F320442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 210 | 130 | 209 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300025925|Ga0207650_10367177|Ga0207650_103671771 |
| Length | 244 |
| Sequence | MNQLPILEIAANSLASALAAQEGGADRIELCCALELGGLTPSHAQLALARERVRIPIYVLIRPRAGDFVYTEQEFETMQRDIEHCVALGCDGVVIGALDAHGDVDSGNCRELIRAAGVTFHRAIDVSRDPRDALEAIIALGCERVLTSGAAADASTGAPVIRSLVEQAATRIIVMPGAGIGAGNVAAIRAQTGAREFHASARSALPSRLVGAAGALPDMSVGEIRTDATQVRALLAALSADRHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 90 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 91 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 92 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 93 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 94 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 95 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 96 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 97 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 100 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 101 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 102 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 103 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 104 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 113 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 114 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 128 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 129 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 130 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 1.43 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.43 |
| Nodule | 0 |
| Rhizoplane | 0.48 |
| Rhizosphere | 80.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_91162 | 2162886007 | Bacteria | 8133 |
| 2 | JGI24741J21665_1004548 | 3300001915 | Bacteria | 3052 |
| 3 | JGI24739J22299_10036307 | 3300001989 | Bacteria | 1666 |
| 4 | JGI24739J22299_10043575 | 3300001989 | Bacteria | 1483 |
| 5 | JGI24739J22299_10057617 | 3300001989 | Bacteria | 1236 |
| 6 | JGI24737J22298_10021890 | 3300001990 | Bacteria | 2033 |
| 7 | JGI24737J22298_10036153 | 3300001990 | Bacteria | 1526 |
| 8 | JGI24735J21928_10000687 | 3300002067 | Bacteria | 11992 |
| 9 | JGI24735J21928_10022600 | 3300002067 | Bacteria | 1913 |
| 10 | JGI25164J39214_1000688 | 3300002772 | Bacteria | 13247 |
| 11 | JGI25165J46597_1001089 | 3300003214 | Bacteria | 17338 |
| 12 | rootL2_10219814 | 3300003322 | Bacteria | 1833 |
| 13 | rootL2_10280418 | 3300003322 | Bacteria | 1685 |
| 14 | Ga0055533_1000635 | 3300003756 | Bacteria | 11853 |
| 15 | Ga0055529_1004342 | 3300003763 | Bacteria | 2169 |
| 16 | Ga0055536_1007478 | 3300003781 | Bacteria | 4876 |
| 17 | Ga0055530_10004773 | 3300003791 | Bacteria | 6816 |
| 18 | Ga0055531_10007232 | 3300003794 | Bacteria | 6102 |
| 19 | Ga0055531_10020759 | 3300003794 | Bacteria | 2582 |
| 20 | Ga0065704_10072684 | 3300005289 | Bacteria | 8150 |
| 21 | Ga0065704_10082243 | 3300005289 | Bacteria | 3631 |
| 22 | Ga0070658_10592720 | 3300005327 | Bacteria | 960 |
| 23 | Ga0070682_100011939 | 3300005337 | Bacteria | 4970 |
| 24 | Ga0070682_100065743 | 3300005337 | Bacteria | 2305 |
| 25 | Ga0070660_100040121 | 3300005339 | Bacteria | 3561 |
| 26 | Ga0070660_100388748 | 3300005339 | Bacteria | 1152 |
| 27 | Ga0070660_100763002 | 3300005339 | Bacteria | 812 |
| 28 | Ga0070668_100105618 | 3300005347 | Bacteria | 2237 |
| 29 | Ga0070659_100015192 | 3300005366 | Bacteria | 5761 |
| 30 | Ga0070659_100428488 | 3300005366 | Bacteria | 1119 |
| 31 | Ga0070659_100454875 | 3300005366 | Bacteria | 1086 |
| 32 | Ga0070659_100541964 | 3300005366 | Bacteria | 995 |
| 33 | Ga0070714_100000409 | 3300005435 | Bacteria | 31605 |
| 34 | Ga0070714_100001867 | 3300005435 | Bacteria | 15353 |
| 35 | Ga0070663_100040466 | 3300005455 | Bacteria | 3263 |
| 36 | Ga0070662_100520193 | 3300005457 | Bacteria | 994 |
