F319956

General Info

Members Datasets Scaffolds Average Seq Length
210 127 420 241

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100385681|Ga0068869_1003856811
Length 248
Sequence MMNKKINWRIGCSGYHYKEWKEVFYPPGLQQRLWFSHYAKYFNTLELNSTFYQFPKPAALKKWFAESPDDFVFSLKVPRIITHYKKFTGTEQLLADFYNVVGDGLGSKLGAVLFQLPPQIQYSAEMLQKIINSLQPGFNNVIEFRHASWWKEKVYDELAKMGVGFCGSSHPKLPDQLIINTNIVYYRFHGVPNLFKSSYEDSFLKKKADSIQKNTNVHTAFLYFNNTWGTAALTNATWLHDYVTTLHK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
123 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
124 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
125 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
126 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
127 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 0.48
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100385681 3300005334 Unclassified 1149
2 JGI24739J22299_10002705 3300001989 Bacteria 6822
3 JGI24737J22298_10001189 3300001990 Bacteria 9177
4 JGI24737J22298_10002851 3300001990 Bacteria 6122
5 JGI24735J21928_10000001 3300002067 Bacteria 650042
6 JGI24735J21928_10014339 3300002067 Bacteria 2483
7 JGI24744J21845_10008286 3300002077 Bacteria 2145
8 JGI25162J39368_1000022 3300002737 Bacteria 239510
9 JGI25162J39368_1000776 3300002737 Bacteria 21475
10 JGI25164J39214_1000954 3300002772 Bacteria 9301
11 JGI25165J46597_1000914 3300003214 Bacteria 20457
12 rootH1_10199819 3300003316 Unclassified 1190
13 rootH2_10002871 3300003320 Bacteria 62767
14 rootH2_10023186 3300003320 Bacteria 3831
15 rootH2_10041719 3300003320 Bacteria 3377
16 rootH1_10039413 3300003323 Bacteria 1811
17 rootH1_10039414 3300003323 Bacteria 3421
18 rootH1_10039415 3300003323 Bacteria 3720
19 Ga0065714_10107536 3300005288 Unclassified 1530
20 Ga0070658_10000047 3300005327 Bacteria 129483
21 Ga0070676_10003005 3300005328 Bacteria 8722
22 Ga0070666_10000055 3300005335 Bacteria 92269
23 Ga0070666_10034269 3300005335 Bacteria 3365
24 Ga0068868_100068256 3300005338 Bacteria 2831
25 Ga0070660_100050042 3300005339 Bacteria 3215
26 Ga0070668_100335719 3300005347 Bacteria 1276
27 Ga0070673_100065794 3300005364 Bacteria 2893
28 Ga0070673_100765487 3300005364 Bacteria 890
29 Ga0070659_100001065 3300005366 Bacteria 20070
30 Ga0070659_100131508 3300005366 Bacteria 2033
31 Ga0070667_100039116 3300005367 Bacteria 3975
32 Ga0070711_100457898 3300005439 Bacteria 1045
33 Ga0070678_100120530 3300005456 Bacteria 2068
34 Ga0070662_100002070 3300005457 Bacteria 12299
35 Ga0070662_100221128 3300005457 Bacteria 1511
36 Ga0068867_100006692 3300005459 Bacteria 8146
37 Ga0070672_100019917 3300005543 Bacteria 4882
38 Ga0070672_100699853 3300005543 Bacteria 887
39 Ga0068855_100003011 3300005563 Bacteria 20603
40 Ga0068855_100009826 3300005563 Bacteria 11542
41 Ga0068855_100011387 3300005563 Bacteria 10741
42 Ga0068855_100145535 3300005563 Bacteria 2698
43 Ga0068855_100159308 3300005563 Unclassified 2563
44 Ga0068855_100193151 3300005563 Bacteria 2295
45 Ga0068855_100501433 3300005563 Bacteria 1319
46 Ga0068856_100004691 3300005614 Bacteria 13567
47 Ga0068856_100061048 3300005614 Bacteria 3724
48 Ga0068856_100567621 3300005614 Bacteria 1156
49 Ga0068852_100001840 3300005616 Bacteria 14418
50 Ga0068852_100003015 3300005616 Bacteria 11714
51 Ga0068859_100003950 3300005617 Bacteria 15131
52 Ga0068864_100079830 3300005618 Bacteria 2866
