F320442

General Info

Members Datasets Scaffolds Average Seq Length
210 130 209 247

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10367177|Ga0207650_103671771
Length 244
Sequence MNQLPILEIAANSLASALAAQEGGADRIELCCALELGGLTPSHAQLALARERVRIPIYVLIRPRAGDFVYTEQEFETMQRDIEHCVALGCDGVVIGALDAHGDVDSGNCRELIRAAGVTFHRAIDVSRDPRDALEAIIALGCERVLTSGAAADASTGAPVIRSLVEQAATRIIVMPGAGIGAGNVAAIRAQTGAREFHASARSALPSRLVGAAGALPDMSVGEIRTDATQVRALLAALSADRHA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221695 Lysobacter sp. Root494 Isolate Unclassified
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
129 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
130 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 1.43
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0
Rhizoplane 0.48
Rhizosphere 80.95
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_91162 2162886007 Bacteria 8133
2 JGI24741J21665_1004548 3300001915 Bacteria 3052
3 JGI24739J22299_10036307 3300001989 Bacteria 1666
4 JGI24739J22299_10043575 3300001989 Bacteria 1483
5 JGI24739J22299_10057617 3300001989 Bacteria 1236
6 JGI24737J22298_10021890 3300001990 Bacteria 2033
7 JGI24737J22298_10036153 3300001990 Bacteria 1526
8 JGI24735J21928_10000687 3300002067 Bacteria 11992
9 JGI24735J21928_10022600 3300002067 Bacteria 1913
10 JGI25164J39214_1000688 3300002772 Bacteria 13247
11 JGI25165J46597_1001089 3300003214 Bacteria 17338
12 rootL2_10219814 3300003322 Bacteria 1833
13 rootL2_10280418 3300003322 Bacteria 1685
14 Ga0055533_1000635 3300003756 Bacteria 11853
15 Ga0055529_1004342 3300003763 Bacteria 2169
16 Ga0055536_1007478 3300003781 Bacteria 4876
17 Ga0055530_10004773 3300003791 Bacteria 6816
18 Ga0055531_10007232 3300003794 Bacteria 6102
19 Ga0055531_10020759 3300003794 Bacteria 2582
20 Ga0065704_10072684 3300005289 Bacteria 8150
21 Ga0065704_10082243 3300005289 Bacteria 3631
22 Ga0070658_10592720 3300005327 Bacteria 960
23 Ga0070682_100011939 3300005337 Bacteria 4970
24 Ga0070682_100065743 3300005337 Bacteria 2305
25 Ga0070660_100040121 3300005339 Bacteria 3561
26 Ga0070660_100388748 3300005339 Bacteria 1152
27 Ga0070660_100763002 3300005339 Bacteria 812
28 Ga0070668_100105618 3300005347 Bacteria 2237
29 Ga0070659_100015192 3300005366 Bacteria 5761
30 Ga0070659_100428488 3300005366 Bacteria 1119
31 Ga0070659_100454875 3300005366 Bacteria 1086
32 Ga0070659_100541964 3300005366 Bacteria 995
33 Ga0070714_100000409 3300005435 Bacteria 31605
34 Ga0070714_100001867 3300005435 Bacteria 15353
35 Ga0070663_100040466 3300005455 Bacteria 3263
36 Ga0070662_100520193 3300005457 Bacteria 994
37 Ga0070681_10029979 3300005458 Bacteria 5460
38 Ga0070681_10052254 3300005458 Bacteria 4075
39 Ga0070699_100585156 3300005518 Bacteria 1017
40 Ga0070679_100147796 3300005530 Bacteria 2327
41 Ga0070684_100199043 3300005535 Bacteria 1824
42 Ga0068853_100495034 3300005539 Bacteria 1154
43 Ga0068855_100005195 3300005563 Bacteria 15881
44 Ga0068855_100078043 3300005563 Bacteria 3842
45 Ga0068855_100398603 3300005563 Bacteria 1508
46 Ga0068855_100478748 3300005563 Bacteria 1355
47 Ga0068855_100796864 3300005563 Bacteria 1004