| 37 | Ga0070681_10029979 | 3300005458 | Bacteria | 5460 |
| 38 | Ga0070681_10052254 | 3300005458 | Bacteria | 4075 |
| 39 | Ga0070699_100585156 | 3300005518 | Bacteria | 1017 |
| 40 | Ga0070679_100147796 | 3300005530 | Bacteria | 2327 |
| 41 | Ga0070684_100199043 | 3300005535 | Bacteria | 1824 |
| 42 | Ga0068853_100495034 | 3300005539 | Bacteria | 1154 |
| 43 | Ga0068855_100005195 | 3300005563 | Bacteria | 15881 |
| 44 | Ga0068855_100078043 | 3300005563 | Bacteria | 3842 |
| 45 | Ga0068855_100398603 | 3300005563 | Bacteria | 1508 |
| 46 | Ga0068855_100478748 | 3300005563 | Bacteria | 1355 |
| 47 | Ga0068855_100796864 | 3300005563 | Bacteria | 1004 |
| 48 | Ga0068857_100012473 | 3300005577 | Bacteria | 7402 |
| 49 | Ga0068857_100219140 | 3300005577 | Bacteria | 1738 |
| 50 | Ga0068854_100000796 | 3300005578 | Bacteria | 18777 |
| 51 | Ga0068854_100122822 | 3300005578 | Bacteria | 1974 |
| 52 | Ga0068856_100050968 | 3300005614 | Bacteria | 4081 |
| 53 | Ga0068856_100900626 | 3300005614 | Bacteria | 903 |
| 54 | Ga0068859_100555654 | 3300005617 | Bacteria | 1242 |
| 55 | Ga0068863_100091584 | 3300005841 | Bacteria | 2883 |
| 56 | Ga0097621_100096288 | 3300006237 | Bacteria | 2484 |
| 57 | Ga0097620_100555677 | 3300006931 | Bacteria | 1242 |
| 58 | Ga0105240_10030323 | 3300009093 | Bacteria | 7029 |
| 59 | Ga0105240_10052023 | 3300009093 | Bacteria | 5150 |
| 60 | Ga0105241_10148332 | 3300009174 | Bacteria | 1916 |
| 61 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 62 | Ga0105237_10000202 | 3300009545 | Bacteria | 84889 |
| 63 | Ga0105237_10057263 | 3300009545 | Bacteria | 3901 |
| 64 | Ga0105249_10000193 | 3300009553 | Bacteria | 69963 |
| 65 | Ga0105239_10003546 | 3300010375 | Bacteria | 19082 |
| 66 | Ga0105239_10021578 | 3300010375 | Bacteria | 7102 |
| 67 | Ga0105239_10098959 | 3300010375 | Bacteria | 3224 |
| 68 | Ga0157314_1001376 | 3300012500 | Bacteria | 1756 |
| 69 | Ga0157371_10046620 | 3300013102 | Bacteria | 3083 |
| 70 | Ga0157370_10052256 | 3300013104 | Bacteria | 3901 |
| 71 | Ga0157370_10095918 | 3300013104 | Bacteria | 2782 |
| 72 | Ga0157370_10811100 | 3300013104 | Bacteria | 851 |
| 73 | Ga0157369_10188116 | 3300013105 | Bacteria | 2170 |
| 74 | Ga0157369_10419867 | 3300013105 | Bacteria | 1387 |
| 75 | Ga0157369_10465118 | 3300013105 | Bacteria | 1309 |
| 76 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 77 | Ga0163162_10490736 | 3300013306 | Bacteria | 1359 |
| 78 | Ga0157372_10122163 | 3300013307 | Bacteria | 2993 |
| 79 | Ga0157372_10302723 | 3300013307 | Bacteria | 1860 |
| 80 | Ga0157372_10309164 | 3300013307 | Bacteria | 1839 |
| 81 | Ga0182008_10112003 | 3300014497 | Bacteria | 1352 |
| 82 | Ga0157376_10005796 | 3300014969 | Bacteria | 8658 |
| 83 | Ga0206356_11274608 | 3300020070 | Bacteria | 1177 |
| 84 | Ga0206354_10471909 | 3300020081 | Bacteria | 1751 |
| 85 | Ga0206353_10646063 | 3300020082 | Bacteria | 917 |
| 86 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 87 | Ga0207427_100107 | 3300025231 | Bacteria | 116422 |
| 88 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 89 | Ga0209258_101793 | 3300025242 | Bacteria | 6573 |
| 90 | Ga0209026_1000369 | 3300025250 | Bacteria | 41539 |
| 91 | Ga0209759_1001120 | 3300025256 | Bacteria | 17239 |
| 92 | Ga0209759_1008762 | 3300025256 | Bacteria | 3124 |
| 93 | Ga0209233_1000224 | 3300025261 | Bacteria | 103605 |
| 94 | Ga0209455_1000397 | 3300025272 | Bacteria | 37401 |
| 95 | Ga0209676_1037405 | 3300025292 | Bacteria | 1401 |
| 96 | Ga0209025_1023333 | 3300025294 | Bacteria | 3237 |
| 97 | Ga0209050_1000833 | 3300025298 | Bacteria | 42666 |
| 98 | Ga0209051_1023954 | 3300025303 | Bacteria | 2525 |
| 99 | Ga0209257_1000278 | 3300025304 | Bacteria | 114707 |
| 100 | Ga0209257_1006160 | 3300025304 | Bacteria | 7918 |
| 101 | Ga0209257_1006624 | 3300025304 | Bacteria | 7372 |
