000458 | 3300048923 | Bacteria | 64377 |
| 166 | Ga0496120_0009492 | 3300048923 | Bacteria | 6893 |
| 167 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 168 | Ga0496122_0000896 | 3300048925 | Bacteria | 55027 |
| 169 | Ga0496122_0136449 | 3300048925 | Bacteria | 1545 |
| 170 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 171 | Ga0496123_0000137 | 3300048926 | Bacteria | 152169 |
| 172 | Ga0496123_0230420 | 3300048926 | Bacteria | 927 |
| 173 | Ga0496124_0000515 | 3300048927 | Bacteria | 66726 |
| 174 | Ga0496124_0000725 | 3300048927 | Bacteria | 54102 |
| 175 | Ga0496125_0000019 | 3300048928 | Bacteria | 474989 |
| 176 | Ga0496125_0008045 | 3300048928 | Bacteria | 11130 |
| 177 | Ga0496126_0001396 | 3300048929 | Bacteria | 38235 |
| 178 | Ga0496126_0002648 | 3300048929 | Bacteria | 23744 |
| 179 | Ga0496126_0016963 | 3300048929 | Bacteria | 7266 |
| 180 | Ga0496126_0034622 | 3300048929 | Bacteria | 4742 |
| 181 | Ga0496126_0127207 | 3300048929 | Bacteria | 2204 |
| 182 | Ga0495678_006932 | 3300049459 | Bacteria | 5948 |
| 183 | Ga0501034_0000521 | 3300049571 | Bacteria | 61943 |
| 184 | Ga0501043_0001103 | 3300049579 | Bacteria | 23737 |
| 185 | nmdc:mga0qj67_189782_c1 | 3300050509 | Bacteria | 1670 |
| 186 | nmdc:mga06r32_35635_c1 | 3300050510 | Bacteria | 4695 |
| 187 | 2523470835 | 2523231067 | Bacteria | 5230452 |
| 188 | 2597032768 | 2596583598 | Bacteria | 5251611 |
| 189 | 2643909324 | 2643221579 | Bacteria | 4443405 |
| 190 | 2643914827 | 2643221581 | Bacteria | 3893603 |
| 191 | 2671108175 | 2667528173 | Bacteria | 5375747 |
| 192 | 2687579866 | 2687453129 | Bacteria | 4387428 |
| 193 | 2739733893 | 2739367700 | Bacteria | 4747630 |
| 194 | 2740033470 | 2739367866 | Bacteria | 4215900 |
| 195 | 2746084609 | 2744054900 | Bacteria | 8399525 |
| 196 | 2746098531 | 2744054901 | Bacteria | 8397047 |
| 197 | 2747949758 | 2747842428 | Bacteria | 4689383 |
| 198 | 2819242781 | 2818991272 | Bacteria | 4622173 |
| 199 | 2819661229 | 2818991457 | Bacteria | 5323295 |
| 200 | 2852105493 | 2852103415 | Bacteria | 5193810 |
| 201 | 2852687098 | 2852684882 | Bacteria | 5463342 |
| 202 | 2904475153 | 2904474040 | Bacteria | 5504324 |
| 203 | 2908746255 | 2908739725 | Bacteria | 8628932 |
| 204 | 2919131128 | 2919130084 | Bacteria | 5301837 |
| 205 | 2919151499 | 2919150387 | Bacteria | 5500879 |
| 206 | 2923517266 | 2923516293 | Bacteria | 3716336 |
| 207 | 2927146373 | 2927143783 | Bacteria | 5504251 |
| 208 | 2929196368 | 2929195423 | Bacteria | 5325372 |
| 209 | 8005246837 | 8005246636 | Bacteria | 4933972 |
| 210 | 8024489453 | 8024486573 | Bacteria | 6540512 |
| 211 | Ga0055531_10014720 | |||
| 212 | SwRhRL2b_contig_2899781 | |||
| 213 | SwRhRL2b_contig_719850 | |||
