F320358

General Info

Members Datasets Scaffolds Average Seq Length
210 137 420 349

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10084775|Ga0163162_100847752
Length 380
Sequence LRAERRKSGGTNGAEQPKQESERTVQMPLSPGEPAPWFTAPTPSNPEYVFDTVAGRFVLLAFLPALDAAAAGAALKALSDYQRLFDDRRLSAFVVVRDPAMAATLRDMPGLRWFLDFDGAVSRLYDALGEDGAERPFWMLLDPALRVIGHVALGEPKGIFDFMARLPDPGSHAGTALHAPVLIAPRVFEPEMRQRLIALHEATGGKFSGVMRDAGDRTVMVMDELKKRRDVLVEDVGLQAALRERLERRLFPLIKRGLGFTASHIERYVVSCYDAADEAVFHPHRDHTTMGTAHRKFACSINLNDDFQGGDLRFAEFGPATYRPPVGGAVVFSCALLHEATRVTAGRRYAFLPFFYDDAGAEVLRAYQARIAETAEPALG

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
118 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
119 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
124 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
125 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
126 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
127 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
128 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
129 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
130 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
131 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
132 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
136 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
137 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20
Nodule 0
Rhizoplane 2.86
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10084775 3300013306 Bacteria 3245
2 Ga0055530_10000657 3300003791 Bacteria 29580
3 Ga0055531_10001202 3300003794 Bacteria 19850
4 Ga0065165_1000238 3300005262 Bacteria 95406
5 Ga0070658_10084224 3300005327 Bacteria 2614
6 Ga0070670_100000128 3300005331 Bacteria 71585
7 Ga0070670_100060008 3300005331 Bacteria 3265
8 Ga0070670_100062252 3300005331 Bacteria 3204
9 Ga0070660_100045565 3300005339 Bacteria 3358
10 Ga0070668_100000584 3300005347 Bacteria 24454
11 Ga0070668_100001376 3300005347 Bacteria 17440
12 Ga0070668_100004146 3300005347 Bacteria 10732
13 Ga0070669_100001021 3300005353 Bacteria 20402
14 Ga0070671_100000209 3300005355 Bacteria 38883
15 Ga0070671_100076766 3300005355 Bacteria 2791
16 Ga0070659_100000549 3300005366 Bacteria 27383
17 Ga0070667_100000169 3300005367 Bacteria 81539
18 Ga0070667_100002073 3300005367 Bacteria 17732
19 Ga0070663_100379488 3300005455 Bacteria 1151
20 Ga0070678_100041347 3300005456 Bacteria 3267
21 Ga0070681_10007397 3300005458 Bacteria 10737
22 Ga0070679_100221405 3300005530 Bacteria 1853
23 Ga0070665_100000166 3300005548 Bacteria 120121
24 Ga0070665_100001083 3300005548 Bacteria 33888
25 Ga0070665_100002779 3300005548 Bacteria 18970
26 Ga0068855_100015798 3300005563 Bacteria 9083
27 Ga0068855_100020632 3300005563 Bacteria 7901
28 Ga0068856_100245959 3300005614 Bacteria 1804
29 Ga0068859_100005908 3300005617 Bacteria 12424
30 Ga0068864_100000461 3300005618 Bacteria 35261
31 Ga0068864_100006430 3300005618 Bacteria 9628
32 Ga0068864_100040076 3300005618 Bacteria 4006