| 102 | Ga0207647_10003521 | 3300025904 | Bacteria | 11739 |
| 103 | Ga0207647_10020440 | 3300025904 | Bacteria | 4440 |
| 104 | Ga0207705_10001274 | 3300025909 | Bacteria | 20222 |
| 105 | Ga0207705_10097119 | 3300025909 | Bacteria | 2163 |
| 106 | Ga0207707_10070596 | 3300025912 | Bacteria | 3043 |
| 107 | Ga0207707_10074441 | 3300025912 | Bacteria | 2962 |
| 108 | Ga0207695_10000907 | 3300025913 | Bacteria | 53347 |
| 109 | Ga0207695_10023713 | 3300025913 | Bacteria | 6924 |
| 110 | Ga0207695_10030066 | 3300025913 | Bacteria | 5987 |
| 111 | Ga0207695_10049642 | 3300025913 | Bacteria | 4421 |
| 112 | Ga0207695_10196234 | 3300025913 | Bacteria | 1934 |
| 113 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 114 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 115 | Ga0207671_10007696 | 3300025914 | Bacteria | 9301 |
| 116 | Ga0207657_10067338 | 3300025919 | Bacteria | 3045 |
| 117 | Ga0207657_10072239 | 3300025919 | Bacteria | 2919 |
| 118 | Ga0207657_10169910 | 3300025919 | Bacteria | 1767 |
| 119 | Ga0207652_10310164 | 3300025921 | Bacteria | 1424 |
| 120 | Ga0207694_10110313 | 3300025924 | Bacteria | 2188 |
| 121 | Ga0207650_10367177 | 3300025925 | Bacteria | 1187 |
| 122 | Ga0207664_10000021 | 3300025929 | Bacteria | 216875 |
| 123 | Ga0207664_10001642 | 3300025929 | Bacteria | 14728 |
| 124 | Ga0207690_10000125 | 3300025932 | Bacteria | 63317 |
| 125 | Ga0207690_10028707 | 3300025932 | Bacteria | 3528 |
| 126 | Ga0207690_10056543 | 3300025932 | Bacteria | 2647 |
| 127 | Ga0207690_10161360 | 3300025932 | Bacteria | 1671 |
| 128 | Ga0207690_10307005 | 3300025932 | Bacteria | 1243 |
| 129 | Ga0207704_10282649 | 3300025938 | Bacteria | 1262 |
| 130 | Ga0207691_10273578 | 3300025940 | Bacteria | 1454 |
| 131 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 132 | Ga0207667_10000169 | 3300025949 | Bacteria | 95977 |
| 133 | Ga0207667_10008580 | 3300025949 | Bacteria | 12131 |
| 134 | Ga0207667_10100204 | 3300025949 | Bacteria | 2988 |
| 135 | Ga0207667_10358166 | 3300025949 | Bacteria | 1488 |
| 136 | Ga0207667_10587206 | 3300025949 | Bacteria | 1124 |
| 137 | Ga0207651_10557982 | 3300025960 | Bacteria | 997 |
| 138 | Ga0207712_10000498 | 3300025961 | Bacteria | 32444 |
| 139 | Ga0207640_10000144 | 3300025981 | Bacteria | 51999 |
| 140 | Ga0207640_10002412 | 3300025981 | Bacteria | 10000 |
| 141 | Ga0207639_10052730 | 3300026041 | Bacteria | 3101 |
| 142 | Ga0207678_10164361 | 3300026067 | Bacteria | 1895 |
| 143 | Ga0207702_10004210 | 3300026078 | Bacteria | 12858 |
| 144 | Ga0207702_10028115 | 3300026078 | Bacteria | 4672 |
| 145 | Ga0207674_10003248 | 3300026116 | Bacteria | 20007 |
| 146 | Ga0207674_10142786 | 3300026116 | Bacteria | 2353 |
| 147 | Ga0207683_10064301 | 3300026121 | Bacteria | 3233 |
| 148 | Ga0268266_10143862 | 3300028379 | Bacteria | 2142 |
| 149 | Ga0307413_10048974 | 3300031824 | Bacteria | 2530 |
| 150 | Ga0307413_10109651 | 3300031824 | Bacteria | 1845 |
| 151 | Ga0307406_10038235 | 3300031901 | Bacteria | 2969 |
| 152 | Ga0307412_10165534 | 3300031911 | Bacteria | 1648 |
| 153 | Ga0307412_10570679 | 3300031911 | Bacteria | 953 |
| 154 | Ga0307414_10066310 | 3300032004 | Bacteria | 2580 |
| 155 | Ga0307414_10101594 | 3300032004 | Bacteria | 2165 |
| 156 | Ga0307411_10008217 | 3300032005 | Bacteria | 5388 |
| 157 | Ga0307411_10508543 | 3300032005 | Bacteria | 1020 |
| 158 | Ga0307415_100299106 | 3300032126 | Bacteria | 1332 |
| 159 | Ga0395899_0079096 | 3300037312 | Bacteria | 2395 |
| 160 | Ga0395899_0103884 | 3300037312 | Bacteria | 2048 |
| 161 | Ga0395900_0007994 | 3300037418 | Bacteria | 10883 |
| 162 | Ga0395900_0009643 | 3300037418 | Bacteria | 9903 |
| 163 | Ga0395898_0016311 | 3300037466 | Bacteria | 7603 |
| 164 | Ga0395898_0031775 | 3300037466 | Bacteria | 5272 |
| 165 | Ga0395898_0241857 | 3300037466 | Bacteria | 1721 |