53 Ga0068866_10205824 3300005718 Bacteria 1178
54 Ga0068858_100006865 3300005842 Bacteria 11063
55 Ga0068860_100010863 3300005843 Bacteria 8979
56 Ga0097621_100000259 3300006237 Bacteria 35593
57 Ga0097621_100191870 3300006237 Bacteria 1770
58 Ga0068871_100000247 3300006358 Bacteria 37582
59 Ga0068871_100031135 3300006358 Bacteria 4205
60 Ga0068871_100537622 3300006358 Unclassified 1057
61 Ga0097620_100003950 3300006931 Bacteria 15131
62 Ga0105240_10003258 3300009093 Bacteria 25379
63 Ga0105240_10048342 3300009093 Bacteria 5378
64 Ga0105240_10767105 3300009093 Bacteria 1047
65 Ga0105247_10003538 3300009101 Bacteria 10151
66 Ga0105243_10132495 3300009148 Bacteria 2116
67 Ga0105241_10000761 3300009174 Bacteria 24490
68 Ga0105241_10005843 3300009174 Bacteria 9084
69 Ga0105241_10013712 3300009174 Bacteria 5937
70 Ga0105242_10009317 3300009176 Bacteria 7539
71 Ga0105237_10008568 3300009545 Bacteria 11059
72 Ga0105237_10036597 3300009545 Bacteria 4968
73 Ga0105237_10045665 3300009545 Unclassified 4407
74 Ga0105237_10628447 3300009545 Bacteria 1081
75 Ga0105238_10002700 3300009551 Bacteria 17646
76 Ga0105249_10220740 3300009553 Bacteria 1865
77 Ga0105239_10000887 3300010375 Bacteria 42411
78 Ga0105239_10004100 3300010375 Bacteria 17522
79 Ga0105239_10034036 3300010375 Bacteria 5594
80 Ga0105239_10240123 3300010375 Bacteria 2034
81 Ga0105239_10245886 3300010375 Bacteria 2008
82 Ga0105246_10053162 3300011119 Unclassified 2787
83 Ga0105246_10058698 3300011119 Bacteria 2666
84 Ga0157373_10028396 3300013100 Bacteria 4035
85 Ga0157371_10000216 3300013102 Bacteria 83975
86 Ga0157371_10010340 3300013102 Bacteria 7280
87 Ga0157370_10078932 3300013104 Bacteria 3100
88 Ga0157370_10265951 3300013104 Bacteria 1584
89 Ga0157370_10328866 3300013104 Bacteria 1409
90 Ga0157370_10403171 3300013104 Bacteria 1259
91 Ga0157369_10028108 3300013105 Bacteria 6226
92 Ga0157369_10247666 3300013105 Bacteria 1860
93 Ga0157369_10449606 3300013105 Bacteria 1334
94 Ga0157374_10003261 3300013296 Bacteria 13627
95 Ga0157374_10012073 3300013296 Bacteria 7502
96 Ga0157374_10031241 3300013296 Bacteria 4840
97 Ga0157374_10503033 3300013296 Bacteria 1216
98 Ga0157378_10008754 3300013297 Bacteria 8811
99 Ga0157378_10122473 3300013297 Bacteria 2399
100 Ga0157378_10170757 3300013297 Unclassified 2039
101 Ga0163162_10000034 3300013306 Bacteria 149611
102 Ga0163162_10000549 3300013306 Bacteria 34654
103 Ga0163162_10858908 3300013306 Bacteria 1022
104 Ga0157372_10003090 3300013307 Bacteria 17926
105 Ga0157372_10010447 3300013307 Bacteria 9877
106 Ga0157372_10180020 3300013307 Bacteria 2447
107 Ga0157375_10020415 3300013308 Bacteria 6052
108 Ga0157375_10048276 3300013308 Bacteria 4163
109 Ga0163163_10130521 3300014325 Bacteria 2553
110 Ga0157377_10012859 3300014745 Bacteria 4219
111 Ga0157376_10014879 3300014969 Bacteria 5858
112 Ga0163161_10310833 3300017792 Unclassified 1243
113 Ga0207427_100066 3300025231 Bacteria 165770
114 Ga0209437_100010 3300025233 Bacteria 838447
115 Ga0209437_100024 3300025233 Bacteria 592878
116 Ga0209026_1001228 3300025250 Bacteria 11766
117 Ga0209026_1011087 3300025250 Bacteria 1645
118 Ga0209233_1000017 3300025261 Bacteria 898076
119 Ga0207710_10004833 3300025900 Bacteria 5846
120 Ga0207680_10000021 3300025903 Bacteria 87712
121 Ga0207647_10000098 3300025904 Bacteria 67170
122 Ga0207647_10000104 3300025904 Bacteria 65696