33 Ga0068861_100141034 3300005719 Bacteria 1967
34 Ga0068861_100245869 3300005719 Bacteria 1524
35 Ga0068863_100000101 3300005841 Bacteria 92384
36 Ga0068863_100000185 3300005841 Bacteria 66169
37 Ga0068863_100004288 3300005841 Bacteria 14042
38 Ga0068858_100000271 3300005842 Bacteria 55626
39 Ga0068858_100037391 3300005842 Bacteria 4502
40 Ga0068860_100000211 3300005843 Bacteria 91286
41 Ga0068860_100111841 3300005843 Bacteria 2611
42 Ga0068862_100002355 3300005844 Bacteria 16829
43 Ga0075368_10003950 3300006042 Bacteria 4994
44 Ga0075364_10006432 3300006051 Bacteria 6900
45 Ga0075367_10010724 3300006178 Bacteria 4825
46 Ga0075366_10019151 3300006195 Bacteria 3956
47 Ga0075370_10009306 3300006353 Bacteria 5098
48 Ga0075370_10112050 3300006353 Bacteria 1585
49 Ga0068865_100000477 3300006881 Bacteria 22364
50 Ga0097620_100005908 3300006931 Bacteria 12424
51 Ga0105240_10014610 3300009093 Bacteria 10714
52 Ga0105240_10021821 3300009093 Bacteria 8509
53 Ga0105240_10132246 3300009093 Bacteria 2992
54 Ga0105240_10132737 3300009093 Bacteria 2985
55 Ga0105240_10294972 3300009093 Bacteria 1857
56 Ga0105247_10055024 3300009101 Bacteria 2455
57 Ga0105248_10000349 3300009177 Bacteria 54104
58 Ga0105248_10001964 3300009177 Bacteria 22859
59 Ga0105248_10033230 3300009177 Bacteria 5762
60 Ga0105248_10123557 3300009177 Bacteria 2920
61 Ga0105248_10297480 3300009177 Bacteria 1817
62 Ga0105248_10585278 3300009177 Unclassified 1259
63 Ga0105237_10297047 3300009545 Unclassified 1618
64 Ga0105238_10012645 3300009551 Bacteria 8518
65 Ga0105238_10073223 3300009551 Bacteria 3421
66 Ga0105238_10074813 3300009551 Bacteria 3380
67 Ga0105249_10001221 3300009553 Bacteria 22640
68 Ga0105249_10280472 3300009553 Bacteria 1664
69 Ga0105239_10193762 3300010375 Bacteria 2275
70 Ga0105239_10334602 3300010375 Bacteria 1708
71 Ga0157374_10140907 3300013296 Bacteria 2341
72 Ga0163162_10021957 3300013306 Bacteria 6287
73 Ga0163162_10030710 3300013306 Bacteria 5324
74 Ga0163163_10005594 3300014325 Bacteria 10887
75 Ga0163163_10118927 3300014325 Bacteria 2675
76 Ga0163163_10175682 3300014325 Bacteria 2188
77 Ga0163163_10202782 3300014325 Bacteria 2032
78 Ga0157379_10000119 3300014968 Bacteria 54670
79 Ga0157379_10016592 3300014968 Bacteria 6477
80 Ga0157379_10188562 3300014968 Bacteria 1864
81 Ga0213876_10051232 3300021384 Bacteria 2182
82 Ga0209026_1000438 3300025250 Bacteria 34415
83 Ga0209758_1001527 3300025297 Bacteria 26774
84 Ga0209050_1000031 3300025298 Bacteria 458181
85 Ga0209257_1000073 3300025304 Bacteria 325833
86 Ga0209257_1003363 3300025304 Bacteria 13812
87 Ga0207705_10002325 3300025909 Bacteria 14703
88 Ga0207707_10013900 3300025912 Bacteria 7019
89 Ga0207695_10010341 3300025913 Bacteria 11422
90 Ga0207695_10038076 3300025913 Bacteria 5183
91 Ga0207695_10339174 3300025913 Unclassified 1391
92 Ga0207671_10312900 3300025914 Bacteria 1242
93 Ga0207660_10000991 3300025917 Bacteria 18818
94 Ga0207657_10025186 3300025919 Bacteria 5491