| 214 | JGI25156J39149_1000205 | |||
| 215 | JGI25163J39215_1000193 | |||
| 216 | JGI25164J39214_1000014 | |||
| 217 | rootH2_10047650 | |||
| 218 | rootH1_10048395 | |||
| 219 | Ga0055538_1000005 | |||
| 220 | Ga0055539_1000007 | |||
| 221 | Ga0055533_1000009 | |||
| 222 | Ga0055525_1000010 | |||
| 223 | Ga0055527_1005355 | |||
| 224 | Ga0055536_1000204 | |||
| 225 | Ga0055536_1008711 | |||
| 226 | Ga0055536_1014122 | |||
| 227 | Ga0055530_10010492 | |||
| 228 | Ga0055531_10015811 | |||
| 229 | Ga0055531_10051005 | |||
| 230 | Ga0055541_1000005 | |||
| 231 | Ga0058692_1000090 | |||
| 232 | Ga0065704_10000763 | |||
| 233 | Ga0065704_10070903 | |||
| 234 | Ga0065704_10080227 | |||
| 235 | Ga0070670_100000993 | |||
| 236 | Ga0070714_100527815 | |||
| 237 | Ga0070714_100700585 | |||
| 238 | Ga0070663_100018754 | |||
| 239 | Ga0070679_100146938 | |||
| 240 | Ga0068855_101214901 | |||
| 241 | Ga0070664_100308378 | |||
| 242 | Ga0070702_100604169 | |||
| 243 | Ga0070715_10296645 | |||
| 244 | Ga0075430_100036126 | |||
| 245 | Ga0075431_100042751 | |||
| 246 | Ga0075433_10130356 | |||
| 247 | Ga0075434_100796277 | |||
| 248 | Ga0105251_10000272 | |||
| 249 | Ga0105244_10000194 | |||
| 250 | Ga0105243_10008468 | |||
| 251 | Ga0157371_10007508 | |||
| 252 | Ga0163162_10296741 | |||
| 253 | Ga0163162_10479839 | |||
| 254 | Ga0182006_1017511 | |||
| 255 | Ga0182005_1001045 | |||
| 256 | Ga0163161_10347116 | |||
| 257 | Ga0209760_100001 | |||
| 258 | Ga0209784_100001 | |||
| 259 | Ga0209566_100001 | |||
| 260 | Ga0209674_100002 | |||
| 261 | Ga0209672_100675 | |||
| 262 | Ga0209563_100008 | |||
| 263 | Ga0207427_100002 | |||
| 264 | Ga0209437_100007 | |||
| 265 | Ga0209026_1005469 | |||
| 266 | Ga0209677_100004 | |||
| 267 | Ga0209759_1000002 | |||
| 268 | Ga0209233_1016217 | |||
| 269 | Ga0209455_1004719 | |||
| 270 | Ga0209130_1013781 | |||
| 271 | Ga0209675_1013192 | |||
| 272 | Ga0209676_1000075 | |||
| 273 | Ga0209676_1000674 | |||
| 274 | Ga0209676_1015206 | |||
| 275 | Ga0209025_1004950 | |||
| 276 | Ga0209025_1092935 | |||
| 277 | Ga0209564_1005110 | |||
| 278 | Ga0209050_1004450 | |||
| 279 | Ga0209051_1010105 | |||
| 280 | Ga0209257_1000498 | |||
| 281 | Ga0209257_1003504 | |||
| 282 | Ga0209257_1042518 | |||
| 283 | Ga0207696_1000444 | |||
| 284 | Ga0207655_1000157 | |||
| 285 | Ga0207713_1000379 | |||
| 286 | Ga0207692_10215810 | |||
| 287 | Ga0207660_10514112 | |||
| 288 | Ga0207652_10111408 | |||
| 289 | Ga0207650_10005735 | |||
| 290 | Ga0207709_10009937 | |||
| 291 | Ga0209371_1000043 | |||
| 292 | Ga0268256_1000044 | |||
| 293 | Ga0265331_10186423 | |||
| 294 | Ga0307513_10306500 | |||
| 295 | Ga0316576_10069442 | |||
| 296 | Ga0316576_10195308 | |||
| 297 | Ga0307406_10206497 | |||