123 Ga0207647_10073020 3300025904 Unclassified 2068
124 Ga0207645_10003564 3300025907 Bacteria 11781
125 Ga0207705_10000052 3300025909 Bacteria 168319
126 Ga0207654_10004039 3300025911 Bacteria 7388
127 Ga0207654_10010172 3300025911 Bacteria 4787
128 Ga0207654_10019279 3300025911 Bacteria 3598
129 Ga0207695_10011997 3300025913 Bacteria 10426
130 Ga0207695_10071739 3300025913 Bacteria 3537
131 Ga0207695_10132078 3300025913 Unclassified 2453
132 Ga0207695_10412746 3300025913 Bacteria 1234
133 Ga0207671_10010655 3300025914 Bacteria 7564
134 Ga0207671_10015269 3300025914 Bacteria 6027
135 Ga0207671_10185286 3300025914 Bacteria 1621
136 Ga0207657_10061610 3300025919 Bacteria 3215
137 Ga0207694_10014353 3300025924 Bacteria 5971
138 Ga0207690_10272672 3300025932 Bacteria 1315
139 Ga0207706_10000176 3300025933 Bacteria 70917
140 Ga0207706_10467555 3300025933 Bacteria 1090
141 Ga0207686_10094541 3300025934 Bacteria 1982
142 Ga0207704_10000164 3300025938 Bacteria 35235
143 Ga0207704_10214387 3300025938 Bacteria 1420
144 Ga0207691_10390069 3300025940 Bacteria 1188
145 Ga0207689_10025789 3300025942 Bacteria 4925
146 Ga0207667_10000022 3300025949 Bacteria 369570
147 Ga0207667_10002384 3300025949 Bacteria 23511
148 Ga0207667_10105136 3300025949 Bacteria 2912
149 Ga0207667_10225025 3300025949 Unclassified 1922
150 Ga0207667_10229828 3300025949 Bacteria 1900
151 Ga0207667_10286375 3300025949 Bacteria 1684
152 Ga0207651_10202052 3300025960 Bacteria 1593
153 Ga0207651_10289395 3300025960 Bacteria 1358
154 Ga0207668_10080912 3300025972 Bacteria 2355
155 Ga0207658_10052165 3300025986 Unclassified 3017
156 Ga0207677_10005269 3300026023 Bacteria 7004
157 Ga0207703_10029921 3300026035 Bacteria 4300
158 Ga0207702_10042959 3300026078 Bacteria 3793
159 Ga0207641_10003759 3300026088 Bacteria 13330
160 Ga0207648_10000294 3300026089 Bacteria 54322
161 Ga0207648_10793917 3300026089 Unclassified 881
162 Ga0207683_10155121 3300026121 Bacteria 2068
163 Ga0207698_10048012 3300026142 Bacteria 3238
164 Ga0268264_10001668 3300028381 Bacteria 20453
165 Ga0307517_10001867 3300028786 Bacteria 34483
166 Ga0307515_10000616 3300028794 Bacteria 83207
167 Ga0307509_10054341 3300031507 Bacteria 4265
168 Ga0307509_10109885 3300031507 Bacteria 2765
169 Ga0307508_10000636 3300031616 Bacteria 42249
170 Ga0307414_10077140 3300032004 Bacteria 2424
171 Ga0307510_10005272 3300033180 Bacteria 15373
172 Ga0395899_0000033 3300037312 Bacteria 306589
173 Ga0395899_0003669 3300037312 Bacteria 12154
174 Ga0395899_0009029 3300037312 Bacteria 7662
175 Ga0395900_0000181 3300037418 Bacteria 101531
176 Ga0395900_0001549 3300037418 Bacteria 27320
177 Ga0395898_0034487 3300037466 Bacteria 5043
178 Ga0395905_0001193 3300037471 Bacteria 32487
179 Ga0395905_0002197 3300037471 Bacteria 22041
180 Ga0395901_0004179 3300038443 Bacteria 14571
181 Ga0395901_0048279 3300038443 Bacteria 4420
182 Ga0395901_0066903 3300038443 Bacteria 3742
183 Ga0436361_0199837 3300039447 Bacteria 14699
184 Ga0495638_0115860 3300046460 Bacteria 1588
185 Ga0495650_0000013 3300046471 Bacteria 611135
186 Ga0495650_0073119 3300046471 Bacteria 1340
187 Ga0495606_0023663 3300046507 Bacteria 4444
188 Ga0495606_0030850 3300046507 Bacteria 3738
189 Ga0495616_0009427 3300046513 Bacteria 5711
190 Ga0495631_0004662 3300046518 Bacteria 7253
191 Ga0495648_0055830 3300046524 Bacteria 2379
192 Ga0495634_0151987 3300046642 Bacteria 1464