| 166 | Ga0395901_0002129 | 3300038443 | Bacteria | 20279 |
| 167 | Ga0395901_0004606 | 3300038443 | Bacteria | 13910 |
| 168 | Ga0395901_0063780 | 3300038443 | Bacteria | 3835 |
| 169 | Ga0395901_0718238 | 3300038443 | Bacteria | 995 |
| 170 | Ga0237819_08569 | 3300038705 | Bacteria | 1410 |
| 171 | Ga0439436_0018428 | 3300041404 | Bacteria | 2087 |
| 172 | Ga0439449_0013926 | 3300042007 | Bacteria | 3024 |
| 173 | Ga0466982_0000023 | 3300044672 | Bacteria | 84859 |
| 174 | Ga0466964_0067622 | 3300044706 | Bacteria | 1502 |
| 175 | Ga0466971_0029221 | 3300044719 | Bacteria | 2465 |
| 176 | Ga0466967_0367454 | 3300045976 | Bacteria | 1395 |
| 177 | Ga0495638_0036909 | 3300046460 | Bacteria | 3110 |
| 178 | Ga0495632_0134803 | 3300046519 | Bacteria | 1148 |
| 179 | Ga0495686_0005175 | 3300047472 | Bacteria | 10384 |
| 180 | Ga0495686_0025112 | 3300047472 | Bacteria | 3907 |
| 181 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 182 | Ga0496117_0033847 | 3300048920 | Bacteria | 3859 |
| 183 | Ga0496118_0006604 | 3300048921 | Bacteria | 12667 |
| 184 | Ga0496121_0155981 | 3300048924 | Bacteria | 1675 |
| 185 | Ga0496121_0445085 | 3300048924 | Bacteria | 836 |
| 186 | Ga0496123_0102032 | 3300048926 | Bacteria | 1666 |
| 187 | Ga0496125_0000738 | 3300048928 | Bacteria | 54072 |
| 188 | Ga0496126_0106402 | 3300048929 | Bacteria | 2448 |
| 189 | Ga0501032_0077169 | 3300049569 | Bacteria | 2218 |
| 190 | Ga0501033_0000878 | 3300049570 | Bacteria | 27450 |
| 191 | Ga0501033_0100031 | 3300049570 | Bacteria | 2116 |
| 192 | Ga0501034_0001186 | 3300049571 | Bacteria | 35964 |
| 193 | Ga0501036_0082530 | 3300049572 | Bacteria | 2717 |
| 194 | Ga0501036_0095740 | 3300049572 | Bacteria | 2510 |
| 195 | Ga0501039_0238704 | 3300049575 | Bacteria | 1429 |
| 196 | Ga0501046_0002402 | 3300049580 | Bacteria | 17565 |
| 197 | Ga0501047_0062561 | 3300049581 | Bacteria | 3589 |
| 198 | Ga0501047_0168543 | 3300049581 | Bacteria | 2059 |
| 199 | Ga0501047_0253661 | 3300049581 | Bacteria | 1607 |
| 200 | Ga0501070_0469237 | 3300049586 | Bacteria | 1013 |
| 201 | Ga0501035_0147375 | 3300049822 | Bacteria | 2043 |
| 202 | Ga0501035_0552057 | 3300049822 | Bacteria | 943 |
| 203 | Ga0501044_0125800 | 3300049823 | Bacteria | 2561 |
| 204 | Ga0501044_0408368 | 3300049823 | Bacteria | 1269 |
| 205 | Ga0501045_0366856 | 3300049824 | Bacteria | 1072 |
| 206 | Ga0500643_005246 | 3300053087 | Bacteria | 5628 |
| 207 | Ga0500597_000437 | 3300053120 | Bacteria | 8758 |
| 208 | Ga0500658_0028553 | 3300053134 | Bacteria | 2166 |
| 209 | Ga0466962_0002706 | 3300061719 | Bacteria | 8427 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0718238 | Ga0395901_0718238_16_741 | 239 |
| 2 | 3300009174 | Ga0105241_10148332 | Ga0105241_101483321 | 240 |
| 3 | 3300003794 | Ga0055531_10020759 | Ga0055531_100207592 | 241 |
| 4 | 3300013104 | Ga0157370_10811100 | Ga0157370_108111001 | 241 |
| 5 | 3300025292 | Ga0209676_1037405 | Ga0209676_10374052 | 241 |
| 6 | 3300025304 | Ga0209257_1006160 | Ga0209257_10061605 | 241 |
| 7 | 3300038705 | Ga0237819_08569 | Ga0237819_08569_634_1365 | 241 |
| 8 | 3300002772 | JGI25164J39214_1000688 | JGI25164J39214_100068813 | 242 |
| 9 | 3300003214 | JGI25165J46597_1001089 | JGI25165J46597_100108913 | 242 |
| 10 | 3300005327 | Ga0070658_10592720 | Ga0070658_105927201 | 242 |
| 11 | 3300005339 | Ga0070660_100040121 | Ga0070660_1000401212 | 242 |
| 12 | 3300005339 | Ga0070660_100763002 | Ga0070660_1007630021 | 242 |
| 13 | 3300005366 | Ga0070659_100428488 | Ga0070659_1004284881 | 242 |
| 14 | 3300005366 | Ga0070659_100454875 | Ga0070659_1004548752 | 242 |
| 15 | 3300005366 | Ga0070659_100541964 | Ga0070659_1005419641 | 242 |
| 16 | 3300005435 | Ga0070714_100000409 | Ga0070714_1000004094 | 242 |
| 17 | 3300005435 | Ga0070714_100001867 | Ga0070714_1000018674 | 242 |
| 18 | 3300005539 | Ga0068853_100495034 | Ga0068853_1004950342 | 242 |
