F320491

General Info

Members Datasets Scaffolds Average Seq Length
210 123 210 312

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10020012|Ga0207428_100200124
Length 336
Sequence LTEGPHRVSLVLPTKNGAATLPAVLEAVWRQRASFGLETIAIDSGSTDGTLDLLRGKVTHLISIPPHTYDHGLTRNLGIMQATGELVVLLVQDAVPASEHWLEALTTPLFADPELAGTFARQQPAPNASAIARHYLSKWVASKDSAWTRSLNGPAELDDLLPLQRMEFCAFDNVCSCIRRSVWTEHPFHSSPIAEDLQWAREVLLAGHKLAFVPEAVVVHSHDRSPWYELFRTHALHKRLSELFGIETIPTPQLLARAIASSLVTNLWCERAAPAQWPRAAALSVVWPLAQYLGARDARAKGTGQRAEGRVKGEKEKEVTLPEPDLYDRPGTILKL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10070697 3300005290 Bacteria 5775
2 Ga0070676_10019085 3300005328 Bacteria 3810
3 Ga0070683_100013210 3300005329 Bacteria 7193
4 Ga0070670_100001174 3300005331 Bacteria 20803
5 Ga0070677_10019248 3300005333 Bacteria 2470
6 Ga0070689_100240141 3300005340 Bacteria 1492
7 Ga0070661_100029230 3300005344 Unclassified 3977
8 Ga0070668_100159356 3300005347 Bacteria 1830
9 Ga0070669_100026329 3300005353 Bacteria 4184
10 Ga0070675_100003488 3300005354 Bacteria 11927
11 Ga0070675_100083640 3300005354 Bacteria 2664
12 Ga0070671_100018452 3300005355 Bacteria 5667
13 Ga0070671_100090684 3300005355 Bacteria 2559
14 Ga0070674_100021562 3300005356 Bacteria 4140
15 Ga0070673_100011620 3300005364 Bacteria 6014
16 Ga0070673_100024091 3300005364 Bacteria 4456
17 Ga0070673_100038963 3300005364 Unclassified 3634
18 Ga0070673_100347977 3300005364 Unclassified 1315
19 Ga0070667_100191213 3300005367 Bacteria 1813
20 Ga0070667_100327231 3300005367 Bacteria 1384
21 Ga0070709_10000005 3300005434 Bacteria 197619
22 Ga0070701_10007187 3300005438 Bacteria 4740
23 Ga0070705_100116224 3300005440 Unclassified 1719
24 Ga0070694_100242409 3300005444 Bacteria 1360
25 Ga0070663_100018918 3300005455 Unclassified 4527
26 Ga0070663_100029527 3300005455 Unclassified 3748
27 Ga0070662_100131774 3300005457 Unclassified 1928
28 Ga0070662_100231892 3300005457 Bacteria 1477
29 Ga0070681_10321481 3300005458 Bacteria 1457
30 Ga0068867_100000708 3300005459 Bacteria 22219
31 Ga0070685_10074228 3300005466 Bacteria 2023
32 Ga0070679_100299313 3300005530 Bacteria 1559
33 Ga0070684_100000941 3300005535 Bacteria 20724
34 Ga0070672_100037038 3300005543 Bacteria 3720
35 Ga0070672_100046579 3300005543 Bacteria 3360
36 Ga0070672_100062089 3300005543 Bacteria 2948
37 Ga0070672_100152705 3300005543 Bacteria 1911
38 Ga0070686_100134656 3300005544 Bacteria 1713
39 Ga0070693_100004577 3300005547 Bacteria 6561
40 Ga0070704_100067617 3300005549 Unclassified 2581
41 Ga0070664_100002693 3300005564 Bacteria 14333
42 Ga0068859_100072865 3300005617 Bacteria 3472
43 Ga0068859_100324736 3300005617 Bacteria 1633
44 Ga0068861_100036879 3300005719 Bacteria 3632
45 Ga0068861_100300348 3300005719 Unclassified 1390
46 Ga0068851_10061297 3300005834 Bacteria 1928
47 Ga0068870_10036439 3300005840 Bacteria 2531
48 Ga0068863_100120814 3300005841 Bacteria 2498
49 Ga0068858_100040297 3300005842 Bacteria 4331
50 Ga0068858_100119106 3300005842 Bacteria 2468
51 Ga0068858_100207227 3300005842 Bacteria 1855
52 Ga0068860_100137159 3300005843 Bacteria 2350
53 Ga0068860_100508751 3300005843 Bacteria 1203
54 Ga0068862_100146636 3300005844 Bacteria 2098
55 Ga0070716_100027702 3300006173 Unclassified 3047
56 Ga0097621_100030980 3300006237 Bacteria 4240
57 Ga0097621_100285660 3300006237 Bacteria 1453
58 Ga0068871_100008084 3300006358 Bacteria 7553
59 Ga0075428_100000078 3300006844 Bacteria 80448
60 Ga0075428_100117399 3300006844 Bacteria 2899
61 Ga0075428_100191987 3300006844 Bacteria 2209
62 Ga0075430_100003650 3300006846 Bacteria 12920
63 Ga0075430_100003689 3300006846 Bacteria 12862
64 Ga0075430_100040658 3300006846 Unclassified 3935
65 Ga0075431_100003019 3300006847 Bacteria 16283
66 Ga0075431_100041614 3300006847 Bacteria 4738
67 Ga0075431_100046884 3300006847 Unclassified 4456
68 Ga0075433_10103611 3300006852 Unclassified 2520
69 Ga0075433_10117413 3300006852 Unclassified 2361
70 Ga0075433_10179934 3300006852 Bacteria 1881
71 Ga0075434_100013121 3300006871 Bacteria 7870
72 Ga0075434_100130417 3300006871 Unclassified 2532
73 Ga0075429_100002680 3300006880 Bacteria 14985
74 Ga0075429_100099138 3300006880 Bacteria 2542
75 Ga0068865_100007674 3300006881 Bacteria 6645
76 Ga0068865_100226248 3300006881 Bacteria 1465
77 Ga0068865_100227793 3300006881 Bacteria 1460
78 Ga0075436_100054024 3300006914 Bacteria 2772
79 Ga0097620_100072862 3300006931 Bacteria 3472
80 Ga0097620_100324756 3300006931 Bacteria 1633
81 Ga0075435_100089519 3300007076 Bacteria 2538
82 Ga0111539_10010736 3300009094 Bacteria 11525
83 Ga0111539_10013731 3300009094 Bacteria 10118
84 Ga0111539_10045352 3300009094 Bacteria 5263
85 Ga0111539_10072412 3300009094 Bacteria 4064
86 Ga0111539_10073111 3300009094 Bacteria 4042
87 Ga0111539_10285552 3300009094 Bacteria 1920
88 Ga0105247_10204649 3300009101 Unclassified 1328
89 Ga0114129_10000323 3300009147 Bacteria 56097
90 Ga0114129_10009555 3300009147 Bacteria 13830
91 Ga0114129_10038168 3300009147 Bacteria 6778
92 Ga0114129_10072695 3300009147 Bacteria 4794
93 Ga0114129_10089253 3300009147 Unclassified 4273
94 Ga0114129_10118356 3300009147 Bacteria 3649
95 Ga0114129_10160660 3300009147 Unclassified 3069
96 Ga0114129_10194831 3300009147 Unclassified 2749
97 Ga0114129_10471406 3300009147 Bacteria 1644
98 Ga0105242_10685930 3300009176 Unclassified 1000
99 Ga0105248_10046686 3300009177 Unclassified 4855
100 Ga0105248_10091188 3300009177 Unclassified 3432
101 Ga0105248_10187431 3300009177 Unclassified 2331
102 Ga0105248_10236122 3300009177 Unclassified 2058
103 Ga0105238_10018859 3300009551 Bacteria 7023
104 Ga0105249_10272843 3300009553 Bacteria 1686
105 Ga0157374_10026540 3300013296 Bacteria 5212
106 Ga0157374_10223336 3300013296 Bacteria 1849
107 Ga0163163_10033389 3300014325 Bacteria 4977
108 Ga0163163_10352871 3300014325 Bacteria 1527
109 Ga0157380_10046981 3300014326 Unclassified 3393
110 Ga0157380_10076691 3300014326 Unclassified 2721
111 Ga0157380_10088214 3300014326 Bacteria 2552
112 Ga0157380_10162799 3300014326 Bacteria 1941
113 Ga0157380_10264041 3300014326 Bacteria 1565
114 Ga0157379_10052759 3300014968 Unclassified 3631
115 Ga0207682_10018624 3300025893 Bacteria 2715
116 Ga0207699_10000015 3300025906 Bacteria 251707
117 Ga0207699_10131265 3300025906 Unclassified 1634
118 Ga0207645_10003966 3300025907 Bacteria 11045
119 Ga0207643_10107846 3300025908 Bacteria 1638
120 Ga0207643_10221553 3300025908 Bacteria 1158
121 Ga0207693_10321406 3300025915 Bacteria 1211
122 Ga0207649_10027415 3300025920 Unclassified 3342
123 Ga0207681_10017320 3300025923 Bacteria 4523
124 Ga0207681_10051427 3300025923 Bacteria 2792
125 Ga0207681_10192416 3300025923 Bacteria 1561
126 Ga0207694_10292746 3300025924 Bacteria 1339
127 Ga0207650_10099653 3300025925 Unclassified 2234
128 Ga0207659_10002191 3300025926 Bacteria 11611
129 Ga0207659_10008525 3300025926 Bacteria 6372
130 Ga0207644_10010406 3300025931 Bacteria 6129
131 Ga0207644_10017003 3300025931 Bacteria 4903
132 Ga0207706_10046163 3300025933 Bacteria 3857
133 Ga0207706_10113614 3300025933 Unclassified 2382
134 Ga0207706_10237079 3300025933 Bacteria 1595
135 Ga0207709_10061302 3300025935 Bacteria 2350
136 Ga0207670_10038460 3300025936 Unclassified 3125
137 Ga0207670_10091543 3300025936 Bacteria 2151
138 Ga0207670_10239466 3300025936 Bacteria 1397
139 Ga0207669_10002901 3300025937 Bacteria 7359
140 Ga0207704_10055899 3300025938 Unclassified 2414
141 Ga0207704_10057553 3300025938 Bacteria 2389
142 Ga0207704_10101290 3300025938 Bacteria 1921
143 Ga0207704_10232100 3300025938 Bacteria 1373
144 Ga0207665_10043185 3300025939 Bacteria 3014
145 Ga0207665_10082615 3300025939 Unclassified 2214
146 Ga0207691_10014827 3300025940 Bacteria 7427
147 Ga0207691_10026300 3300025940 Bacteria 5462
148 Ga0207691_10161636 3300025940 Bacteria 1964
149 Ga0207691_10192992 3300025940 Bacteria 1776
150 Ga0207711_10166849 3300025941 Unclassified 1996
151 Ga0207689_10001155 3300025942 Bacteria 25406
152 Ga0207661_10005267 3300025944 Bacteria 9102
153 Ga0207679_10007680 3300025945 Bacteria 6850
154 Ga0207651_10009181 3300025960 Bacteria 5391
155 Ga0207651_10196616 3300025960 Bacteria 1612
156 Ga0207658_10059932 3300025986 Bacteria 2838
157 Ga0207658_10082671 3300025986 Bacteria 2467
158 Ga0207658_10172099 3300025986 Unclassified 1785
159 Ga0207703_10059466 3300026035 Bacteria 3121
160 Ga0207703_10136927 3300026035 Bacteria 2121
161 Ga0207678_10012858 3300026067 Bacteria 7348
162 Ga0207678_10046877 3300026067 Unclassified 3738
163 Ga0207702_10347104 3300026078 Unclassified 1419
164 Ga0207648_10001137 3300026089 Bacteria 29904
165 Ga0207675_100038801 3300026118 Bacteria 4445
166 Ga0207675_100232888 3300026118 Bacteria 1777
167 Ga0207428_10020012 3300027907 Bacteria 5699
168 Ga0207428_10034075 3300027907 Bacteria 4176
169 Ga0207428_10044155 3300027907 Bacteria 3596
170 Ga0268265_10545766 3300028380 Bacteria 1100
171 Ga0268264_10034357 3300028381 Bacteria 4170
172 Ga0268264_10300119 3300028381 Bacteria 1512
173 Ga0373944_0052193 3300035089 Bacteria 1291
174 Ga0373947_0047378 3300035725 Bacteria 2576
175 Ga0373937_0489262 3300036401 Bacteria 1169
176 Ga0451577_0003991 3300042876 Bacteria 15889
177 Ga0453684_0000428 3300044712 Bacteria 171577
178 Ga0451576_0361208 3300045051 Unclassified 1521
179 Ga0451576_0490608 3300045051 Bacteria 1290
180 Ga0466967_0509995 3300045976 Bacteria 1181
181 Ga0495639_0009452 3300046475 Bacteria 4181
182 Ga0495586_0242330 3300046535 Unclassified 1028
183 Ga0495599_0097385 3300046678 Bacteria 1834
184 Ga0496104_0019148 3300048907 Bacteria 6257
185 Ga0496105_0031951 3300048908 Unclassified 4317
186 Ga0496106_0054730 3300048909 Unclassified 3015
187 Ga0496108_0399706 3300048911 Unclassified 1200
188 Ga0496109_0052839 3300048912 Unclassified 3704
189 Ga0496110_0004522 3300048913 Bacteria 10790
190 Ga0496111_0001625 3300048914 Bacteria 13018
191 Ga0496114_0070209 3300048917 Unclassified 2942
192 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
193 nmdc:mga05p37_49530_c1 3300050507 Bacteria 5167
194 nmdc:mga05p37_58623_c1 3300050507 Bacteria 4742
195 nmdc:mga09592_3365_c1 3300050508 Bacteria 12924
196 nmdc:mga0qj67_20815_c1 3300050509 Bacteria 5024
197 nmdc:mga0qj67_241165_c1 3300050509 Bacteria 1467
198 nmdc:mga06r32_129355_c1 3300050510 Unclassified 2495
199 nmdc:mga06r32_418467_c1 3300050510 Unclassified 1321
200 nmdc:mga06r32_468360_c1 3300050510 Bacteria 1239
201 nmdc:mga08y16_22025_c1 3300050511 Bacteria 6729
202 nmdc:mga08y16_29778_c1 3300050511 Bacteria 5748
203 nmdc:mga08y16_5621_c1 3300050511 Bacteria 13132
204 nmdc:mga0n895_55551_c1 3300050512 Bacteria 3897
205 nmdc:mga08x19_5131_c1 3300050514 Bacteria 7746
206 nmdc:mga0a205_135162_c1 3300050515 Bacteria 2366
207 nmdc:mga0a205_367482_c1 3300050515 Bacteria 1305
208 Ga0495595_0103341 3300053084 Bacteria 1377
209 Ga0501084_0179161 3300054114 Unclassified 1789
210 Ga0530510_0293496 3300061734 Bacteria 1216

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10236122 Ga0105248_102361222 267
2 3300054114 Ga0501084_0179161 Ga0501084_0179161_935_1762 269
3 3300048911 Ga0496108_0399706 Ga0496108_0399706_356_1189 276
4 3300009094 Ga0111539_10285552 Ga0111539_102855522 282
5 3300006914 Ga0075436_100054024 Ga0075436_1000540242 289
6 3300050514 nmdc:mga08x19_5131_c1 nmdc:mga08x19_5131_c1_1903_2775 289
7 3300050509 nmdc:mga0qj67_241165_c1 nmdc:mga0qj67_241165_c1_576_1451 290
8 3300009147 Ga0114129_10160660 Ga0114129_101606603 291
9 3300007076 Ga0075435_100089519 Ga0075435_1000895192 293
10 3300046678 Ga0495599_0097385 Ga0495599_0097385_578_1516 294
11 3300009176 Ga0105242_10685930 Ga0105242_106859301 295
12 3300014326 Ga0157380_10046981 Ga0157380_100469812 296
13 3300046535 Ga0495586_0242330 Ga0495586_0242330_34_975 296
14 3300061734 Ga0530510_0293496 Ga0530510_0293496_167_1066 296
15 3300005364 Ga0070673_100038963 Ga0070673_1000389632 297
16 3300006871 Ga0075434_100130417 Ga0075434_1001304172 299
17 3300009094 Ga0111539_10013731 Ga0111539_100137316 299
18 3300009147 Ga0114129_10000323 Ga0114129_1000032336 300
19 3300050507 nmdc:mga05p37_1_c1 nmdc:mga05p37_1_c1_161210_162190 300
20 3300050511 nmdc:mga08y16_22025_c1 nmdc:mga08y16_22025_c1_2739_3719 300
21 3300050515 nmdc:mga0a205_135162_c1 nmdc:mga0a205_135162_c1_882_1862 300
22 3300009177 Ga0105248_10187431 Ga0105248_101874312 301
23 3300005340 Ga0070689_100240141 Ga0070689_1002401412 302
24 3300005434 Ga0070709_10000005 Ga0070709_1000000514 302
25 3300005440 Ga0070705_100116224 Ga0070705_1001162242 302
26 3300005444 Ga0070694_100242409 Ga0070694_1002424091 302
27 3300006358 Ga0068871_100008084 Ga0068871_1000080847 302
28 3300006844 Ga0075428_100000078 Ga0075428_10000007823 302
29 3300006844 Ga0075428_100191987 Ga0075428_1001919872 302
30 3300006846 Ga0075430_100040658 Ga0075430_1000406582 302
31 3300006880 Ga0075429_100099138 Ga0075429_1000991382 302
32 3300009094 Ga0111539_10073111 Ga0111539_100731113 302
33 3300009147 Ga0114129_10089253 Ga0114129_100892532 302
34 3300009147 Ga0114129_10118356 Ga0114129_101183562 302
35 3300009147 Ga0114129_10471406 Ga0114129_104714062 302
36 3300025906 Ga0207699_10000015 Ga0207699_10000015138 302
37 3300025936 Ga0207670_10239466 Ga0207670_102394662 302
38 3300025939 Ga0207665_10043185 Ga0207665_100431852 302
39 3300027907 Ga0207428_10034075 Ga0207428_100340752 302
40 3300027907 Ga0207428_10044155 Ga0207428_100441552 302
41 3300045051 Ga0451576_0361208 Ga0451576_0361208_557_1468 302
42 3300045051 Ga0451576_0490608 Ga0451576_0490608_295_1260 302
43 3300046475 Ga0495639_0009452 Ga0495639_0009452_1909_2820 302
44 3300050510 nmdc:mga06r32_418467_c1 nmdc:mga06r32_418467_c1_121_1050 302
45 3300050511 nmdc:mga08y16_5621_c1 nmdc:mga08y16_5621_c1_11946_12911 302
46 3300005617 Ga0068859_100324736 Ga0068859_1003247362 303
47 3300006847 Ga0075431_100041614 Ga0075431_1000416141 303
48 3300006852 Ga0075433_10103611 Ga0075433_101036112 303
49 3300006881 Ga0068865_100226248 Ga0068865_1002262482 303
50 3300006931 Ga0097620_100324756 Ga0097620_1003247562 303
51 3300009147 Ga0114129_10009555 Ga0114129_100095554 303
52 3300025938 Ga0207704_10232100 Ga0207704_102321002 303
53 3300050515 nmdc:mga0a205_367482_c1 nmdc:mga0a205_367482_c1_93_1010 303
54 3300042876 Ga0451577_0003991 Ga0451577_0003991_3140_4072 304
55 3300044712 Ga0453684_0000428 Ga0453684_0000428_109770_110702 304
56 3300036401 Ga0373937_0489262 Ga0373937_0489262_56_976 305
57 3300005844 Ga0068862_100146636 Ga0068862_1001466362 307
58 3300006237 Ga0097621_100285660 Ga0097621_1002856602 307
59 3300006852 Ga0075433_10117413 Ga0075433_101174132 307
60 3300009094 Ga0111539_10010736 Ga0111539_100107365 307
61 3300009094 Ga0111539_10045352 Ga0111539_100453523 307
62 3300009094 Ga0111539_10072412 Ga0111539_100724123 307
63 3300009553 Ga0105249_10272843 Ga0105249_102728432 307
64 3300014326 Ga0157380_10088214 Ga0157380_100882142 307
65 3300025936 Ga0207670_10038460 Ga0207670_100384602 307
66 3300025940 Ga0207691_10192992 Ga0207691_101929922 307
67 3300026118 Ga0207675_100232888 Ga0207675_1002328882 307
68 3300027907 Ga0207428_10020012 Ga0207428_100200124 307
69 3300028380 Ga0268265_10545766 Ga0268265_105457662 307
70 3300050511 nmdc:mga08y16_29778_c1 nmdc:mga08y16_29778_c1_4754_5680 307
71 3300005458 Ga0070681_10321481 Ga0070681_103214811 309
72 3300005530 Ga0070679_100299313 Ga0070679_1002993131 309
73 3300005719 Ga0068861_100300348 Ga0068861_1003003481 309
74 3300005842 Ga0068858_100119106 Ga0068858_1001191062 309
75 3300009101 Ga0105247_10204649 Ga0105247_102046492 309
76 3300014325 Ga0163163_10352871 Ga0163163_103528712 309
77 3300014326 Ga0157380_10076691 Ga0157380_100766912 309
78 3300014326 Ga0157380_10162799 Ga0157380_101627992 309
79 3300026078 Ga0207702_10347104 Ga0207702_103471041 309
80 3300045976 Ga0466967_0509995 Ga0466967_0509995_22_954 309
81 3300005328 Ga0070676_10019085 Ga0070676_100190853 310
82 3300005333 Ga0070677_10019248 Ga0070677_100192481 310
83 3300005353 Ga0070669_100026329 Ga0070669_1000263291 310
84 3300005354 Ga0070675_100003488 Ga0070675_1000034884 310
85 3300005354 Ga0070675_100083640 Ga0070675_1000836401 310
86 3300005355 Ga0070671_100090684 Ga0070671_1000906842 310
87 3300005356 Ga0070674_100021562 Ga0070674_1000215624 310
88 3300005364 Ga0070673_100011620 Ga0070673_1000116202 310
89 3300005364 Ga0070673_100024091 Ga0070673_1000240912 310
90 3300005364 Ga0070673_100347977 Ga0070673_1003479771 310
91 3300005367 Ga0070667_100191213 Ga0070667_1001912132 310
92 3300005438 Ga0070701_10007187 Ga0070701_100071872 310
93 3300005455 Ga0070663_100029527 Ga0070663_1000295272 310
94 3300005457 Ga0070662_100231892 Ga0070662_1002318921 310
95 3300005459 Ga0068867_100000708 Ga0068867_1000007084 310
96 3300005543 Ga0070672_100037038 Ga0070672_1000370382 310
97 3300005543 Ga0070672_100062089 Ga0070672_1000620893 310
98 3300005543 Ga0070672_100152705 Ga0070672_1001527052 310
99 3300005544 Ga0070686_100134656 Ga0070686_1001346562 310
100 3300005549 Ga0070704_100067617 Ga0070704_1000676172 310
101 3300005617 Ga0068859_100072865 Ga0068859_1000728652 310
102 3300005719 Ga0068861_100036879 Ga0068861_1000368792 310
103 3300005834 Ga0068851_10061297 Ga0068851_100612972 310
104 3300005840 Ga0068870_10036439 Ga0068870_100364391 310
105 3300005841 Ga0068863_100120814 Ga0068863_1001208142 310
106 3300005842 Ga0068858_100040297 Ga0068858_1000402973 310
107 3300005842 Ga0068858_100207227 Ga0068858_1002072272 310
108 3300005843 Ga0068860_100137159 Ga0068860_1001371592 310
109 3300005843 Ga0068860_100508751 Ga0068860_1005087512 310
110 3300006237 Ga0097621_100030980 Ga0097621_1000309803 310
111 3300006844 Ga0075428_100117399 Ga0075428_1001173992 310
112 3300006846 Ga0075430_100003650 Ga0075430_1000036509 310
113 3300006846 Ga0075430_100003689 Ga0075430_1000036896 310
114 3300006847 Ga0075431_100003019 Ga0075431_1000030195 310
115 3300006847 Ga0075431_100046884 Ga0075431_1000468842 310
116 3300006880 Ga0075429_100002680 Ga0075429_10000268011 310
117 3300006881 Ga0068865_100007674 Ga0068865_1000076744 310
118 3300006931 Ga0097620_100072862 Ga0097620_1000728622 310
119 3300009147 Ga0114129_10038168 Ga0114129_100381683 310
120 3300009147 Ga0114129_10072695 Ga0114129_100726953 310
121 3300009147 Ga0114129_10194831 Ga0114129_101948312 310
122 3300009177 Ga0105248_10091188 Ga0105248_100911882 310
123 3300009551 Ga0105238_10018859 Ga0105238_100188594 310
124 3300013296 Ga0157374_10223336 Ga0157374_102233362 310
125 3300014325 Ga0163163_10033389 Ga0163163_100333892 310
126 3300014326 Ga0157380_10264041 Ga0157380_102640411 310
127 3300025893 Ga0207682_10018624 Ga0207682_100186242 310
128 3300025907 Ga0207645_10003966 Ga0207645_1000396610 310
129 3300025908 Ga0207643_10107846 Ga0207643_101078462 310
130 3300025908 Ga0207643_10221553 Ga0207643_102215532 310
131 3300025923 Ga0207681_10017320 Ga0207681_100173205 310
132 3300025923 Ga0207681_10051427 Ga0207681_100514272 310
133 3300025923 Ga0207681_10192416 Ga0207681_101924162 310
134 3300025924 Ga0207694_10292746 Ga0207694_102927462 310
135 3300025926 Ga0207659_10002191 Ga0207659_100021918 310
136 3300025926 Ga0207659_10008525 Ga0207659_100085256 310
137 3300025931 Ga0207644_10010406 Ga0207644_100104065 310
138 3300025931 Ga0207644_10017003 Ga0207644_100170032 310
139 3300025933 Ga0207706_10046163 Ga0207706_100461633 310
140 3300025933 Ga0207706_10237079 Ga0207706_102370792 310
141 3300025935 Ga0207709_10061302 Ga0207709_100613022 310
142 3300025936 Ga0207670_10091543 Ga0207670_100915432 310
143 3300025937 Ga0207669_10002901 Ga0207669_100029012 310
144 3300025938 Ga0207704_10057553 Ga0207704_100575532 310
145 3300025940 Ga0207691_10014827 Ga0207691_100148272 310
146 3300025940 Ga0207691_10026300 Ga0207691_100263002 310
147 3300025940 Ga0207691_10161636 Ga0207691_101616362 310
148 3300025942 Ga0207689_10001155 Ga0207689_100011557 310
149 3300025960 Ga0207651_10009181 Ga0207651_100091815 310
150 3300025960 Ga0207651_10196616 Ga0207651_101966162 310
151 3300025986 Ga0207658_10059932 Ga0207658_100599322 310
152 3300025986 Ga0207658_10082671 Ga0207658_100826712 310
153 3300026035 Ga0207703_10059466 Ga0207703_100594663 310
154 3300026035 Ga0207703_10136927 Ga0207703_101369272 310
155 3300026067 Ga0207678_10046877 Ga0207678_100468773 310
156 3300026089 Ga0207648_10001137 Ga0207648_100011378 310
157 3300026118 Ga0207675_100038801 Ga0207675_1000388012 310
158 3300028381 Ga0268264_10034357 Ga0268264_100343572 310
159 3300028381 Ga0268264_10300119 Ga0268264_103001191 310
160 3300050507 nmdc:mga05p37_49530_c1 nmdc:mga05p37_49530_c1_92_1033 310
161 3300050507 nmdc:mga05p37_58623_c1 nmdc:mga05p37_58623_c1_2562_3548 310
162 3300050508 nmdc:mga09592_3365_c1 nmdc:mga09592_3365_c1_7473_8459 310
163 3300050509 nmdc:mga0qj67_20815_c1 nmdc:mga0qj67_20815_c1_1962_2915 310
164 3300050510 nmdc:mga06r32_129355_c1 nmdc:mga06r32_129355_c1_867_1811 310
165 3300050510 nmdc:mga06r32_468360_c1 nmdc:mga06r32_468360_c1_160_1101 310
166 3300053084 Ga0495595_0103341 Ga0495595_0103341_207_1151 310
167 3300005290 Ga0065712_10070697 Ga0065712_100706973 311
168 3300005329 Ga0070683_100013210 Ga0070683_1000132102 311
169 3300005331 Ga0070670_100001174 Ga0070670_10000117414 311
170 3300005344 Ga0070661_100029230 Ga0070661_1000292303 311
171 3300005347 Ga0070668_100159356 Ga0070668_1001593563 311
172 3300005355 Ga0070671_100018452 Ga0070671_1000184522 311
173 3300005367 Ga0070667_100327231 Ga0070667_1003272312 311
174 3300005455 Ga0070663_100018918 Ga0070663_1000189182 311
175 3300005457 Ga0070662_100131774 Ga0070662_1001317742 311
176 3300005466 Ga0070685_10074228 Ga0070685_100742282 311
177 3300005535 Ga0070684_100000941 Ga0070684_1000009419 311
178 3300005543 Ga0070672_100046579 Ga0070672_1000465792 311
179 3300005547 Ga0070693_100004577 Ga0070693_1000045774 311
180 3300005564 Ga0070664_100002693 Ga0070664_10000269310 311
181 3300006173 Ga0070716_100027702 Ga0070716_1000277022 311
182 3300006852 Ga0075433_10179934 Ga0075433_101799342 311
183 3300006871 Ga0075434_100013121 Ga0075434_1000131214 311
184 3300006881 Ga0068865_100227793 Ga0068865_1002277932 311
185 3300009177 Ga0105248_10046686 Ga0105248_100466864 311
186 3300013296 Ga0157374_10026540 Ga0157374_100265403 311
187 3300014968 Ga0157379_10052759 Ga0157379_100527591 311
188 3300025906 Ga0207699_10131265 Ga0207699_101312652 311
189 3300025915 Ga0207693_10321406 Ga0207693_103214061 311
190 3300025920 Ga0207649_10027415 Ga0207649_100274152 311
191 3300025925 Ga0207650_10099653 Ga0207650_100996532 311
192 3300025933 Ga0207706_10113614 Ga0207706_101136142 311
193 3300025938 Ga0207704_10055899 Ga0207704_100558992 311
194 3300025938 Ga0207704_10101290 Ga0207704_101012901 311
195 3300025939 Ga0207665_10082615 Ga0207665_100826152 311
196 3300025941 Ga0207711_10166849 Ga0207711_101668492 311
197 3300025944 Ga0207661_10005267 Ga0207661_100052673 311
198 3300025945 Ga0207679_10007680 Ga0207679_100076805 311
199 3300025986 Ga0207658_10172099 Ga0207658_101720992 311
200 3300026067 Ga0207678_10012858 Ga0207678_100128584 311
201 3300035089 Ga0373944_0052193 Ga0373944_0052193_280_1215 311
202 3300035725 Ga0373947_0047378 Ga0373947_0047378_966_1901 311
203 3300048907 Ga0496104_0019148 Ga0496104_0019148_1539_2474 311
204 3300048908 Ga0496105_0031951 Ga0496105_0031951_2170_3105 311
205 3300048909 Ga0496106_0054730 Ga0496106_0054730_1800_2741 311
206 3300048912 Ga0496109_0052839 Ga0496109_0052839_840_1775 311
207 3300048913 Ga0496110_0004522 Ga0496110_0004522_5408_6343 311
208 3300048914 Ga0496111_0001625 Ga0496111_0001625_6269_7204 311
209 3300048917 Ga0496114_0070209 Ga0496114_0070209_333_1274 311
210 3300050512 nmdc:mga0n895_55551_c1 nmdc:mga0n895_55551_c1_1891_2826 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

9

168

0.84

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

5

235

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7531 1 219
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7496 1 219
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7439 1 220
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7403 1 220
3bcv-assembly1.cif.gz_B crystal structure of a putative glycosyltransferase from bacteroides fragilis 0.7356 1 211
ID Description Score Start End Superfamily
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.827 1 224 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8145 3 222 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8089 3 222 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7989 1 224 3.90.550.10
af_A9C3Q0_26_206_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.771 3 106 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F2REV6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9577 1 311
AF-A0A1F2REV6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9517 1 311
AF-A0A522A668-F1-model_v4 Glycosyltransferase family 2 protein 0.9493 5 311 GO:0016740
GO:0044010
GO:0045226
AF-A0A2D6A245-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9424 5 306
AF-A0A522A668-F1-model_v4 Glycosyltransferase family 2 protein 0.9345 5 311 GO:0016740
GO:0044010
GO:0045226

Feature Viewer

pLDDT pTM Quality
94.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map