| 298 | Ga0307414_10025387 | |||
| 299 | Ga0307414_10029627 | |||
| 300 | Ga0316584_0037655 | |||
| 301 | Ga0395905_0255997 | |||
| 302 | Ga0395905_0528627 | |||
| 303 | Ga0439436_0011733 | |||
| 304 | Ga0451791_1345811 | |||
| 305 | Ga0451800_1161449 | |||
| 306 | Ga0451851_0773014 | |||
| 307 | Ga0439449_0004160 | |||
| 308 | Ga0439452_021323 | |||
| 309 | Ga0451577_0000118 | |||
| 310 | Ga0451577_0035509 | |||
| 311 | Ga0451577_0054256 | |||
| 312 | Ga0451577_0081668 | |||
| 313 | Ga0451577_0616374 | |||
| 314 | Ga0451577_0862709 | |||
| 315 | Ga0453683_0000027 | |||
| 316 | Ga0453683_0000036 | |||
| 317 | Ga0453684_0000416 | |||
| 318 | Ga0453684_0001501 | |||
| 319 | Ga0453684_0002808 | |||
| 320 | Ga0453684_0003337 | |||
| 321 | Ga0453684_0038108 | |||
| 322 | Ga0453684_0044983 | |||
| 323 | Ga0453684_0371466 | |||
| 324 | Ga0451576_0000069 | |||
| 325 | Ga0451576_0000319 | |||
| 326 | Ga0451576_0000820 | |||
| 327 | Ga0451576_0452917 | |||
| 328 | Ga0495627_011558 | |||
| 329 | Ga0495638_0000112 | |||
| 330 | Ga0495650_0000016 | |||
| 331 | Ga0495650_0003484 | |||
| 332 | Ga0495606_0000134 | |||
| 333 | Ga0495606_0007844 | |||
| 334 | Ga0495610_0002433 | |||
| 335 | Ga0495631_0166197 | |||
| 336 | Ga0495648_0011187 | |||
| 337 | Ga0495648_0050728 | |||
| 338 | Ga0495642_0065905 | |||
| 339 | Ga0495652_0321438 | |||
| 340 | Ga0495609_0093871 | |||
| 341 | Ga0495597_0043396 | |||
| 342 | Ga0495622_0003024 | |||
| 343 | Ga0495667_0154143 | |||
| 344 | Ga0495625_0015376 | |||
| 345 | Ga0495661_0053492 | |||
| 346 | Ga0495670_0286310 | |||
| 347 | Ga0495649_0000173 | |||
| 348 | Ga0495660_0000007 | |||
| 349 | Ga0495680_0168613 | |||
| 350 | Ga0495681_0000986 | |||
| 351 | Ga0495615_0139437 | |||
| 352 | Ga0495626_0054144 | |||
| 353 | Ga0496100_0005631 | |||
| 354 | Ga0496104_0423116 | |||
| 355 | Ga0496108_0052143 | |||
| 356 | Ga0496109_0389577 | |||
| 357 | Ga0496110_0029299 | |||
| 358 | Ga0496111_0023907 | |||
| 359 | Ga0496112_0011738 | |||
| 360 | Ga0496114_0000155 | |||
| 361 | Ga0496114_0423226 | |||
| 362 | Ga0496115_0000495 | |||
| 363 | Ga0496115_0007006 | |||
| 364 | Ga0496115_0086528 | |||
| 365 | Ga0496116_0000127 | |||
| 366 | Ga0496116_0025815 | |||
| 367 | Ga0496117_0000368 | |||
| 368 | Ga0496117_0004360 | |||
| 369 | Ga0496118_0001275 | |||
| 370 | Ga0496118_0087895 | |||
| 371 | Ga0496118_0133968 | |||
| 372 | Ga0496119_0000450 | |||
| 373 | Ga0496119_0000779 | |||
| 374 | Ga0496119_0034122 | |||
| 375 | Ga0496120_0000458 | |||
| 376 | Ga0496120_0009492 | |||
| 377 | Ga0496122_0000013 | |||
| 378 | Ga0496122_0000896 | |||
| 379 | Ga0496122_0136449 | |||
| 380 | Ga0496123_0000010 | |||
| 381 | Ga0496123_0000137 | |||
| 382 | Ga0496123_0230420 | |||