| 19 | 3300005563 | Ga0068855_100796864 | Ga0068855_1007968642 | 242 |
| 20 | 3300005577 | Ga0068857_100219140 | Ga0068857_1002191402 | 242 |
| 21 | 3300005614 | Ga0068856_100900626 | Ga0068856_1009006261 | 242 |
| 22 | 3300009545 | Ga0105237_10057263 | Ga0105237_100572632 | 242 |
| 23 | 3300013102 | Ga0157371_10046620 | Ga0157371_100466202 | 242 |
| 24 | 3300013104 | Ga0157370_10095918 | Ga0157370_100959183 | 242 |
| 25 | 3300013307 | Ga0157372_10302723 | Ga0157372_103027232 | 242 |
| 26 | 3300014497 | Ga0182008_10112003 | Ga0182008_101120031 | 242 |
| 27 | 3300025231 | Ga0207427_100107 | Ga0207427_10010783 | 242 |
| 28 | 3300025233 | Ga0209437_100039 | Ga0209437_10003930 | 242 |
| 29 | 3300025261 | Ga0209233_1000224 | Ga0209233_10002249 | 242 |
| 30 | 3300025909 | Ga0207705_10097119 | Ga0207705_100971192 | 242 |
| 31 | 3300025919 | Ga0207657_10072239 | Ga0207657_100722392 | 242 |
| 32 | 3300025924 | Ga0207694_10110313 | Ga0207694_101103131 | 242 |
| 33 | 3300025929 | Ga0207664_10000021 | Ga0207664_1000002137 | 242 |
| 34 | 3300025929 | Ga0207664_10001642 | Ga0207664_1000164214 | 242 |
| 35 | 3300025932 | Ga0207690_10000125 | Ga0207690_1000012529 | 242 |
| 36 | 3300025932 | Ga0207690_10056543 | Ga0207690_100565432 | 242 |
| 37 | 3300025932 | Ga0207690_10161360 | Ga0207690_101613602 | 242 |
| 38 | 3300025932 | Ga0207690_10307005 | Ga0207690_103070051 | 242 |
| 39 | 3300025949 | Ga0207667_10587206 | Ga0207667_105872062 | 242 |
| 40 | 3300026116 | Ga0207674_10142786 | Ga0207674_101427863 | 242 |
| 41 | 3300047472 | Ga0495686_0025112 | Ga0495686_0025112_1257_1988 | 242 |
| 42 | 3300048924 | Ga0496121_0155981 | Ga0496121_0155981_856_1590 | 242 |
| 43 | 3300049569 | Ga0501032_0077169 | Ga0501032_0077169_1252_2004 | 242 |
| 44 | 3300049571 | Ga0501034_0001186 | Ga0501034_0001186_24002_24733 | 242 |
| 45 | 3300049580 | Ga0501046_0002402 | Ga0501046_0002402_2544_3296 | 242 |
| 46 | 3300049824 | Ga0501045_0366856 | Ga0501045_0366856_82_810 | 242 |
| 47 | 3300001989 | JGI24739J22299_10036307 | JGI24739J22299_100363072 | 243 |
| 48 | 3300001989 | JGI24739J22299_10043575 | JGI24739J22299_100435752 | 243 |
| 49 | 3300001989 | JGI24739J22299_10057617 | JGI24739J22299_100576171 | 243 |
| 50 | 3300001990 | JGI24737J22298_10021890 | JGI24737J22298_100218903 | 243 |
| 51 | 3300001990 | JGI24737J22298_10036153 | JGI24737J22298_100361532 | 243 |
| 52 | 3300002067 | JGI24735J21928_10000687 | JGI24735J21928_1000068714 | 243 |
| 53 | 3300002067 | JGI24735J21928_10022600 | JGI24735J21928_100226002 | 243 |
| 54 | 3300003756 | Ga0055533_1000635 | Ga0055533_10006357 | 243 |
| 55 | 3300003794 | Ga0055531_10007232 | Ga0055531_100072323 | 243 |
| 56 | 3300005289 | Ga0065704_10082243 | Ga0065704_100822433 | 243 |
| 57 | 3300005337 | Ga0070682_100065743 | Ga0070682_1000657433 | 243 |
| 58 | 3300005366 | Ga0070659_100015192 | Ga0070659_1000151922 | 243 |
| 59 | 3300005458 | Ga0070681_10052254 | Ga0070681_100522544 | 243 |
| 60 | 3300005530 | Ga0070679_100147796 | Ga0070679_1001477962 | 243 |
| 61 | 3300005563 | Ga0068855_100005195 | Ga0068855_1000051953 | 243 |
| 62 | 3300005563 | Ga0068855_100078043 | Ga0068855_1000780433 | 243 |
| 63 | 3300005563 | Ga0068855_100398603 | Ga0068855_1003986032 | 243 |
| 64 | 3300005577 | Ga0068857_100012473 | Ga0068857_1000124733 | 243 |
| 65 | 3300005578 | Ga0068854_100000796 | Ga0068854_10000079614 | 243 |
| 66 | 3300005578 | Ga0068854_100122822 | Ga0068854_1001228222 | 243 |
| 67 | 3300009093 | Ga0105240_10030323 | Ga0105240_100303233 | 243 |
| 68 | 3300009093 | Ga0105240_10052023 | Ga0105240_100520233 | 243 |
| 69 | 3300009545 | Ga0105237_10000023 | Ga0105237_1000002397 | 243 |
| 70 | 3300010375 | Ga0105239_10003546 | Ga0105239_100035464 | 243 |
| 71 | 3300010375 | Ga0105239_10098959 | Ga0105239_100989593 | 243 |
| 72 | 3300012500 | Ga0157314_1001376 | Ga0157314_10013762 | 243 |