48 Ga0068857_100012473 3300005577 Bacteria 7402
49 Ga0068857_100219140 3300005577 Bacteria 1738
50 Ga0068854_100000796 3300005578 Bacteria 18777
51 Ga0068854_100122822 3300005578 Bacteria 1974
52 Ga0068856_100050968 3300005614 Bacteria 4081
53 Ga0068856_100900626 3300005614 Bacteria 903
54 Ga0068859_100555654 3300005617 Bacteria 1242
55 Ga0068863_100091584 3300005841 Bacteria 2883
56 Ga0097621_100096288 3300006237 Bacteria 2484
57 Ga0097620_100555677 3300006931 Bacteria 1242
58 Ga0105240_10030323 3300009093 Bacteria 7029
59 Ga0105240_10052023 3300009093 Bacteria 5150
60 Ga0105241_10148332 3300009174 Bacteria 1916
61 Ga0105237_10000023 3300009545 Bacteria 226144
62 Ga0105237_10000202 3300009545 Bacteria 84889
63 Ga0105237_10057263 3300009545 Bacteria 3901
64 Ga0105249_10000193 3300009553 Bacteria 69963
65 Ga0105239_10003546 3300010375 Bacteria 19082
66 Ga0105239_10021578 3300010375 Bacteria 7102
67 Ga0105239_10098959 3300010375 Bacteria 3224
68 Ga0157314_1001376 3300012500 Bacteria 1756
69 Ga0157371_10046620 3300013102 Bacteria 3083
70 Ga0157370_10052256 3300013104 Bacteria 3901
71 Ga0157370_10095918 3300013104 Bacteria 2782
72 Ga0157370_10811100 3300013104 Bacteria 851
73 Ga0157369_10188116 3300013105 Bacteria 2170
74 Ga0157369_10419867 3300013105 Bacteria 1387
75 Ga0157369_10465118 3300013105 Bacteria 1309
76 Ga0163162_10000004 3300013306 Bacteria 505593
77 Ga0163162_10490736 3300013306 Bacteria 1359
78 Ga0157372_10122163 3300013307 Bacteria 2993
79 Ga0157372_10302723 3300013307 Bacteria 1860
80 Ga0157372_10309164 3300013307 Bacteria 1839
81 Ga0182008_10112003 3300014497 Bacteria 1352
82 Ga0157376_10005796 3300014969 Bacteria 8658
83 Ga0206356_11274608 3300020070 Bacteria 1177
84 Ga0206354_10471909 3300020081 Bacteria 1751
85 Ga0206353_10646063 3300020082 Bacteria 917
86 Ga0209674_100016 3300025226 Bacteria 696756
87 Ga0207427_100107 3300025231 Bacteria 116422
88 Ga0209437_100039 3300025233 Bacteria 448321
89 Ga0209258_101793 3300025242 Bacteria 6573
90 Ga0209026_1000369 3300025250 Bacteria 41539
91 Ga0209759_1001120 3300025256 Bacteria 17239
92 Ga0209759_1008762 3300025256 Bacteria 3124
93 Ga0209233_1000224 3300025261 Bacteria 103605
94 Ga0209455_1000397 3300025272 Bacteria 37401
95 Ga0209676_1037405 3300025292 Bacteria 1401
96 Ga0209025_1023333 3300025294 Bacteria 3237
97 Ga0209050_1000833 3300025298 Bacteria 42666
98 Ga0209051_1023954 3300025303 Bacteria 2525
99 Ga0209257_1000278 3300025304 Bacteria 114707
100 Ga0209257_1006160 3300025304 Bacteria 7918
101 Ga0209257_1006624 3300025304 Bacteria 7372
102 Ga0207647_10003521 3300025904 Bacteria 11739
103 Ga0207647_10020440 3300025904 Bacteria 4440
104 Ga0207705_10001274 3300025909 Bacteria 20222
105 Ga0207705_10097119 3300025909 Bacteria 2163
106 Ga0207707_10070596 3300025912 Bacteria 3043
107 Ga0207707_10074441 3300025912 Bacteria 2962
108 Ga0207695_10000907 3300025913 Bacteria 53347
109 Ga0207695_10023713 3300025913 Bacteria 6924
110 Ga0207695_10030066 3300025913 Bacteria 5987
111 Ga0207695_10049642 3300025913 Bacteria 4421
112 Ga0207695_10196234 3300025913 Bacteria 1934
113 Ga0207671_10000020 3300025914 Bacteria 309636
114 Ga0207671_10000033 3300025914 Bacteria 245869
115 Ga0207671_10007696 3300025914 Bacteria 9301
116 Ga0207657_10067338 3300025919 Bacteria 3045
117 Ga0207657_10072239 3300025919 Bacteria 2919
118 Ga0207657_10169910 3300025919 Bacteria 1767
119 Ga0207652_10310164 3300025921 Bacteria 1424
120 Ga0207694_10110313 3300025924 Bacteria 2188
121 Ga0207650_10367177 3300025925 Bacteria 1187
122 Ga0207664_10000021 3300025929 Bacteria 216875
123 Ga0207664_10001642 3300025929 Bacteria 14728
124 Ga0207690_10000125 3300025932 Bacteria 63317
125 Ga0207690_10028707 3300025932 Bacteria 3528
126 Ga0207690_10056543 3300025932 Bacteria 2647
127 Ga0207690_10161360 3300025932 Bacteria 1671
128 Ga0207690_10307005 3300025932 Bacteria 1243
129 Ga0207704_10282649 3300025938 Bacteria 1262
130 Ga0207691_10273578 3300025940 Bacteria 1454
131 Ga0207667_10000130 3300025949 Bacteria 115321
132 Ga0207667_10000169 3300025949 Bacteria 95977
133 Ga0207667_10008580 3300025949 Bacteria 12131
134 Ga0207667_10100204 3300025949 Bacteria 2988
135 Ga0207667_10358166 3300025949 Bacteria 1488
136 Ga0207667_10587206 3300025949 Bacteria 1124
137 Ga0207651_10557982 3300025960 Bacteria 997
138 Ga0207712_10000498 3300025961 Bacteria 32444
139 Ga0207640_10000144 3300025981 Bacteria 51999
140 Ga0207640_10002412 3300025981 Bacteria 10000
141 Ga0207639_10052730 3300026041 Bacteria 3101
142 Ga0207678_10164361 3300026067 Bacteria 1895
143 Ga0207702_10004210 3300026078 Bacteria 12858
144 Ga0207702_10028115 3300026078 Bacteria 4672
145 Ga0207674_10003248 3300026116 Bacteria 20007
146 Ga0207674_10142786 3300026116 Bacteria 2353
147 Ga0207683_10064301 3300026121 Bacteria 3233
148 Ga0268266_10143862 3300028379 Bacteria 2142
149 Ga0307413_10048974 3300031824 Bacteria 2530
150 Ga0307413_10109651 3300031824 Bacteria 1845
151 Ga0307406_10038235 3300031901 Bacteria 2969
152 Ga0307412_10165534 3300031911 Bacteria 1648
153 Ga0307412_10570679 3300031911 Bacteria 953
154 Ga0307414_10066310 3300032004 Bacteria 2580
155 Ga0307414_10101594 3300032004 Bacteria 2165
156 Ga0307411_10008217 3300032005 Bacteria 5388
157 Ga0307411_10508543 3300032005 Bacteria 1020
158 Ga0307415_100299106 3300032126 Bacteria 1332
159 Ga0395899_0079096 3300037312 Bacteria 2395
160 Ga0395899_0103884 3300037312 Bacteria 2048
161 Ga0395900_0007994 3300037418 Bacteria 10883
162 Ga0395900_0009643 3300037418 Bacteria 9903
163 Ga0395898_0016311 3300037466 Bacteria 7603
164 Ga0395898_0031775 3300037466 Bacteria 5272
165 Ga0395898_0241857 3300037466 Bacteria 1721
166 Ga0395901_0002129 3300038443 Bacteria 20279
167 Ga0395901_0004606 3300038443 Bacteria 13910
168 Ga0395901_0063780 3300038443 Bacteria 3835
169 Ga0395901_0718238 3300038443 Bacteria 995
170 Ga0237819_08569 3300038705 Bacteria 1410
171 Ga0439436_0018428 3300041404 Bacteria 2087
172 Ga0439449_0013926 3300042007 Bacteria 3024
173 Ga0466982_0000023 3300044672 Bacteria 84859
174 Ga0466964_0067622 3300044706 Bacteria 1502
175 Ga0466971_0029221 3300044719 Bacteria 2465
176 Ga0466967_0367454 3300045976 Bacteria 1395
177 Ga0495638_0036909 3300046460 Bacteria 3110
178 Ga0495632_0134803 3300046519 Bacteria 1148
179 Ga0495686_0005175 3300047472 Bacteria 10384
180 Ga0495686_0025112 3300047472 Bacteria 3907
181 Ga0496115_0000039 3300048918 Bacteria 124044
182 Ga0496117_0033847 3300048920 Bacteria 3859
183 Ga0496118_0006604 3300048921 Bacteria 12667
184 Ga0496121_0155981 3300048924 Bacteria 1675
185 Ga0496121_0445085 3300048924 Bacteria 836
186 Ga0496123_0102032 3300048926 Bacteria 1666
187 Ga0496125_0000738 3300048928 Bacteria 54072
188 Ga0496126_0106402 3300048929 Bacteria 2448
189 Ga0501032_0077169 3300049569 Bacteria 2218
190 Ga0501033_0000878 3300049570 Bacteria 27450
191 Ga0501033_0100031 3300049570 Bacteria 2116
192 Ga0501034_0001186 3300049571 Bacteria 35964
193 Ga0501036_0082530 3300049572 Bacteria 2717
194 Ga0501036_0095740 3300049572 Bacteria 2510
195 Ga0501039_0238704 3300049575 Bacteria 1429
196 Ga0501046_0002402 3300049580 Bacteria 17565
197 Ga0501047_0062561 3300049581 Bacteria 3589
198 Ga0501047_0168543 3300049581 Bacteria 2059
199 Ga0501047_0253661 3300049581 Bacteria 1607
200 Ga0501070_0469237 3300049586 Bacteria 1013
201 Ga0501035_0147375 3300049822 Bacteria 2043
202 Ga0501035_0552057 3300049822 Bacteria 943
203 Ga0501044_0125800 3300049823 Bacteria 2561
204 Ga0501044_0408368 3300049823 Bacteria 1269
205 Ga0501045_0366856 3300049824 Bacteria 1072
206 Ga0500643_005246 3300053087 Bacteria 5628
207 Ga0500597_000437 3300053120 Bacteria 8758
208 Ga0500658_0028553 3300053134 Bacteria 2166
209 Ga0466962_0002706 3300061719 Bacteria 8427

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0718238 Ga0395901_0718238_16_741 239
2 3300009174 Ga0105241_10148332 Ga0105241_101483321 240
3 3300003794 Ga0055531_10020759 Ga0055531_100207592 241
4 3300013104 Ga0157370_10811100 Ga0157370_108111001 241
5 3300025292 Ga0209676_1037405 Ga0209676_10374052 241
6 3300025304 Ga0209257_1006160 Ga0209257_10061605 241
7 3300038705 Ga0237819_08569 Ga0237819_08569_634_1365 241
8 3300002772 JGI25164J39214_1000688 JGI25164J39214_100068813 242
9 3300003214 JGI25165J46597_1001089 JGI25165J46597_100108913 242
10 3300005327 Ga0070658_10592720 Ga0070658_105927201 242
11 3300005339 Ga0070660_100040121 Ga0070660_1000401212 242
12 3300005339 Ga0070660_100763002 Ga0070660_1007630021 242
13 3300005366 Ga0070659_100428488 Ga0070659_1004284881 242
14 3300005366 Ga0070659_100454875 Ga0070659_1004548752 242
15 3300005366 Ga0070659_100541964 Ga0070659_1005419641 242
16 3300005435 Ga0070714_100000409 Ga0070714_1000004094 242
17 3300005435 Ga0070714_100001867 Ga0070714_1000018674 242
18 3300005539 Ga0068853_100495034 Ga0068853_1004950342 242
19 3300005563 Ga0068855_100796864 Ga0068855_1007968642 242
20 3300005577 Ga0068857_100219140 Ga0068857_1002191402 242
21 3300005614 Ga0068856_100900626 Ga0068856_1009006261 242
22 3300009545 Ga0105237_10057263 Ga0105237_100572632 242
23 3300013102 Ga0157371_10046620 Ga0157371_100466202 242
24 3300013104 Ga0157370_10095918 Ga0157370_100959183 242
25 3300013307 Ga0157372_10302723 Ga0157372_103027232 242
26 3300014497 Ga0182008_10112003 Ga0182008_101120031 242
27 3300025231 Ga0207427_100107 Ga0207427_10010783 242
28 3300025233 Ga0209437_100039 Ga0209437_10003930 242
29 3300025261 Ga0209233_1000224 Ga0209233_10002249 242
30 3300025909 Ga0207705_10097119 Ga0207705_100971192 242
31 3300025919 Ga0207657_10072239 Ga0207657_100722392 242
32 3300025924 Ga0207694_10110313 Ga0207694_101103131 242
33 3300025929 Ga0207664_10000021 Ga0207664_1000002137 242
34 3300025929 Ga0207664_10001642 Ga0207664_1000164214 242
35 3300025932 Ga0207690_10000125 Ga0207690_1000012529 242
36 3300025932 Ga0207690_10056543 Ga0207690_100565432 242
37 3300025932 Ga0207690_10161360 Ga0207690_101613602 242
38 3300025932 Ga0207690_10307005 Ga0207690_103070051 242
39 3300025949 Ga0207667_10587206 Ga0207667_105872062 242
40 3300026116 Ga0207674_10142786 Ga0207674_101427863 242
41 3300047472 Ga0495686_0025112 Ga0495686_0025112_1257_1988 242
42 3300048924 Ga0496121_0155981 Ga0496121_0155981_856_1590 242
43 3300049569 Ga0501032_0077169 Ga0501032_0077169_1252_2004 242
44 3300049571 Ga0501034_0001186 Ga0501034_0001186_24002_24733 242
45 3300049580 Ga0501046_0002402 Ga0501046_0002402_2544_3296 242
46 3300049824 Ga0501045_0366856 Ga0501045_0366856_82_810 242
47 3300001989 JGI24739J22299_10036307 JGI24739J22299_100363072 243
48 3300001989 JGI24739J22299_10043575 JGI24739J22299_100435752 243
49 3300001989 JGI24739J22299_10057617 JGI24739J22299_100576171 243
50 3300001990 JGI24737J22298_10021890 JGI24737J22298_100218903 243
51 3300001990 JGI24737J22298_10036153 JGI24737J22298_100361532 243
52 3300002067 JGI24735J21928_10000687 JGI24735J21928_1000068714 243
53 3300002067 JGI24735J21928_10022600 JGI24735J21928_100226002 243
54 3300003756 Ga0055533_1000635 Ga0055533_10006357 243
55 3300003794 Ga0055531_10007232 Ga0055531_100072323 243
56 3300005289 Ga0065704_10082243 Ga0065704_100822433 243
57 3300005337 Ga0070682_100065743 Ga0070682_1000657433 243
58 3300005366 Ga0070659_100015192 Ga0070659_1000151922 243
59 3300005458 Ga0070681_10052254 Ga0070681_100522544 243
60 3300005530 Ga0070679_100147796 Ga0070679_1001477962 243
61 3300005563 Ga0068855_100005195 Ga0068855_1000051953 243
62 3300005563 Ga0068855_100078043 Ga0068855_1000780433 243
63 3300005563 Ga0068855_100398603 Ga0068855_1003986032 243
64 3300005577 Ga0068857_100012473 Ga0068857_1000124733 243
65 3300005578 Ga0068854_100000796 Ga0068854_10000079614 243
66 3300005578 Ga0068854_100122822 Ga0068854_1001228222 243
67 3300009093 Ga0105240_10030323 Ga0105240_100303233 243
68 3300009093 Ga0105240_10052023 Ga0105240_100520233 243
69 3300009545 Ga0105237_10000023 Ga0105237_1000002397 243
70 3300010375 Ga0105239_10003546 Ga0105239_100035464 243
71 3300010375 Ga0105239_10098959 Ga0105239_100989593 243
72 3300012500 Ga0157314_1001376 Ga0157314_10013762 243
73 3300013105 Ga0157369_10188116 Ga0157369_101881162 243
74 3300013105 Ga0157369_10465118 Ga0157369_104651182 243
75 3300014969 Ga0157376_10005796 Ga0157376_100057963 243
76 3300025226 Ga0209674_100016 Ga0209674_100016252 243
77 3300025304 Ga0209257_1000278 Ga0209257_100027895 243
78 3300025904 Ga0207647_10003521 Ga0207647_100035214 243
79 3300025904 Ga0207647_10020440 Ga0207647_100204402 243
80 3300025912 Ga0207707_10070596 Ga0207707_100705962 243
81 3300025913 Ga0207695_10000907 Ga0207695_1000090712 243
82 3300025913 Ga0207695_10023713 Ga0207695_100237133 243
83 3300025913 Ga0207695_10030066 Ga0207695_100300663 243
84 3300025914 Ga0207671_10000020 Ga0207671_10000020139 243
85 3300025914 Ga0207671_10000033 Ga0207671_10000033116 243
86 3300025919 Ga0207657_10169910 Ga0207657_101699101 243
87 3300025921 Ga0207652_10310164 Ga0207652_103101642 243
88 3300025949 Ga0207667_10000130 Ga0207667_1000013027 243
89 3300025949 Ga0207667_10000169 Ga0207667_1000016968 243
90 3300025949 Ga0207667_10358166 Ga0207667_103581662 243
91 3300025981 Ga0207640_10000144 Ga0207640_1000014428 243
92 3300025981 Ga0207640_10002412 Ga0207640_100024123 243
93 3300026116 Ga0207674_10003248 Ga0207674_1000324816 243
94 3300044672 Ga0466982_0000023 Ga0466982_0000023_74002_74733 243
95 3300044706 Ga0466964_0067622 Ga0466964_0067622_30_761 243
96 3300044719 Ga0466971_0029221 Ga0466971_0029221_492_1223 243
97 3300046460 Ga0495638_0036909 Ga0495638_0036909_1019_1750 243
98 3300048918 Ga0496115_0000039 Ga0496115_0000039_59817_60548 243
99 3300048924 Ga0496121_0445085 Ga0496121_0445085_58_789 243
100 3300048926 Ga0496123_0102032 Ga0496123_0102032_849_1583 243
101 3300048928 Ga0496125_0000738 Ga0496125_0000738_11963_12694 243
102 3300048929 Ga0496126_0106402 Ga0496126_0106402_739_1473 243
103 3300049570 Ga0501033_0000878 Ga0501033_0000878_7360_8091 243
104 3300049822 Ga0501035_0552057 Ga0501035_0552057_49_780 243
105 3300061719 Ga0466962_0002706 Ga0466962_0002706_86_817 243
106 3300003763 Ga0055529_1004342 Ga0055529_10043422 244
107 3300003781 Ga0055536_1007478 Ga0055536_10074784 244
108 3300003791 Ga0055530_10004773 Ga0055530_100047734 244
109 3300005337 Ga0070682_100011939 Ga0070682_1000119392 244
110 3300005455 Ga0070663_100040466 Ga0070663_1000404662 244
111 3300005518 Ga0070699_100585156 Ga0070699_1005851561 244
112 3300005563 Ga0068855_100478748 Ga0068855_1004787482 244
113 3300009545 Ga0105237_10000202 Ga0105237_1000020211 244
114 3300013104 Ga0157370_10052256 Ga0157370_100522562 244
115 3300013306 Ga0163162_10000004 Ga0163162_1000000448 244
116 3300013306 Ga0163162_10490736 Ga0163162_104907361 244
117 3300020070 Ga0206356_11274608 Ga0206356_112746082 244
118 3300020081 Ga0206354_10471909 Ga0206354_104719091 244
119 3300020082 Ga0206353_10646063 Ga0206353_106460632 244
120 3300025250 Ga0209026_1000369 Ga0209026_100036926 244
121 3300025256 Ga0209759_1001120 Ga0209759_100112023 244
122 3300025256 Ga0209759_1008762 Ga0209759_10087622 244
123 3300025272 Ga0209455_1000397 Ga0209455_10003975 244
124 3300025294 Ga0209025_1023333 Ga0209025_10233333 244
125 3300025298 Ga0209050_1000833 Ga0209050_10008334 244
126 3300025303 Ga0209051_1023954 Ga0209051_10239543 244
127 3300025304 Ga0209257_1006624 Ga0209257_10066245 244
128 3300025913 Ga0207695_10049642 Ga0207695_100496422 244
129 3300025913 Ga0207695_10196234 Ga0207695_101962342 244
130 3300025914 Ga0207671_10007696 Ga0207671_1000769611 244
131 3300025925 Ga0207650_10367177 Ga0207650_103671771 244
132 3300025940 Ga0207691_10273578 Ga0207691_102735782 244
133 3300025949 Ga0207667_10100204 Ga0207667_101002042 244
134 3300026067 Ga0207678_10164361 Ga0207678_101643612 244
135 3300026078 Ga0207702_10004210 Ga0207702_100042109 244
136 3300047472 Ga0495686_0005175 Ga0495686_0005175_3146_3880 244
137 3300049581 Ga0501047_0253661 Ga0501047_0253661_330_1064 244
138 3300049586 Ga0501070_0469237 Ga0501070_0469237_156_890 244
139 3300049823 Ga0501044_0408368 Ga0501044_0408368_444_1178 244
140 3300053087 Ga0500643_005246 Ga0500643_005246_1289_2023 244
141 3300053120 Ga0500597_000437 Ga0500597_000437_6312_7046 244
142 3300003322 rootL2_10219814 rootL2_102198142 245
143 3300005339 Ga0070660_100388748 Ga0070660_1003887481 245
144 3300013105 Ga0157369_10419867 Ga0157369_104198672 245
145 3300025242 Ga0209258_101793 Ga0209258_1017933 245
146 3300025919 Ga0207657_10067338 Ga0207657_100673382 245
147 3300026041 Ga0207639_10052730 Ga0207639_100527302 245
148 3300001915 JGI24741J21665_1004548 JGI24741J21665_10045482 246
149 3300003322 rootL2_10280418 rootL2_102804182 246
150 3300005457 Ga0070662_100520193 Ga0070662_1005201931 246
151 3300005535 Ga0070684_100199043 Ga0070684_1001990432 246
152 3300025909 Ga0207705_10001274 Ga0207705_1000127417 246
153 3300025932 Ga0207690_10028707 Ga0207690_100287072 246
154 3300025949 Ga0207667_10008580 Ga0207667_100085807 246
155 3300031824 Ga0307413_10048974 Ga0307413_100489742 246
156 3300031824 Ga0307413_10109651 Ga0307413_101096512 246
157 3300031901 Ga0307406_10038235 Ga0307406_100382352 246
158 3300031911 Ga0307412_10165534 Ga0307412_101655342 246
159 3300031911 Ga0307412_10570679 Ga0307412_105706792 246
160 3300032004 Ga0307414_10066310 Ga0307414_100663103 246
161 3300032005 Ga0307411_10008217 Ga0307411_100082172 246
162 3300032005 Ga0307411_10508543 Ga0307411_105085432 246
163 3300032126 Ga0307415_100299106 Ga0307415_1002991062 246
164 3300041404 Ga0439436_0018428 Ga0439436_0018428_1153_1896 246
165 3300042007 Ga0439449_0013926 Ga0439449_0013926_2267_3010 246
166 3300046519 Ga0495632_0134803 Ga0495632_0134803_346_1095 246
167 3300053134 Ga0500658_0028553 Ga0500658_0028553_1375_2130 246
168 iso_pu_bacteria 2643221695 2644529303 246
169 3300005347 Ga0070668_100105618 Ga0070668_1001056183 247
170 3300005614 Ga0068856_100050968 Ga0068856_1000509682 247
171 3300005841 Ga0068863_100091584 Ga0068863_1000915843 247
172 3300009553 Ga0105249_10000193 Ga0105249_1000019314 247
173 3300010375 Ga0105239_10021578 Ga0105239_100215783 247
174 3300025938 Ga0207704_10282649 Ga0207704_102826491 247
175 3300025960 Ga0207651_10557982 Ga0207651_105579821 247
176 3300025961 Ga0207712_10000498 Ga0207712_1000049814 247
177 3300026078 Ga0207702_10028115 Ga0207702_100281153 247
178 3300026121 Ga0207683_10064301 Ga0207683_100643014 247
179 3300005617 Ga0068859_100555654 Ga0068859_1005556542 248
180 3300006931 Ga0097620_100555677 Ga0097620_1005556772 248
181 3300028379 Ga0268266_10143862 Ga0268266_101438622 248
182 3300037312 Ga0395899_0103884 Ga0395899_0103884_477_1241 248
183 3300038443 Ga0395901_0004606 Ga0395901_0004606_12747_13511 248
184 2162886007 SwRhRL2b_contig_91162 SwRhRL2b_0570.00005480 249
185 3300005289 Ga0065704_10072684 Ga0065704_100726846 249
186 3300005458 Ga0070681_10029979 Ga0070681_100299796 249
187 3300006237 Ga0097621_100096288 Ga0097621_1000962882 249
188 3300013307 Ga0157372_10122163 Ga0157372_101221632 249
189 3300013307 Ga0157372_10309164 Ga0157372_103091642 249
190 3300025912 Ga0207707_10074441 Ga0207707_100744412 249
191 3300032004 Ga0307414_10101594 Ga0307414_101015941 249
192 3300037312 Ga0395899_0079096 Ga0395899_0079096_1503_2270 249
193 3300037418 Ga0395900_0007994 Ga0395900_0007994_3181_3942 249
194 3300037418 Ga0395900_0009643 Ga0395900_0009643_7153_7920 249
195 3300037466 Ga0395898_0016311 Ga0395898_0016311_1326_2087 249
196 3300037466 Ga0395898_0031775 Ga0395898_0031775_1326_2087 249
197 3300037466 Ga0395898_0241857 Ga0395898_0241857_130_897 249
198 3300038443 Ga0395901_0002129 Ga0395901_0002129_1683_2444 249
199 3300038443 Ga0395901_0063780 Ga0395901_0063780_1733_2500 249
200 3300045976 Ga0466967_0367454 Ga0466967_0367454_257_1024 249
201 3300048920 Ga0496117_0033847 Ga0496117_0033847_2758_3513 249
202 3300048921 Ga0496118_0006604 Ga0496118_0006604_3297_4052 249
203 3300049570 Ga0501033_0100031 Ga0501033_0100031_19_780 249
204 3300049572 Ga0501036_0082530 Ga0501036_0082530_1750_2511 249
205 3300049572 Ga0501036_0095740 Ga0501036_0095740_1263_2030 249
206 3300049575 Ga0501039_0238704 Ga0501039_0238704_352_1113 249
207 3300049581 Ga0501047_0062561 Ga0501047_0062561_2501_3268 249
208 3300049581 Ga0501047_0168543 Ga0501047_0168543_801_1562 249
209 3300049822 Ga0501035_0147375 Ga0501035_0147375_1010_1771 249
210 3300049823 Ga0501044_0125800 Ga0501044_0125800_1724_2485 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

5

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iwp-assembly3.cif.gz_I crystal structure of human copper homeostasis protein cutc 0.9798 7 246
3iwp-assembly6.cif.gz_F crystal structure of human copper homeostasis protein cutc 0.9797 7 245
3iwp-assembly5.cif.gz_D crystal structure of human copper homeostasis protein cutc 0.9794 7 246
3iwp-assembly6.cif.gz_E crystal structure of human copper homeostasis protein cutc 0.9782 5 245
3iwp-assembly4.cif.gz_A crystal structure of human copper homeostasis protein cutc 0.9781 5 246
ID Description Score Start End Superfamily
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9783 7 246 3.20.20.380
af_Q54K76_6_279_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9658 7 244 3.20.20.380
af_Q4E0C3_1_211_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9613 7 203 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9587 7 249 3.20.20.380
af_P34630_10_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9514 7 243 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A3C0GR56-F1-model_v4 Copper homeostasis protein cutC homolog 0.9977 37 150 GO:0005507
AF-A0A4R7UL95-F1-model_v4 deleted 0.9969 4 244
AF-A0A4U3GNF7-F1-model_v4 deleted 0.9956 6 245
AF-A0A2K1PZ15-F1-model_v4 PF03932 family protein CutC 0.9949 5 245 GO:0005507
GO:0005737
AF-A0A087T6U7-F1-model_v4 Copper homeostasis protein cutC homolog 0.9938 49 171 GO:0005507

Feature Viewer

pLDDT pTM Quality
95.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map