193 Ga0495625_0003063 3300046660 Bacteria 17116
194 Ga0495660_0027736 3300046810 Bacteria 3202
195 Ga0495683_0073609 3300047323 Bacteria 1675
196 Ga0495687_008218 3300047443 Bacteria 6009
197 Ga0495687_048708 3300047443 Bacteria 1816
198 Ga0495686_0000274 3300047472 Bacteria 91650
199 Ga0495686_0000367 3300047472 Bacteria 73112
200 Ga0495678_021013 3300049459 Bacteria 2881
201 Ga0500635_0042280 3300053080 Unclassified 1528
202 Ga0500608_000903 3300053122 Bacteria 10695
203 Ga0500564_064357 3300053138 Bacteria 1660
204 Ga0500622_0000199 3300053156 Bacteria 63518
205 2599477423 2599185184 Bacteria 6430550
206 2852623799 2852623160 Bacteria 4376875
207 2919441676 2919437846 Bacteria 6199444
208 2928079336 2928078545 Bacteria 6534839
209 2928148184 2928147474 Bacteria 6512076
210 2932084072 2932082852 Bacteria 6563563
211 Ga0068869_100385681
212 JGI24739J22299_10002705
213 JGI24737J22298_10001189
214 JGI24737J22298_10002851
215 JGI24735J21928_10000001
216 JGI24735J21928_10014339
217 JGI24744J21845_10008286
218 JGI25162J39368_1000022
219 JGI25162J39368_1000776
220 JGI25164J39214_1000954
221 JGI25165J46597_1000914
222 rootH1_10199819
223 rootH2_10002871
224 rootH2_10023186
225 rootH2_10041719
226 rootH1_10039413
227 rootH1_10039414
228 rootH1_10039415
229 Ga0065714_10107536
230 Ga0070658_10000047
231 Ga0070676_10003005
232 Ga0070666_10000055
233 Ga0070666_10034269
234 Ga0068868_100068256
235 Ga0070660_100050042
236 Ga0070668_100335719
237 Ga0070673_100065794
238 Ga0070673_100765487
239 Ga0070659_100001065
240 Ga0070659_100131508
241 Ga0070667_100039116
242 Ga0070711_100457898
243 Ga0070678_100120530
244 Ga0070662_100002070
245 Ga0070662_100221128
246 Ga0068867_100006692
247 Ga0070672_100019917
248 Ga0070672_100699853
249 Ga0068855_100003011
250 Ga0068855_100009826
251 Ga0068855_100011387
252 Ga0068855_100145535
253 Ga0068855_100159308
254 Ga0068855_100193151
255 Ga0068855_100501433
256 Ga0068856_100004691
257 Ga0068856_100061048
258 Ga0068856_100567621
259 Ga0068852_100001840
260 Ga0068852_100003015
261 Ga0068859_100003950
262 Ga0068864_100079830
263 Ga0068866_10205824
264 Ga0068858_100006865
265 Ga0068860_100010863
266 Ga0097621_100000259
267 Ga0097621_100191870
268 Ga0068871_100000247
269 Ga0068871_100031135
270 Ga0068871_100537622
271 Ga0097620_100003950
272 Ga0105240_10003258
273 Ga0105240_10048342
274 Ga0105240_10767105
275 Ga0105247_10003538
276 Ga0105243_10132495
277 Ga0105241_10000761
278 Ga0105241_10005843
279 Ga0105241_10013712
280 Ga0105242_10009317
281 Ga0105237_10008568
282 Ga0105237_10036597
283 Ga0105237_10045665
284 Ga0105237_10628447
285 Ga0105238_10002700
286 Ga0105249_10220740
287 Ga0105239_10000887
288 Ga0105239_10004100
289 Ga0105239_10034036
290 Ga0105239_10240123
291 Ga0105239_10245886
292 Ga0105246_10053162
293 Ga0105246_10058698
294 Ga0157373_10028396
295 Ga0157371_10000216
296 Ga0157371_10010340
297 Ga0157370_10078932
298 Ga0157370_10265951
299 Ga0157370_10328866
300 Ga0157370_10403171
301 Ga0157369_10028108
302 Ga0157369_10247666
303 Ga0157369_10449606
304 Ga0157374_10003261
305 Ga0157374_10012073
306 Ga0157374_10031241
307 Ga0157374_10503033
308 Ga0157378_10008754
309 Ga0157378_10122473
310 Ga0157378_10170757
311 Ga0163162_10000034
312 Ga0163162_10000549
313 Ga0163162_10858908
314 Ga0157372_10003090
315 Ga0157372_10010447
316 Ga0157372_10180020
317 Ga0157375_10020415
318 Ga0157375_10048276