| 73 | 3300013105 | Ga0157369_10188116 | Ga0157369_101881162 | 243 |
| 74 | 3300013105 | Ga0157369_10465118 | Ga0157369_104651182 | 243 |
| 75 | 3300014969 | Ga0157376_10005796 | Ga0157376_100057963 | 243 |
| 76 | 3300025226 | Ga0209674_100016 | Ga0209674_100016252 | 243 |
| 77 | 3300025304 | Ga0209257_1000278 | Ga0209257_100027895 | 243 |
| 78 | 3300025904 | Ga0207647_10003521 | Ga0207647_100035214 | 243 |
| 79 | 3300025904 | Ga0207647_10020440 | Ga0207647_100204402 | 243 |
| 80 | 3300025912 | Ga0207707_10070596 | Ga0207707_100705962 | 243 |
| 81 | 3300025913 | Ga0207695_10000907 | Ga0207695_1000090712 | 243 |
| 82 | 3300025913 | Ga0207695_10023713 | Ga0207695_100237133 | 243 |
| 83 | 3300025913 | Ga0207695_10030066 | Ga0207695_100300663 | 243 |
| 84 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020139 | 243 |
| 85 | 3300025914 | Ga0207671_10000033 | Ga0207671_10000033116 | 243 |
| 86 | 3300025919 | Ga0207657_10169910 | Ga0207657_101699101 | 243 |
| 87 | 3300025921 | Ga0207652_10310164 | Ga0207652_103101642 | 243 |
| 88 | 3300025949 | Ga0207667_10000130 | Ga0207667_1000013027 | 243 |
| 89 | 3300025949 | Ga0207667_10000169 | Ga0207667_1000016968 | 243 |
| 90 | 3300025949 | Ga0207667_10358166 | Ga0207667_103581662 | 243 |
| 91 | 3300025981 | Ga0207640_10000144 | Ga0207640_1000014428 | 243 |
| 92 | 3300025981 | Ga0207640_10002412 | Ga0207640_100024123 | 243 |
| 93 | 3300026116 | Ga0207674_10003248 | Ga0207674_1000324816 | 243 |
| 94 | 3300044672 | Ga0466982_0000023 | Ga0466982_0000023_74002_74733 | 243 |
| 95 | 3300044706 | Ga0466964_0067622 | Ga0466964_0067622_30_761 | 243 |
| 96 | 3300044719 | Ga0466971_0029221 | Ga0466971_0029221_492_1223 | 243 |
| 97 | 3300046460 | Ga0495638_0036909 | Ga0495638_0036909_1019_1750 | 243 |
| 98 | 3300048918 | Ga0496115_0000039 | Ga0496115_0000039_59817_60548 | 243 |
| 99 | 3300048924 | Ga0496121_0445085 | Ga0496121_0445085_58_789 | 243 |
| 100 | 3300048926 | Ga0496123_0102032 | Ga0496123_0102032_849_1583 | 243 |
| 101 | 3300048928 | Ga0496125_0000738 | Ga0496125_0000738_11963_12694 | 243 |
| 102 | 3300048929 | Ga0496126_0106402 | Ga0496126_0106402_739_1473 | 243 |
| 103 | 3300049570 | Ga0501033_0000878 | Ga0501033_0000878_7360_8091 | 243 |
| 104 | 3300049822 | Ga0501035_0552057 | Ga0501035_0552057_49_780 | 243 |
| 105 | 3300061719 | Ga0466962_0002706 | Ga0466962_0002706_86_817 | 243 |
| 106 | 3300003763 | Ga0055529_1004342 | Ga0055529_10043422 | 244 |
| 107 | 3300003781 | Ga0055536_1007478 | Ga0055536_10074784 | 244 |
| 108 | 3300003791 | Ga0055530_10004773 | Ga0055530_100047734 | 244 |
| 109 | 3300005337 | Ga0070682_100011939 | Ga0070682_1000119392 | 244 |
| 110 | 3300005455 | Ga0070663_100040466 | Ga0070663_1000404662 | 244 |
| 111 | 3300005518 | Ga0070699_100585156 | Ga0070699_1005851561 | 244 |
| 112 | 3300005563 | Ga0068855_100478748 | Ga0068855_1004787482 | 244 |
| 113 | 3300009545 | Ga0105237_10000202 | Ga0105237_1000020211 | 244 |
| 114 | 3300013104 | Ga0157370_10052256 | Ga0157370_100522562 | 244 |
| 115 | 3300013306 | Ga0163162_10000004 | Ga0163162_1000000448 | 244 |
| 116 | 3300013306 | Ga0163162_10490736 | Ga0163162_104907361 | 244 |
| 117 | 3300020070 | Ga0206356_11274608 | Ga0206356_112746082 | 244 |
| 118 | 3300020081 | Ga0206354_10471909 | Ga0206354_104719091 | 244 |
| 119 | 3300020082 | Ga0206353_10646063 | Ga0206353_106460632 | 244 |
| 120 | 3300025250 | Ga0209026_1000369 | Ga0209026_100036926 | 244 |
| 121 | 3300025256 | Ga0209759_1001120 | Ga0209759_100112023 | 244 |
| 122 | 3300025256 | Ga0209759_1008762 | Ga0209759_10087622 | 244 |
| 123 | 3300025272 | Ga0209455_1000397 | Ga0209455_10003975 | 244 |
| 124 | 3300025294 | Ga0209025_1023333 | Ga0209025_10233333 | 244 |
| 125 | 3300025298 | Ga0209050_1000833 | Ga0209050_10008334 | 244 |
| 126 | 3300025303 | Ga0209051_1023954 | Ga0209051_10239543 | 244 |
