F320448

General Info

Members Datasets Scaffolds Average Seq Length
210 127 420 342

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10030766|Ga0207644_100307662
Length 386
Sequence MAGKTLSLCLRDILCSIFNESNQIINQINPTTIVMKKILLXXSXXXXTXASVKAATTAVADTGKVGTTADPKDPPLIFSGSVDTYYKYDFSGHANIPTSFASDQNSVSIGMIDLGLKKKVGKAAFVGELAFGPRGQYQSIPNGDGTTANNGNSFHIQNLYVSYDVTDKLNFTAGYMATFIGYEVISPVGNFNYSTSYLFTSGPFQNAGFKATYAFSDKVSLMAGIFNDNWNTYTAQHDVSTFGAQLMIAPVKGWTAYLNVASGPTSGTIFDLTTAYQITDAFKLGLNAADYSTAHGGLGYQGVALYPQVAVSKIVTFGLRGEYFKIKQGDNIKAVTLTSNIKAGALTIIPEVRLDGANVDTFGFTKGDGTPTKSAGQFVIAAVYAF

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
103 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
104 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
105 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
108 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
109 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
110 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
113 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
114 2738541283 Pedobacter sp. OK701 Isolate Unclassified
115 2738541302 Pedobacter sp. CF074 Isolate Unclassified
116 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
117 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
118 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
119 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
120 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
121 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
122 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
123 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
124 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
125 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
126 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
127 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.48
Metatranscriptomes 0.95
Isolates 8.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 0
Rhizoplane 0.48
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10030766 3300025931 Bacteria 3736
2 JGI24740J21852_10002460 3300001979 Bacteria 8390
3 JGI24739J22299_10013939 3300001989 Bacteria 2928
4 JGI24737J22298_10000014 3300001990 Bacteria 50004
5 JGI24737J22298_10001792 3300001990 Bacteria 7692
6 JGI24737J22298_10010944 3300001990 Bacteria 2979
7 JGI24735J21928_10000008 3300002067 Bacteria 319819
8 JGI25162J39368_1000110 3300002737 Bacteria 89871
9 JGI25152J39213_1000292 3300002773 Bacteria 32967
10 JGI25150J39212_1000014 3300002774 Bacteria 170955
11 JGI25151J46595_10000042 3300003187 Bacteria 170955
12 JGI25153J46596_10000009 3300003215 Bacteria 340925
13 rootH2_10001334 3300003320 Bacteria 238709
14 rootH2_10002127 3300003320 Bacteria 66384
15 rootH2_10064485 3300003320 Bacteria 6031
16 rootH1_10145779 3300003323 Bacteria 2738
17 Ga0055536_1000019 3300003781 Bacteria 203087
18 Ga0055530_10011852 3300003791 Bacteria 3091
19 Ga0065714_10065813 3300005288 Bacteria 8417
20 Ga0065714_10070949 3300005288 Bacteria 3719
21 Ga0070658_10077249 3300005327 Bacteria 2731
22 Ga0068868_100003844 3300005338 Bacteria 10487
23 Ga0070660_100009437 3300005339 Bacteria 6862
24 Ga0070671_100001929 3300005355 Bacteria 15895
25 Ga0070659_100000578 3300005366 Bacteria 26773
26 Ga0070659_100041711 3300005366 Bacteria 3588
27 Ga0070662_100000011 3300005457 Bacteria 133652
28 Ga0068853_100002150 3300005539 Bacteria 14673
29 Ga0068855_100027462 3300005563 Bacteria 6808
30 Ga0068855_100068685 3300005563 Bacteria 4125
31 Ga0068855_100187849 3300005563 Bacteria 2333
32 Ga0068855_100232236 3300005563 Bacteria 2065
33 Ga0068856_100239221 3300005614 Bacteria 1831
34 Ga0068852_100220306 3300005616 Bacteria 1804
35 Ga0068858_100100771 3300005842 Bacteria 2693
36 Ga0075366_10003988 3300006195 Bacteria 7884
37 Ga0075366_10010177 3300006195 Bacteria 5276
38 Ga0105240_10012904 3300009093 Bacteria 11507
39 Ga0105240_10049535 3300009093 Bacteria 5301
40 Ga0105240_10140321 3300009093 Bacteria 2890
41 Ga0105240_10153658 3300009093 Bacteria 2739
42 Ga0105241_10022200 3300009174 Bacteria 4699
43 Ga0105242_10355660 3300009176 Bacteria 1354
44 Ga0105248_10288533 3300009177 Bacteria 1848
45 Ga0105237_10000411 3300009545 Bacteria 60960
46 Ga0105237_10021023 3300009545 Bacteria 6716
47 Ga0105237_10054550 3300009545 Bacteria 4005
48 Ga0105237_10107187 3300009545 Bacteria 2786
49 Ga0105237_10442881 3300009545 Bacteria 1305
50 Ga0105239_10003910 3300010375 Bacteria 18055
51 Ga0105239_10009216 3300010375 Bacteria 11163
52 Ga0105239_10077253 3300010375 Bacteria 3664
53 Ga0105239_10128289 3300010375 Bacteria 2820
54 Ga0105239_10128714 3300010375 Bacteria 2815
55 Ga0105239_10137259 3300010375 Bacteria 2723
56 Ga0157373_10012274 3300013100 Bacteria 6298
57 Ga0157373_10051370 3300013100 Bacteria 2937
58 Ga0157371_10000527 3300013102 Bacteria 45686
59 Ga0157371_10009884 3300013102 Bacteria 7470
60 Ga0157370_10000285 3300013104 Bacteria 64200
61 Ga0157370_10029968 3300013104 Bacteria 5333
62 Ga0157370_10040658 3300013104 Bacteria 4489
63 Ga0157370_10057381 3300013104 Bacteria 3702
64 Ga0157370_10093374 3300013104 Bacteria 2824
65 Ga0157370_10099312 3300013104 Bacteria 2728
66 Ga0157370_10156710 3300013104 Unclassified 2119
67 Ga0157370_10190052 3300013104 Bacteria 1906
68 Ga0157370_10285609 3300013104 Bacteria 1524
69 Ga0157369_10000897 3300013105 Bacteria 37997
70 Ga0157369_10020600 3300013105 Bacteria 7373
71 Ga0157369_10069938 3300013105 Bacteria 3771
72 Ga0157369_10308768 3300013105 Bacteria 1645
73 Ga0157378_10273164 3300013297 Unclassified 1626
74 Ga0163162_10000024 3300013306 Bacteria 188515
75 Ga0163162_10103395 3300013306 Bacteria 2943
76 Ga0163162_10141790 3300013306 Bacteria 2517
77 Ga0163162_10171003 3300013306 Bacteria 2298
78 Ga0157372_10000118 3300013307 Bacteria 84096
79 Ga0157372_10011013 3300013307 Bacteria 9625
80 Ga0157375_10095213 3300013308 Bacteria 3048
81 Ga0157375_10197197 3300013308 Bacteria 2168
82 Ga0157375_10418753 3300013308 Bacteria 1506
83 Ga0163163_10486332 3300014325 Bacteria 1296
84 Ga0182008_10000078 3300014497 Bacteria 77087
85 Ga0182008_10001962 3300014497 Bacteria 13209
86 Ga0182006_1000297 3300015261 Bacteria 43680
87 Ga0182007_10000002 3300015262 Bacteria 564661
88 Ga0182007_10003829 3300015262 Bacteria 7000
89 Ga0182007_10011075 3300015262 Bacteria 3526
90 Ga0183373_1004 3300015682 Bacteria 537398
91 Ga0163161_10003475 3300017792 Bacteria 11043
92 Ga0163161_10009430 3300017792 Bacteria 6754
93 Ga0163161_10009767 3300017792 Bacteria 6651
94 Ga0163161_10013474 3300017792 Bacteria 5692
95 Ga0163161_10042224 3300017792 Bacteria 3279
96 Ga0206351_10985716 3300020077 Bacteria 2600
97 Ga0206350_10138342 3300020080 Bacteria 1833
98 Ga0209437_100077 3300025233 Bacteria 286656
99 Ga0207425_1000023 3300025245 Bacteria 341339
100 Ga0209026_1001207 3300025250 Bacteria 11966
101 Ga0209026_1004773 3300025250 Bacteria 3884
102 Ga0209129_1000032 3300025258 Bacteria 341150
103 Ga0209676_1000009 3300025292 Bacteria 981719
104 Ga0209025_1000047 3300025294 Bacteria 341150
105 Ga0209758_1000145 3300025297 Bacteria 170553
106 Ga0209050_1000094 3300025298 Bacteria 242893
107 Ga0207647_10000543 3300025904 Bacteria 30114
108 Ga0207705_10000108 3300025909 Bacteria 93501
109 Ga0207705_10000916 3300025909 Bacteria 24137
110 Ga0207695_10043778 3300025913 Bacteria 4767
111 Ga0207671_10001816 3300025914 Bacteria 23813
112 Ga0207671_10002127 3300025914 Bacteria 21616
113 Ga0207671_10003999 3300025914 Bacteria 14330
114 Ga0207671_10008018 3300025914 Bacteria 9038
115 Ga0207671_10009786 3300025914 Bacteria 7977
116 Ga0207671_10015758 3300025914 Bacteria 5903
117 Ga0207690_10002593 3300025932 Bacteria 10912
118 Ga0207690_10019605 3300025932 Bacteria 4169
119 Ga0207690_10113315 3300025932 Bacteria 1957
120 Ga0207706_10000246 3300025933 Bacteria 59254
121 Ga0207704_10000011 3300025938 Bacteria 180140
122 Ga0207667_10011579 3300025949 Bacteria 10242
123 Ga0207667_10038565 3300025949 Bacteria 5101
124 Ga0207667_10083603 3300025949 Bacteria 3305
125 Ga0207667_10367518 3300025949 Bacteria 1466
126 Ga0207640_10023086 3300025981 Bacteria 3735
127 Ga0207677_10062395 3300026023 Bacteria 2585
128 Ga0207703_10076557 3300026035 Bacteria 2776
129 Ga0207639_10031064 3300026041 Bacteria 3923
130 Ga0207702_10164815 3300026078 Bacteria 2027
131 Ga0268266_10000380 3300028379 Bacteria 67791
132 Ga0307515_10000172 3300028794 Bacteria 159265
133 Ga0307515_10001710 3300028794 Bacteria 48899
134 Ga0307515_10007640 3300028794 Bacteria 21325
135 Ga0307515_10107926 3300028794 Bacteria 3285
136 Ga0307515_10219407 3300028794 Bacteria 1724
137 Ga0307408_100001899 3300031548 Bacteria 15198
138 Ga0307408_100001976 3300031548 Bacteria 14793
139 Ga0307413_10094162 3300031824 Bacteria 1960
140 Ga0307412_10000698 3300031911 Bacteria 19359
141 Ga0307414_10015327 3300032004 Bacteria 4627
142 Ga0307414_10118115 3300032004 Bacteria 2033
143 Ga0307510_10002780 3300033180 Bacteria 20056
144 Ga0307510_10088304 3300033180 Bacteria 2960
145 Ga0395899_0000926 3300037312 Bacteria 27634
146 Ga0395900_0000014 3300037418 Bacteria 386513
147 Ga0395900_0000557 3300037418 Bacteria 51834
148 Ga0395898_0006998 3300037466 Bacteria 11986
149 Ga0395905_0000241 3300037471 Bacteria 82847
150 Ga0395905_0000303 3300037471 Bacteria 71615
151 Ga0395901_0000446 3300038443 Bacteria 48079
152 Ga0395901_0000582 3300038443 Bacteria 42425
153 Ga0395901_0047267 3300038443 Bacteria 4469
154 Ga0436361_1100175 3300039447 Bacteria 5051
155 Ga0495650_0021786 3300046471 Bacteria 3085
156 Ga0495605_0117257 3300046474 Bacteria 1210
157 Ga0495585_0000767 3300046492 Bacteria 28423
158 Ga0495606_0156957 3300046507 Unclassified 1330
159 Ga0495616_0010864 3300046513 Bacteria 5244
160 Ga0495631_0003938 3300046518 Bacteria 8024
161 Ga0495632_0046040 3300046519 Bacteria 2170
162 Ga0495648_0004548 3300046524 Bacteria 11816
163 Ga0495648_0029991 3300046524 Bacteria 3603
164 Ga0495633_0000161 3300046558 Bacteria 87685
165 Ga0495633_0080114 3300046558 Bacteria 1520
166 Ga0495668_0000041 3300046616 Bacteria 229462
167 Ga0495625_0000586 3300046660 Bacteria 52844
168 Ga0495625_0002085 3300046660 Bacteria 22344
169 Ga0495625_0005888 3300046660 Bacteria 11039
170 Ga0495625_0007171 3300046660 Bacteria 9779
171 Ga0495625_0016289 3300046660 Bacteria 5854
172 Ga0495661_0044274 3300046665 Unclassified 2730
173 Ga0495671_0133592 3300046692 Bacteria 1210
174 Ga0495687_002833 3300047443 Bacteria 13355
175 Ga0495687_058071 3300047443 Bacteria 1606
176 Ga0495686_0000196 3300047472 Bacteria 112875
177 Ga0495686_0065058 3300047472 Bacteria 2255
178 Ga0495614_0009626 3300048089 Bacteria 4271
179 Ga0496122_0001975 3300048925 Bacteria 30642
180 Ga0496123_0013583 3300048926 Bacteria 6819
181 Ga0495678_004793 3300049459 Bacteria 7698
182 Ga0495682_0092029 3300049460 Bacteria 1089
183 Ga0501238_021492 3300049671 Bacteria 914
184 Ga0501249_000025 3300049679 Bacteria 91259
185 nmdc:mga0k408_3988_c1 3300050493 Bacteria 7827
186 nmdc:mga0k408_433_c2 3300050493 Bacteria 5846
187 Ga0500635_0014614 3300053080 Bacteria 2304
188 Ga0500647_0096238 3300053091 Bacteria 1416
189 Ga0500594_0001373 3300053118 Bacteria 5285
190 Ga0500608_000548 3300053122 Bacteria 14063
191 Ga0500608_044169 3300053122 Bacteria 2139
192 Ga0500622_0001353 3300053156 Bacteria 19841
193 2513232308 2513020052 Bacteria 5120511
194 2599480170 2599185184 Bacteria 6430550
195 2738755266 2738541283 Bacteria 7222293
196 2738856122 2738541302 Bacteria 5944758
197 2852623396 2852623160 Bacteria 4376875
198 2857629258 2857627736 Bacteria 5625397
199 2884937727 2884933994 Bacteria 4535041
200 2919190212 2919186247 Bacteria 6244071
201 2919438509 2919437846 Bacteria 6199444
202 2919442957 2919437846 Bacteria 6199444
203 2919686237 2919683626 Bacteria 5534354
204 2928083613 2928078545 Bacteria 6534839
205 2928151126 2928147474 Bacteria 6512076
206 2932084424 2932082852 Bacteria 6563563
207 2939668493 2939664404 Bacteria 6364494
208 2977232541 2977232053 Bacteria 5485925
209 2977235953 2977232053 Bacteria 5485925
210 8056440229 8056440228 Bacteria 4946504
211 Ga0207644_10030766
212 JGI24740J21852_10002460
213 JGI24739J22299_10013939
214 JGI24737J22298_10000014
215 JGI24737J22298_10001792
216 JGI24737J22298_10010944
217 JGI24735J21928_10000008
218 JGI25162J39368_1000110
219 JGI25152J39213_1000292
220 JGI25150J39212_1000014
221 JGI25151J46595_10000042
222 JGI25153J46596_10000009
223 rootH2_10001334
224 rootH2_10002127
225 rootH2_10064485
226 rootH1_10145779
227 Ga0055536_1000019
228 Ga0055530_10011852
229 Ga0065714_10065813
230 Ga0065714_10070949
231 Ga0070658_10077249
232 Ga0068868_100003844
233 Ga0070660_100009437
234 Ga0070671_100001929
235 Ga0070659_100000578
236 Ga0070659_100041711
237 Ga0070662_100000011
238 Ga0068853_100002150
239 Ga0068855_100027462
240 Ga0068855_100068685
241 Ga0068855_100187849
242 Ga0068855_100232236
243 Ga0068856_100239221
244 Ga0068852_100220306
245 Ga0068858_100100771
246 Ga0075366_10003988
247 Ga0075366_10010177
248 Ga0105240_10012904
249 Ga0105240_10049535
250 Ga0105240_10140321
251 Ga0105240_10153658
252 Ga0105241_10022200
253 Ga0105242_10355660
254 Ga0105248_10288533
255 Ga0105237_10000411
256 Ga0105237_10021023
257 Ga0105237_10054550
258 Ga0105237_10107187
259 Ga0105237_10442881
260 Ga0105239_10003910
261 Ga0105239_10009216
262 Ga0105239_10077253
263 Ga0105239_10128289
264 Ga0105239_10128714
265 Ga0105239_10137259
266 Ga0157373_10012274
267 Ga0157373_10051370
268 Ga0157371_10000527