319 Ga0163163_10130521
320 Ga0157377_10012859
321 Ga0157376_10014879
322 Ga0163161_10310833
323 Ga0207427_100066
324 Ga0209437_100010
325 Ga0209437_100024
326 Ga0209026_1001228
327 Ga0209026_1011087
328 Ga0209233_1000017
329 Ga0207710_10004833
330 Ga0207680_10000021
331 Ga0207647_10000098
332 Ga0207647_10000104
333 Ga0207647_10073020
334 Ga0207645_10003564
335 Ga0207705_10000052
336 Ga0207654_10004039
337 Ga0207654_10010172
338 Ga0207654_10019279
339 Ga0207695_10011997
340 Ga0207695_10071739
341 Ga0207695_10132078
342 Ga0207695_10412746
343 Ga0207671_10010655
344 Ga0207671_10015269
345 Ga0207671_10185286
346 Ga0207657_10061610
347 Ga0207694_10014353
348 Ga0207690_10272672
349 Ga0207706_10000176
350 Ga0207706_10467555
351 Ga0207686_10094541
352 Ga0207704_10000164
353 Ga0207704_10214387
354 Ga0207691_10390069
355 Ga0207689_10025789
356 Ga0207667_10000022
357 Ga0207667_10002384
358 Ga0207667_10105136
359 Ga0207667_10225025
360 Ga0207667_10229828
361 Ga0207667_10286375
362 Ga0207651_10202052
363 Ga0207651_10289395
364 Ga0207668_10080912
365 Ga0207658_10052165
366 Ga0207677_10005269
367 Ga0207703_10029921
368 Ga0207702_10042959
369 Ga0207641_10003759
370 Ga0207648_10000294
371 Ga0207648_10793917
372 Ga0207683_10155121
373 Ga0207698_10048012
374 Ga0268264_10001668
375 Ga0307517_10001867
376 Ga0307515_10000616
377 Ga0307509_10054341
378 Ga0307509_10109885
379 Ga0307508_10000636
380 Ga0307414_10077140
381 Ga0307510_10005272
382 Ga0395899_0000033
383 Ga0395899_0003669
384 Ga0395899_0009029
385 Ga0395900_0000181
386 Ga0395900_0001549
387 Ga0395898_0034487
388 Ga0395905_0001193
389 Ga0395905_0002197
390 Ga0395901_0004179
391 Ga0395901_0048279
392 Ga0395901_0066903
393 Ga0436361_0199837
394 Ga0495638_0115860
395 Ga0495650_0000013
396 Ga0495650_0073119
397 Ga0495606_0023663
398 Ga0495606_0030850
399 Ga0495616_0009427
400 Ga0495631_0004662
401 Ga0495648_0055830
402 Ga0495634_0151987
403 Ga0495625_0003063
404 Ga0495660_0027736
405 Ga0495683_0073609
406 Ga0495687_008218
407 Ga0495687_048708
408 Ga0495686_0000274
409 Ga0495686_0000367
410 Ga0495678_021013
411 Ga0500635_0042280
412 Ga0500608_000903
413 Ga0500564_064357
414 Ga0500622_0000199
415 2599477423
416 2852623799
417 2919441676
418 2928079336
419 2928148184
420 2932084072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

25

242

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8961 1 236
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8751 1 236
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8329 3 241
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8233 3 241
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7921 2 236
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8961 1 236 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8913 66 238 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8751 1 236 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8388 3 241 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8291 3 241 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A4Y7U3X3-F1-model_v4 DUF72 domain-containing protein 0.9913 46 164
AF-A0A841JCV5-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9874 1 239
AF-A0A1G6ZD48-F1-model_v4 Uncharacterized conserved protein YecE, DUF72 family 0.9869 1 237
AF-A0A4Q5Y3T4-F1-model_v4 deleted 0.9847 1 238
AF-A0A841JCV5-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9833 1 239

Map