| 383 | Ga0496124_0000515 | |||
| 384 | Ga0496124_0000725 | |||
| 385 | Ga0496125_0000019 | |||
| 386 | Ga0496125_0008045 | |||
| 387 | Ga0496126_0001396 | |||
| 388 | Ga0496126_0002648 | |||
| 389 | Ga0496126_0016963 | |||
| 390 | Ga0496126_0034622 | |||
| 391 | Ga0496126_0127207 | |||
| 392 | Ga0495678_006932 | |||
| 393 | Ga0501034_0000521 | |||
| 394 | Ga0501043_0001103 | |||
| 395 | nmdc:mga0qj67_189782_c1 | |||
| 396 | nmdc:mga06r32_35635_c1 | |||
| 397 | 2523470835 | |||
| 398 | 2597032768 | |||
| 399 | 2643909324 | |||
| 400 | 2643914827 | |||
| 401 | 2671108175 | |||
| 402 | 2687579866 | |||
| 403 | 2739733893 | |||
| 404 | 2740033470 | |||
| 405 | 2746084609 | |||
| 406 | 2746098531 | |||
| 407 | 2747949758 | |||
| 408 | 2819242781 | |||
| 409 | 2819661229 | |||
| 410 | 2852105493 | |||
| 411 | 2852687098 | |||
| 412 | 2904475153 | |||
| 413 | 2908746255 | |||
| 414 | 2919131128 | |||
| 415 | 2919151499 | |||
| 416 | 2923517266 | |||
| 417 | 2927146373 | |||
| 418 | 2929196368 | |||
| 419 | 8005246837 | |||
| 420 | 8024489453 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p5p-assembly1.cif.gz_A | x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 | 0.9541 | 11 | 234 |
| 4p5p-assembly1.cif.gz_A | x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 | 0.9378 | 11 | 234 |
| 1u9c-assembly1.cif.gz_A | crystallographic structure of apc35852 | 0.9281 | 10 | 235 |
| 4qyx-assembly1.cif.gz_A | crystal structure of ydr533cp | 0.927 | 10 | 234 |
| 1qvv-assembly1.cif.gz_D-2 | crystal structure of the s. cerevisiae ydr533c protein | 0.9249 | 12 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p5pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9538 | 11 | 234 | 3.40.50.880 |
| af_Q54W12_1_221_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9534 | 11 | 230 | 3.40.50.880 |
| 4p5pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9374 | 11 | 234 | 3.40.50.880 |
| af_Q54W12_1_221_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9368 | 11 | 230 | 3.40.50.880 |
| af_Q58377_26_203_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9298 | 10 | 235 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351NYN2-F1-model_v4 | Type 1 glutamine amidotransferase domain-containing protein | 0.9983 | 137 | 234 |
GO:0005737
GO:0016740 GO:0019172 GO:0019243 |
| AF-W4RWS6-F1-model_v4 | ThiJ/PfpI family protein | 0.9971 | 117 | 236 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A455U1L9-F1-model_v4 | DJ-1/PfpI domain-containing protein | 0.9961 | 145 | 234 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A844BBE8-F1-model_v4 | DJ-1/PfpI family protein | 0.9956 | 133 | 235 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A2N8FPJ5-F1-model_v4 | deleted | 0.9935 | 11 | 100 |
|