269 Ga0157371_10009884
270 Ga0157370_10000285
271 Ga0157370_10029968
272 Ga0157370_10040658
273 Ga0157370_10057381
274 Ga0157370_10093374
275 Ga0157370_10099312
276 Ga0157370_10156710
277 Ga0157370_10190052
278 Ga0157370_10285609
279 Ga0157369_10000897
280 Ga0157369_10020600
281 Ga0157369_10069938
282 Ga0157369_10308768
283 Ga0157378_10273164
284 Ga0163162_10000024
285 Ga0163162_10103395
286 Ga0163162_10141790
287 Ga0163162_10171003
288 Ga0157372_10000118
289 Ga0157372_10011013
290 Ga0157375_10095213
291 Ga0157375_10197197
292 Ga0157375_10418753
293 Ga0163163_10486332
294 Ga0182008_10000078
295 Ga0182008_10001962
296 Ga0182006_1000297
297 Ga0182007_10000002
298 Ga0182007_10003829
299 Ga0182007_10011075
300 Ga0183373_1004
301 Ga0163161_10003475
302 Ga0163161_10009430
303 Ga0163161_10009767
304 Ga0163161_10013474
305 Ga0163161_10042224
306 Ga0206351_10985716
307 Ga0206350_10138342
308 Ga0209437_100077
309 Ga0207425_1000023
310 Ga0209026_1001207
311 Ga0209026_1004773
312 Ga0209129_1000032
313 Ga0209676_1000009
314 Ga0209025_1000047
315 Ga0209758_1000145
316 Ga0209050_1000094
317 Ga0207647_10000543
318 Ga0207705_10000108
319 Ga0207705_10000916
320 Ga0207695_10043778
321 Ga0207671_10001816
322 Ga0207671_10002127
323 Ga0207671_10003999
324 Ga0207671_10008018
325 Ga0207671_10009786
326 Ga0207671_10015758
327 Ga0207690_10002593
328 Ga0207690_10019605
329 Ga0207690_10113315
330 Ga0207706_10000246
331 Ga0207704_10000011
332 Ga0207667_10011579
333 Ga0207667_10038565
334 Ga0207667_10083603
335 Ga0207667_10367518
336 Ga0207640_10023086
337 Ga0207677_10062395
338 Ga0207703_10076557
339 Ga0207639_10031064
340 Ga0207702_10164815
341 Ga0268266_10000380
342 Ga0307515_10000172
343 Ga0307515_10001710
344 Ga0307515_10007640
345 Ga0307515_10107926
346 Ga0307515_10219407
347 Ga0307408_100001899
348 Ga0307408_100001976
349 Ga0307413_10094162
350 Ga0307412_10000698
351 Ga0307414_10015327
352 Ga0307414_10118115
353 Ga0307510_10002780
354 Ga0307510_10088304
355 Ga0395899_0000926
356 Ga0395900_0000014
357 Ga0395900_0000557
358 Ga0395898_0006998
359 Ga0395905_0000241
360 Ga0395905_0000303
361 Ga0395901_0000446
362 Ga0395901_0000582
363 Ga0395901_0047267
364 Ga0436361_1100175
365 Ga0495650_0021786
366 Ga0495605_0117257
367 Ga0495585_0000767
368 Ga0495606_0156957
369 Ga0495616_0010864
370 Ga0495631_0003938
371 Ga0495632_0046040
372 Ga0495648_0004548
373 Ga0495648_0029991
374 Ga0495633_0000161
375 Ga0495633_0080114
376 Ga0495668_0000041
377 Ga0495625_0000586
378 Ga0495625_0002085
379 Ga0495625_0005888
380 Ga0495625_0007171
381 Ga0495625_0016289
382 Ga0495661_0044274
383 Ga0495671_0133592
384 Ga0495687_002833
385 Ga0495687_058071
386 Ga0495686_0000196
387 Ga0495686_0065058
388 Ga0495614_0009626
389 Ga0496122_0001975
390 Ga0496123_0013583
391 Ga0495678_004793
392 Ga0495682_0092029
393 Ga0501238_021492
394 Ga0501249_000025
395 nmdc:mga0k408_3988_c1
396 nmdc:mga0k408_433_c2
397 Ga0500635_0014614
398 Ga0500647_0096238
399 Ga0500594_0001373
400 Ga0500608_000548
401 Ga0500608_044169
402 Ga0500622_0001353
403 2513232308
404 2599480170
405 2738755266
406 2738856122
407 2852623396
408 2857629258
409 2884937727
410 2919190212
411 2919438509
412 2919442957
413 2919686237
414 2928083613
415 2928151126
416 2932084424
417 2939668493
418 2977232541
419 2977235953
420 8056440229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07642

BBP2

Putative beta-barrel porin-2, OmpL-like. bbp2

75

386

0.93

PF07396

Porin_O_P

Phosphate-selective porin O and P

84

297

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uu2-assembly1.cif.gz_C salmonella typhi osmoporin(ompc):an outer membrane protein 0.7118 21 348
3uu2-assembly1.cif.gz_C salmonella typhi osmoporin(ompc):an outer membrane protein 0.7096 21 348
7ff7-assembly1.cif.gz_A structure of ompf2 0.7017 24 348
1e54-assembly1.cif.gz_A anion-selective porin from comamonas acidovorans 0.69 31 348
1bt9-assembly1.cif.gz_A ompf porin mutant d74a 0.6865 21 348
ID Description Score Start End Superfamily
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.7259 21 348 2.40.160.10
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.7237 21 348 2.40.160.10
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6912 30 348 2.40.160.10
4gf4A00 Mainly Beta;Beta Barrel;Porin;Carbohydrate-selective porin OprB 0.6735 32 348 2.40.160.180
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6671 30 348 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A7Y1YD85-F1-model_v4 Porin 0.9233 21 348
AF-A0A2J6H808-F1-model_v4 Porin 0.9186 20 247
AF-A0A4Q6DYI4-F1-model_v4 Porin 0.914 144 348
AF-W6TME4-F1-model_v4 Porin 0.9106 68 348
AF-W6TME4-F1-model_v4 Porin 0.9075 68 348

Map