95 Ga0207657_10052955 3300025919 Bacteria 3519
96 Ga0207657_10061153 3300025919 Bacteria 3231
97 Ga0207652_10003485 3300025921 Bacteria 12965
98 Ga0207681_10011510 3300025923 Bacteria 5435
99 Ga0207694_10117726 3300025924 Bacteria 2118
100 Ga0207694_10225009 3300025924 Bacteria 1531
101 Ga0207694_10226892 3300025924 Bacteria 1525
102 Ga0207650_10000315 3300025925 Bacteria 47489
103 Ga0207644_10000679 3300025931 Bacteria 21492
104 Ga0207644_10039681 3300025931 Bacteria 3324
105 Ga0207690_10000110 3300025932 Bacteria 67145
106 Ga0207706_10031506 3300025933 Bacteria 4724
107 Ga0207704_10012311 3300025938 Bacteria 4246
108 Ga0207711_10002092 3300025941 Bacteria 18020
109 Ga0207711_10029395 3300025941 Bacteria 4635
110 Ga0207711_10030505 3300025941 Bacteria 4547
111 Ga0207667_10013416 3300025949 Bacteria 9375
112 Ga0207667_10047567 3300025949 Bacteria 4540
113 Ga0207667_10147586 3300025949 Bacteria 2421
114 Ga0207667_10466128 3300025949 Bacteria 1283
115 Ga0207712_10000203 3300025961 Bacteria 59867
116 Ga0207712_10287308 3300025961 Unclassified 1344
117 Ga0207668_10000007 3300025972 Bacteria 190613
118 Ga0207668_10000427 3300025972 Bacteria 26560
119 Ga0207658_10001368 3300025986 Bacteria 19037
120 Ga0207658_10001403 3300025986 Bacteria 18780
121 Ga0207703_10000105 3300026035 Bacteria 99702
122 Ga0207703_10003669 3300026035 Bacteria 12795
123 Ga0207703_10006225 3300026035 Bacteria 9551
124 Ga0207678_10203881 3300026067 Bacteria 1692
125 Ga0207641_10000109 3300026088 Bacteria 121126
126 Ga0207641_10002034 3300026088 Bacteria 19258
127 Ga0207676_10000159 3300026095 Bacteria 59242
128 Ga0207676_10001888 3300026095 Bacteria 15316
129 Ga0207676_10020306 3300026095 Bacteria 4859
130 Ga0207675_100180341 3300026118 Bacteria 2022
131 Ga0207683_10057436 3300026121 Bacteria 3416
132 Ga0209981_1000371 3300027378 Bacteria 5746
133 Ga0209999_1001345 3300027543 Bacteria 4212
134 Ga0209813_10019173 3300027866 Bacteria 1898
135 Ga0268266_10000005 3300028379 Bacteria 1448194
136 Ga0268266_10001260 3300028379 Bacteria 30951
137 Ga0268266_10005172 3300028379 Bacteria 12291
138 Ga0268265_10004689 3300028380 Bacteria 9438
139 Ga0268264_10000270 3300028381 Bacteria 90954
140 Ga0268264_10062103 3300028381 Bacteria 3136
141 Ga0307517_10002579 3300028786 Bacteria 28853
142 Ga0307517_10103137 3300028786 Bacteria 2231
143 Ga0307511_10051143 3300030521 Bacteria 3317
144 Ga0307513_10001556 3300031456 Bacteria 32890
145 Ga0307516_10000042 3300031730 Bacteria 142687
146 Ga0307510_10002252 3300033180 Bacteria 21803
147 Ga0373947_0233389 3300035725 Bacteria 1212
148 Ga0395905_0344835 3300037471 Bacteria 1381
149 Ga0395901_0122083 3300038443 Bacteria 2738
150 Ga0436365_0434950 3300039437 Bacteria 6979
151 Ga0436365_1503777 3300039437 Bacteria 2821
152 Ga0495629_0060706 3300046459 Bacteria 2642
153 Ga0495610_0021011 3300046512 Bacteria 3602
154 Ga0495616_0103562 3300046513 Bacteria 1332
155 Ga0495643_0008264 3300046522 Bacteria 6607
156 Ga0495597_0002672 3300046542 Bacteria 11028
157 Ga0495622_0011710 3300046557 Bacteria 4055
158 Ga0495668_0054206 3300046616 Bacteria 2217
159 Ga0495611_0047887 3300046648 Bacteria 1919
160 Ga0495625_0059042 3300046660 Bacteria 2723
161 Ga0495625_0131057 3300046660 Bacteria 1698
162 Ga0495625_0170789 3300046660 Bacteria 1452
163 Ga0495669_0000271 3300046684 Bacteria 29724
164 Ga0495669_0000928 3300046684 Bacteria 12259
165 Ga0495669_0007607 3300046684 Bacteria 4546
166 Ga0495669_0062292 3300046684 Bacteria 1690
167 Ga0496102_0148098 3300048905 Bacteria 2204
168 Ga0496111_0212206 3300048914 Bacteria 1438
169 Ga0496112_0014104 3300048915 Bacteria 7400
170 Ga0496112_0147550 3300048915 Bacteria 2320
171 Ga0496115_0002044 3300048918 Bacteria 14436
172 Ga0496115_0002144 3300048918 Bacteria 14121
173 Ga0496117_0026005 3300048920 Bacteria 4588
174 Ga0496118_0020143 3300048921 Bacteria 5928
175 Ga0496121_0000009 3300048924 Bacteria 836971
176 Ga0501033_0062667 3300049570 Bacteria 2738
177 Ga0501043_0275469 3300049579 Bacteria 1291
178 Ga0501047_0010553 3300049581 Bacteria 8736
179 Ga0501047_0103448 3300049581 Bacteria 2728
180 Ga0501035_0054594 3300049822 Bacteria 3570
181 Ga0501044_0043583 3300049823 Bacteria 4660
182 Ga0501044_0294934 3300049823 Bacteria 1552
183 nmdc:mga03n38_21328_c1 3300050490 Bacteria 2605
184 nmdc:mga00v17_282_c1 3300050491 Bacteria 30074
185 nmdc:mga0k408_49789_c1 3300050493 Bacteria 2425
186 nmdc:mga06z11_18437_c1 3300050494 Bacteria 3188
187 nmdc:mga04h51_3685_c1 3300050495 Bacteria 3748
188 nmdc:mga07m45_26990_c1 3300050496 Bacteria 3160
189 Ga0500635_0000052 3300053080 Bacteria 75372
190 Ga0500578_0172858 3300053086 Bacteria 1335
191 Ga0500651_0041093 3300053093 Bacteria 2914
192 Ga0500566_0006891 3300053094 Bacteria 6727
193 Ga0500555_001884 3300053103 Bacteria 6227
194 Ga0500556_0022801 3300053104 Bacteria 2038
195 Ga0500562_000539 3300053108 Bacteria 9175
196 Ga0500569_010122 3300053109 Bacteria 2210
197 Ga0500595_000667 3300053119 Bacteria 20599
198 Ga0500608_000667 3300053122 Bacteria 12573
199 Ga0500642_0008741 3300053130 Bacteria 3482
200 Ga0500658_0041886 3300053134 Bacteria 1838
201 Ga0500590_070250 3300053148 Bacteria 1741
202 Ga0500603_001957 3300053150 Bacteria 4590
203 Ga0500624_002215 3300053157 Bacteria 2680
204 Ga0500639_055854 3300053163 Bacteria 2046
205 Ga0500637_0006912 3300053178 Bacteria 5638
206 Ga0500637_0011907 3300053178 Bacteria 4516
207 Ga0500625_045638 3300053729 Bacteria 2045
208 Ga0500645_003102 3300053730 Bacteria 6940
209 Ga0500596_003899 3300053735 Bacteria 2789
210 Ga0500601_001519 3300053737 Bacteria 2535
211 Ga0163162_10084775
212 Ga0055530_10000657
213 Ga0055531_10001202
214 Ga0065165_1000238
215 Ga0070658_10084224
216 Ga0070670_100000128
217 Ga0070670_100060008
218 Ga0070670_100062252
219 Ga0070660_100045565
220 Ga0070668_100000584
221 Ga0070668_100001376
222 Ga0070668_100004146
223 Ga0070669_100001021
224 Ga0070671_100000209
225 Ga0070671_100076766
226 Ga0070659_100000549
227 Ga0070667_100000169