| 127 | 3300025304 | Ga0209257_1006624 | Ga0209257_10066245 | 244 |
| 128 | 3300025913 | Ga0207695_10049642 | Ga0207695_100496422 | 244 |
| 129 | 3300025913 | Ga0207695_10196234 | Ga0207695_101962342 | 244 |
| 130 | 3300025914 | Ga0207671_10007696 | Ga0207671_1000769611 | 244 |
| 131 | 3300025925 | Ga0207650_10367177 | Ga0207650_103671771 | 244 |
| 132 | 3300025940 | Ga0207691_10273578 | Ga0207691_102735782 | 244 |
| 133 | 3300025949 | Ga0207667_10100204 | Ga0207667_101002042 | 244 |
| 134 | 3300026067 | Ga0207678_10164361 | Ga0207678_101643612 | 244 |
| 135 | 3300026078 | Ga0207702_10004210 | Ga0207702_100042109 | 244 |
| 136 | 3300047472 | Ga0495686_0005175 | Ga0495686_0005175_3146_3880 | 244 |
| 137 | 3300049581 | Ga0501047_0253661 | Ga0501047_0253661_330_1064 | 244 |
| 138 | 3300049586 | Ga0501070_0469237 | Ga0501070_0469237_156_890 | 244 |
| 139 | 3300049823 | Ga0501044_0408368 | Ga0501044_0408368_444_1178 | 244 |
| 140 | 3300053087 | Ga0500643_005246 | Ga0500643_005246_1289_2023 | 244 |
| 141 | 3300053120 | Ga0500597_000437 | Ga0500597_000437_6312_7046 | 244 |
| 142 | 3300003322 | rootL2_10219814 | rootL2_102198142 | 245 |
| 143 | 3300005339 | Ga0070660_100388748 | Ga0070660_1003887481 | 245 |
| 144 | 3300013105 | Ga0157369_10419867 | Ga0157369_104198672 | 245 |
| 145 | 3300025242 | Ga0209258_101793 | Ga0209258_1017933 | 245 |
| 146 | 3300025919 | Ga0207657_10067338 | Ga0207657_100673382 | 245 |
| 147 | 3300026041 | Ga0207639_10052730 | Ga0207639_100527302 | 245 |
| 148 | 3300001915 | JGI24741J21665_1004548 | JGI24741J21665_10045482 | 246 |
| 149 | 3300003322 | rootL2_10280418 | rootL2_102804182 | 246 |
| 150 | 3300005457 | Ga0070662_100520193 | Ga0070662_1005201931 | 246 |
| 151 | 3300005535 | Ga0070684_100199043 | Ga0070684_1001990432 | 246 |
| 152 | 3300025909 | Ga0207705_10001274 | Ga0207705_1000127417 | 246 |
| 153 | 3300025932 | Ga0207690_10028707 | Ga0207690_100287072 | 246 |
| 154 | 3300025949 | Ga0207667_10008580 | Ga0207667_100085807 | 246 |
| 155 | 3300031824 | Ga0307413_10048974 | Ga0307413_100489742 | 246 |
| 156 | 3300031824 | Ga0307413_10109651 | Ga0307413_101096512 | 246 |
| 157 | 3300031901 | Ga0307406_10038235 | Ga0307406_100382352 | 246 |
| 158 | 3300031911 | Ga0307412_10165534 | Ga0307412_101655342 | 246 |
| 159 | 3300031911 | Ga0307412_10570679 | Ga0307412_105706792 | 246 |
| 160 | 3300032004 | Ga0307414_10066310 | Ga0307414_100663103 | 246 |
| 161 | 3300032005 | Ga0307411_10008217 | Ga0307411_100082172 | 246 |
| 162 | 3300032005 | Ga0307411_10508543 | Ga0307411_105085432 | 246 |
| 163 | 3300032126 | Ga0307415_100299106 | Ga0307415_1002991062 | 246 |
| 164 | 3300041404 | Ga0439436_0018428 | Ga0439436_0018428_1153_1896 | 246 |
| 165 | 3300042007 | Ga0439449_0013926 | Ga0439449_0013926_2267_3010 | 246 |
| 166 | 3300046519 | Ga0495632_0134803 | Ga0495632_0134803_346_1095 | 246 |
| 167 | 3300053134 | Ga0500658_0028553 | Ga0500658_0028553_1375_2130 | 246 |
| 168 | iso_pu_bacteria | 2643221695 | 2644529303 | 246 |
| 169 | 3300005347 | Ga0070668_100105618 | Ga0070668_1001056183 | 247 |
| 170 | 3300005614 | Ga0068856_100050968 | Ga0068856_1000509682 | 247 |
| 171 | 3300005841 | Ga0068863_100091584 | Ga0068863_1000915843 | 247 |
| 172 | 3300009553 | Ga0105249_10000193 | Ga0105249_1000019314 | 247 |
| 173 | 3300010375 | Ga0105239_10021578 | Ga0105239_100215783 | 247 |
| 174 | 3300025938 | Ga0207704_10282649 | Ga0207704_102826491 | 247 |
| 175 | 3300025960 | Ga0207651_10557982 | Ga0207651_105579821 | 247 |
| 176 | 3300025961 | Ga0207712_10000498 | Ga0207712_1000049814 | 247 |
| 177 | 3300026078 | Ga0207702_10028115 | Ga0207702_100281153 | 247 |
| 178 | 3300026121 | Ga0207683_10064301 | Ga0207683_100643014 | 247 |
| 179 | 3300005617 | Ga0068859_100555654 | Ga0068859_1005556542 | 248 |
| 180 | 3300006931 | Ga0097620_100555677 | Ga0097620_1005556772 | 248 |
| 181 | 3300028379 | Ga0268266_10143862 | Ga0268266_101438622 | 248 |