228 Ga0070667_100002073
229 Ga0070663_100379488
230 Ga0070678_100041347
231 Ga0070681_10007397
232 Ga0070679_100221405
233 Ga0070665_100000166
234 Ga0070665_100001083
235 Ga0070665_100002779
236 Ga0068855_100015798
237 Ga0068855_100020632
238 Ga0068856_100245959
239 Ga0068859_100005908
240 Ga0068864_100000461
241 Ga0068864_100006430
242 Ga0068864_100040076
243 Ga0068861_100141034
244 Ga0068861_100245869
245 Ga0068863_100000101
246 Ga0068863_100000185
247 Ga0068863_100004288
248 Ga0068858_100000271
249 Ga0068858_100037391
250 Ga0068860_100000211
251 Ga0068860_100111841
252 Ga0068862_100002355
253 Ga0075368_10003950
254 Ga0075364_10006432
255 Ga0075367_10010724
256 Ga0075366_10019151
257 Ga0075370_10009306
258 Ga0075370_10112050
259 Ga0068865_100000477
260 Ga0097620_100005908
261 Ga0105240_10014610
262 Ga0105240_10021821
263 Ga0105240_10132246
264 Ga0105240_10132737
265 Ga0105240_10294972
266 Ga0105247_10055024
267 Ga0105248_10000349
268 Ga0105248_10001964
269 Ga0105248_10033230
270 Ga0105248_10123557
271 Ga0105248_10297480
272 Ga0105248_10585278
273 Ga0105237_10297047
274 Ga0105238_10012645
275 Ga0105238_10073223
276 Ga0105238_10074813
277 Ga0105249_10001221
278 Ga0105249_10280472
279 Ga0105239_10193762
280 Ga0105239_10334602
281 Ga0157374_10140907
282 Ga0163162_10021957
283 Ga0163162_10030710
284 Ga0163163_10005594
285 Ga0163163_10118927
286 Ga0163163_10175682
287 Ga0163163_10202782
288 Ga0157379_10000119
289 Ga0157379_10016592
290 Ga0157379_10188562
291 Ga0213876_10051232
292 Ga0209026_1000438
293 Ga0209758_1001527
294 Ga0209050_1000031
295 Ga0209257_1000073
296 Ga0209257_1003363
297 Ga0207705_10002325
298 Ga0207707_10013900
299 Ga0207695_10010341
300 Ga0207695_10038076
301 Ga0207695_10339174
302 Ga0207671_10312900
303 Ga0207660_10000991
304 Ga0207657_10025186
305 Ga0207657_10052955
306 Ga0207657_10061153
307 Ga0207652_10003485
308 Ga0207681_10011510
309 Ga0207694_10117726
310 Ga0207694_10225009
311 Ga0207694_10226892
312 Ga0207650_10000315
313 Ga0207644_10000679
314 Ga0207644_10039681
315 Ga0207690_10000110
316 Ga0207706_10031506
317 Ga0207704_10012311
318 Ga0207711_10002092
319 Ga0207711_10029395
320 Ga0207711_10030505
321 Ga0207667_10013416
322 Ga0207667_10047567
323 Ga0207667_10147586
324 Ga0207667_10466128
325 Ga0207712_10000203
326 Ga0207712_10287308
327 Ga0207668_10000007
328 Ga0207668_10000427
329 Ga0207658_10001368
330 Ga0207658_10001403
331 Ga0207703_10000105
332 Ga0207703_10003669
333 Ga0207703_10006225
334 Ga0207678_10203881
335 Ga0207641_10000109
336 Ga0207641_10002034
337 Ga0207676_10000159
338 Ga0207676_10001888
339 Ga0207676_10020306
340 Ga0207675_100180341
341 Ga0207683_10057436
342 Ga0209981_1000371
343 Ga0209999_1001345
344 Ga0209813_10019173
345 Ga0268266_10000005
346 Ga0268266_10001260
347 Ga0268266_10005172
348 Ga0268265_10004689
349 Ga0268264_10000270
350 Ga0268264_10062103
351 Ga0307517_10002579
352 Ga0307517_10103137
353 Ga0307511_10051143
354 Ga0307513_10001556
355 Ga0307516_10000042
356 Ga0307510_10002252
357 Ga0373947_0233389
358 Ga0395905_0344835
359 Ga0395901_0122083
360 Ga0436365_0434950
361 Ga0436365_1503777
362 Ga0495629_0060706
363 Ga0495610_0021011
364 Ga0495616_0103562
365 Ga0495643_0008264
366 Ga0495597_0002672
367 Ga0495622_0011710
368 Ga0495668_0054206
369 Ga0495611_0047887
370 Ga0495625_0059042
371 Ga0495625_0131057
372 Ga0495625_0170789
373 Ga0495669_0000271
374 Ga0495669_0000928
375 Ga0495669_0007607
376 Ga0495669_0062292
377 Ga0496102_0148098
378 Ga0496111_0212206
379 Ga0496112_0014104
380 Ga0496112_0147550
381 Ga0496115_0002044
382 Ga0496115_0002144
383 Ga0496117_0026005
384 Ga0496118_0020143
385 Ga0496121_0000009
386 Ga0501033_0062667
387 Ga0501043_0275469
388 Ga0501047_0010553
389 Ga0501047_0103448
390 Ga0501035_0054594
391 Ga0501044_0043583
392 Ga0501044_0294934
393 nmdc:mga03n38_21328_c1
394 nmdc:mga00v17_282_c1
395 nmdc:mga0k408_49789_c1
396 nmdc:mga06z11_18437_c1
397 nmdc:mga04h51_3685_c1
398 nmdc:mga07m45_26990_c1
399 Ga0500635_0000052
400 Ga0500578_0172858
401 Ga0500651_0041093
402 Ga0500566_0006891
403 Ga0500555_001884
404 Ga0500556_0022801
405 Ga0500562_000539
406 Ga0500569_010122
407 Ga0500595_000667
408 Ga0500608_000667
409 Ga0500642_0008741
410 Ga0500658_0041886
411 Ga0500590_070250
412 Ga0500603_001957
413 Ga0500624_002215
414 Ga0500639_055854
415 Ga0500637_0006912
416 Ga0500637_0011907
417 Ga0500625_045638
418 Ga0500645_003102
419 Ga0500596_003899
420 Ga0500601_001519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

268

356

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ax7-assembly1.cif.gz_A the crystal structure of a lysyl hydroxylase from acanthamoeba polyphaga mimivirus 0.8266 146 321
6ax6-assembly1.cif.gz_A the crystal structure of a lysyl hydroxylase from acanthamoeba polyphaga mimivirus 0.8254 143 321
6ax7-assembly1.cif.gz_B the crystal structure of a lysyl hydroxylase from acanthamoeba polyphaga mimivirus 0.8194 143 321
6ax6-assembly1.cif.gz_B the crystal structure of a lysyl hydroxylase from acanthamoeba polyphaga mimivirus 0.8192 143 321
2ls5-assembly1.cif.gz_A solution structure of a putative protein disulfide isomerase from bacteroides thetaiotaomicron 0.8185 3 130
ID Description Score Start End Superfamily
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8219 3 129 3.40.30.10
2ls5A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8185 3 130 3.40.30.10
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.806 231 324 2.60.120.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7989 3 130 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7953 3 132 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D2RFE9-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9895 216 325
AF-A0A4Y3M4C9-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9841 236 322
AF-A0A545TPA8-F1-model_v4 2OG-Fe(II) oxygenase 0.9818 192 324
AF-A0A357LFD2-F1-model_v4 Peroxiredoxin 0.9803 159 336 GO:0005506
GO:0016705
GO:0031418
GO:0051213
AF-A0A495GHN4-F1-model_v4 deleted 0.9802 143 338

Map