| 182 | 3300037312 | Ga0395899_0103884 | Ga0395899_0103884_477_1241 | 248 |
| 183 | 3300038443 | Ga0395901_0004606 | Ga0395901_0004606_12747_13511 | 248 |
| 184 | 2162886007 | SwRhRL2b_contig_91162 | SwRhRL2b_0570.00005480 | 249 |
| 185 | 3300005289 | Ga0065704_10072684 | Ga0065704_100726846 | 249 |
| 186 | 3300005458 | Ga0070681_10029979 | Ga0070681_100299796 | 249 |
| 187 | 3300006237 | Ga0097621_100096288 | Ga0097621_1000962882 | 249 |
| 188 | 3300013307 | Ga0157372_10122163 | Ga0157372_101221632 | 249 |
| 189 | 3300013307 | Ga0157372_10309164 | Ga0157372_103091642 | 249 |
| 190 | 3300025912 | Ga0207707_10074441 | Ga0207707_100744412 | 249 |
| 191 | 3300032004 | Ga0307414_10101594 | Ga0307414_101015941 | 249 |
| 192 | 3300037312 | Ga0395899_0079096 | Ga0395899_0079096_1503_2270 | 249 |
| 193 | 3300037418 | Ga0395900_0007994 | Ga0395900_0007994_3181_3942 | 249 |
| 194 | 3300037418 | Ga0395900_0009643 | Ga0395900_0009643_7153_7920 | 249 |
| 195 | 3300037466 | Ga0395898_0016311 | Ga0395898_0016311_1326_2087 | 249 |
| 196 | 3300037466 | Ga0395898_0031775 | Ga0395898_0031775_1326_2087 | 249 |
| 197 | 3300037466 | Ga0395898_0241857 | Ga0395898_0241857_130_897 | 249 |
| 198 | 3300038443 | Ga0395901_0002129 | Ga0395901_0002129_1683_2444 | 249 |
| 199 | 3300038443 | Ga0395901_0063780 | Ga0395901_0063780_1733_2500 | 249 |
| 200 | 3300045976 | Ga0466967_0367454 | Ga0466967_0367454_257_1024 | 249 |
| 201 | 3300048920 | Ga0496117_0033847 | Ga0496117_0033847_2758_3513 | 249 |
| 202 | 3300048921 | Ga0496118_0006604 | Ga0496118_0006604_3297_4052 | 249 |
| 203 | 3300049570 | Ga0501033_0100031 | Ga0501033_0100031_19_780 | 249 |
| 204 | 3300049572 | Ga0501036_0082530 | Ga0501036_0082530_1750_2511 | 249 |
| 205 | 3300049572 | Ga0501036_0095740 | Ga0501036_0095740_1263_2030 | 249 |
| 206 | 3300049575 | Ga0501039_0238704 | Ga0501039_0238704_352_1113 | 249 |
| 207 | 3300049581 | Ga0501047_0062561 | Ga0501047_0062561_2501_3268 | 249 |
| 208 | 3300049581 | Ga0501047_0168543 | Ga0501047_0168543_801_1562 | 249 |
| 209 | 3300049822 | Ga0501035_0147375 | Ga0501035_0147375_1010_1771 | 249 |
| 210 | 3300049823 | Ga0501044_0125800 | Ga0501044_0125800_1724_2485 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iwp-assembly3.cif.gz_I | crystal structure of human copper homeostasis protein cutc | 0.9798 | 7 | 246 |
| 3iwp-assembly6.cif.gz_F | crystal structure of human copper homeostasis protein cutc | 0.9797 | 7 | 245 |
| 3iwp-assembly5.cif.gz_D | crystal structure of human copper homeostasis protein cutc | 0.9794 | 7 | 246 |
| 3iwp-assembly6.cif.gz_E | crystal structure of human copper homeostasis protein cutc | 0.9782 | 5 | 245 |
| 3iwp-assembly4.cif.gz_A | crystal structure of human copper homeostasis protein cutc | 0.9781 | 5 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D8X1_24_272_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9783 | 7 | 246 | 3.20.20.380 |
| af_Q54K76_6_279_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9658 | 7 | 244 | 3.20.20.380 |
| af_Q4E0C3_1_211_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9613 | 7 | 203 | 3.20.20.380 |
| af_P67826_1_248_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9587 | 7 | 249 | 3.20.20.380 |
| af_P34630_10_248_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9514 | 7 | 243 | 3.20.20.380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0GR56-F1-model_v4 | Copper homeostasis protein cutC homolog | 0.9977 | 37 | 150 |
GO:0005507
|
| AF-A0A4R7UL95-F1-model_v4 | deleted | 0.9969 | 4 | 244 |
|
| AF-A0A4U3GNF7-F1-model_v4 | deleted | 0.9956 | 6 | 245 |
|
| AF-A0A2K1PZ15-F1-model_v4 | PF03932 family protein CutC | 0.9949 | 5 | 245 |
GO:0005507
GO:0005737 |
| AF-A0A087T6U7-F1-model_v4 | Copper homeostasis protein cutC homolog | 0.9938 | 49 | 171 |
GO:0005507
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar