F320491
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 210 | 123 | 210 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10020012|Ga0207428_100200124 |
| Length | 336 |
| Sequence | LTEGPHRVSLVLPTKNGAATLPAVLEAVWRQRASFGLETIAIDSGSTDGTLDLLRGKVTHLISIPPHTYDHGLTRNLGIMQATGELVVLLVQDAVPASEHWLEALTTPLFADPELAGTFARQQPAPNASAIARHYLSKWVASKDSAWTRSLNGPAELDDLLPLQRMEFCAFDNVCSCIRRSVWTEHPFHSSPIAEDLQWAREVLLAGHKLAFVPEAVVVHSHDRSPWYELFRTHALHKRLSELFGIETIPTPQLLARAIASSLVTNLWCERAAPAQWPRAAALSVVWPLAQYLGARDARAKGTGQRAEGRVKGEKEKEVTLPEPDLYDRPGTILKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 99 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 100 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 106 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 107 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 108 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 109 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 111 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 112 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 113 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 96.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10070697 | 3300005290 | Bacteria | 5775 |
| 2 | Ga0070676_10019085 | 3300005328 | Bacteria | 3810 |
| 3 | Ga0070683_100013210 | 3300005329 | Bacteria | 7193 |
| 4 | Ga0070670_100001174 | 3300005331 | Bacteria | 20803 |
| 5 | Ga0070677_10019248 | 3300005333 | Bacteria | 2470 |
| 6 | Ga0070689_100240141 | 3300005340 | Bacteria | 1492 |
| 7 | Ga0070661_100029230 | 3300005344 | Unclassified | 3977 |
| 8 | Ga0070668_100159356 | 3300005347 | Bacteria | 1830 |
| 9 | Ga0070669_100026329 | 3300005353 | Bacteria | 4184 |
| 10 | Ga0070675_100003488 | 3300005354 | Bacteria | 11927 |
| 11 | Ga0070675_100083640 | 3300005354 | Bacteria | 2664 |
| 12 | Ga0070671_100018452 | 3300005355 | Bacteria | 5667 |
| 13 | Ga0070671_100090684 | 3300005355 | Bacteria | 2559 |
| 14 | Ga0070674_100021562 | 3300005356 | Bacteria | 4140 |
| 15 | Ga0070673_100011620 | 3300005364 | Bacteria | 6014 |
| 16 | Ga0070673_100024091 | 3300005364 | Bacteria | 4456 |
| 17 | Ga0070673_100038963 | 3300005364 | Unclassified | 3634 |
| 18 | Ga0070673_100347977 | 3300005364 | Unclassified | 1315 |
| 19 | Ga0070667_100191213 | 3300005367 | Bacteria | 1813 |
| 20 | Ga0070667_100327231 | 3300005367 | Bacteria | 1384 |
| 21 | Ga0070709_10000005 | 3300005434 | Bacteria | 197619 |
| 22 | Ga0070701_10007187 | 3300005438 | Bacteria | 4740 |
| 23 | Ga0070705_100116224 | 3300005440 | Unclassified | 1719 |
| 24 | Ga0070694_100242409 | 3300005444 | Bacteria | 1360 |
| 25 | Ga0070663_100018918 | 3300005455 | Unclassified | 4527 |
| 26 | Ga0070663_100029527 | 3300005455 | Unclassified | 3748 |
| 27 | Ga0070662_100131774 | 3300005457 | Unclassified | 1928 |
| 28 | Ga0070662_100231892 | 3300005457 | Bacteria | 1477 |
| 29 | Ga0070681_10321481 | 3300005458 | Bacteria | 1457 |
| 30 | Ga0068867_100000708 | 3300005459 | Bacteria | 22219 |
| 31 | Ga0070685_10074228 | 3300005466 | Bacteria | 2023 |
| 32 | Ga0070679_100299313 | 3300005530 | Bacteria | 1559 |
| 33 | Ga0070684_100000941 | 3300005535 | Bacteria | 20724 |
| 34 | Ga0070672_100037038 | 3300005543 | Bacteria | 3720 |
| 35 | Ga0070672_100046579 | 3300005543 | Bacteria | 3360 |
| 36 | Ga0070672_100062089 | 3300005543 | Bacteria | 2948 |
| 37 | Ga0070672_100152705 | 3300005543 | Bacteria | 1911 |
| 38 | Ga0070686_100134656 | 3300005544 | Bacteria | 1713 |
| 39 | Ga0070693_100004577 | 3300005547 | Bacteria | 6561 |
| 40 | Ga0070704_100067617 | 3300005549 | Unclassified | 2581 |
| 41 | Ga0070664_100002693 | 3300005564 | Bacteria | 14333 |
| 42 | Ga0068859_100072865 | 3300005617 | Bacteria | 3472 |
| 43 | Ga0068859_100324736 | 3300005617 | Bacteria | 1633 |
| 44 | Ga0068861_100036879 | 3300005719 | Bacteria | 3632 |
| 45 | Ga0068861_100300348 | 3300005719 | Unclassified | 1390 |
| 46 | Ga0068851_10061297 | 3300005834 | Bacteria | 1928 |
| 47 | Ga0068870_10036439 | 3300005840 | Bacteria | 2531 |
| 48 | Ga0068863_100120814 | 3300005841 | Bacteria | 2498 |
| 49 | Ga0068858_100040297 | 3300005842 | Bacteria | 4331 |
| 50 | Ga0068858_100119106 | 3300005842 | Bacteria | 2468 |
| 51 | Ga0068858_100207227 | 3300005842 | Bacteria | 1855 |
| 52 | Ga0068860_100137159 | 3300005843 | Bacteria | 2350 |
| 53 | Ga0068860_100508751 | 3300005843 | Bacteria | 1203 |
| 54 | Ga0068862_100146636 | 3300005844 | Bacteria | 2098 |
| 55 | Ga0070716_100027702 | 3300006173 | Unclassified | 3047 |
| 56 | Ga0097621_100030980 | 3300006237 | Bacteria | 4240 |
| 57 | Ga0097621_100285660 | 3300006237 | Bacteria | 1453 |
| 58 | Ga0068871_100008084 | 3300006358 | Bacteria | 7553 |
| 59 | Ga0075428_100000078 | 3300006844 | Bacteria | 80448 |
| 60 | Ga0075428_100117399 | 3300006844 | Bacteria | 2899 |
| 61 | Ga0075428_100191987 | 3300006844 | Bacteria | 2209 |
| 62 | Ga0075430_100003650 | 3300006846 | Bacteria | 12920 |
| 63 | Ga0075430_100003689 | 3300006846 | Bacteria | 12862 |
| 64 | Ga0075430_100040658 | 3300006846 | Unclassified | 3935 |
| 65 | Ga0075431_100003019 | 3300006847 | Bacteria | 16283 |
| 66 | Ga0075431_100041614 | 3300006847 | Bacteria | 4738 |
| 67 | Ga0075431_100046884 | 3300006847 | Unclassified | 4456 |
| 68 | Ga0075433_10103611 | 3300006852 | Unclassified | 2520 |
| 69 | Ga0075433_10117413 | 3300006852 | Unclassified | 2361 |
| 70 | Ga0075433_10179934 | 3300006852 | Bacteria | 1881 |
| 71 | Ga0075434_100013121 | 3300006871 | Bacteria | 7870 |
| 72 | Ga0075434_100130417 | 3300006871 | Unclassified | 2532 |
| 73 | Ga0075429_100002680 | 3300006880 | Bacteria | 14985 |
| 74 | Ga0075429_100099138 | 3300006880 | Bacteria | 2542 |
| 75 | Ga0068865_100007674 | 3300006881 | Bacteria | 6645 |
| 76 | Ga0068865_100226248 | 3300006881 | Bacteria | 1465 |
| 77 | Ga0068865_100227793 | 3300006881 | Bacteria | 1460 |
| 78 | Ga0075436_100054024 | 3300006914 | Bacteria | 2772 |
| 79 | Ga0097620_100072862 | 3300006931 | Bacteria | 3472 |
| 80 | Ga0097620_100324756 | 3300006931 | Bacteria | 1633 |
| 81 | Ga0075435_100089519 | 3300007076 | Bacteria | 2538 |
| 82 | Ga0111539_10010736 | 3300009094 | Bacteria | 11525 |
| 83 | Ga0111539_10013731 | 3300009094 | Bacteria | 10118 |
| 84 | Ga0111539_10045352 | 3300009094 | Bacteria | 5263 |
| 85 | Ga0111539_10072412 | 3300009094 | Bacteria | 4064 |
| 86 | Ga0111539_10073111 | 3300009094 | Bacteria | 4042 |
| 87 | Ga0111539_10285552 | 3300009094 | Bacteria | 1920 |
| 88 | Ga0105247_10204649 | 3300009101 | Unclassified | 1328 |
| 89 | Ga0114129_10000323 | 3300009147 | Bacteria | 56097 |
| 90 | Ga0114129_10009555 | 3300009147 | Bacteria | 13830 |
| 91 | Ga0114129_10038168 | 3300009147 | Bacteria | 6778 |
| 92 | Ga0114129_10072695 | 3300009147 | Bacteria | 4794 |
| 93 | Ga0114129_10089253 | 3300009147 | Unclassified | 4273 |
| 94 | Ga0114129_10118356 | 3300009147 | Bacteria | 3649 |
| 95 | Ga0114129_10160660 | 3300009147 | Unclassified | 3069 |
| 96 | Ga0114129_10194831 | 3300009147 | Unclassified | 2749 |
| 97 | Ga0114129_10471406 | 3300009147 | Bacteria | 1644 |
| 98 | Ga0105242_10685930 | 3300009176 | Unclassified | 1000 |
| 99 | Ga0105248_10046686 | 3300009177 | Unclassified | 4855 |
| 100 | Ga0105248_10091188 | 3300009177 | Unclassified | 3432 |
| 101 | Ga0105248_10187431 | 3300009177 | Unclassified | 2331 |
| 102 | Ga0105248_10236122 | 3300009177 | Unclassified | 2058 |
| 103 | Ga0105238_10018859 | 3300009551 | Bacteria | 7023 |
| 104 | Ga0105249_10272843 | 3300009553 | Bacteria | 1686 |
| 105 | Ga0157374_10026540 | 3300013296 | Bacteria | 5212 |
| 106 | Ga0157374_10223336 | 3300013296 | Bacteria | 1849 |
| 107 | Ga0163163_10033389 | 3300014325 | Bacteria | 4977 |
| 108 | Ga0163163_10352871 | 3300014325 | Bacteria | 1527 |
| 109 | Ga0157380_10046981 | 3300014326 | Unclassified | 3393 |
| 110 | Ga0157380_10076691 | 3300014326 | Unclassified | 2721 |
| 111 | Ga0157380_10088214 | 3300014326 | Bacteria | 2552 |
| 112 | Ga0157380_10162799 | 3300014326 | Bacteria | 1941 |
| 113 | Ga0157380_10264041 | 3300014326 | Bacteria | 1565 |
| 114 | Ga0157379_10052759 | 3300014968 | Unclassified | 3631 |
| 115 | Ga0207682_10018624 | 3300025893 | Bacteria | 2715 |
| 116 | Ga0207699_10000015 | 3300025906 | Bacteria | 251707 |
| 117 | Ga0207699_10131265 | 3300025906 | Unclassified | 1634 |
| 118 | Ga0207645_10003966 | 3300025907 | Bacteria | 11045 |
| 119 | Ga0207643_10107846 | 3300025908 | Bacteria | 1638 |
| 120 | Ga0207643_10221553 | 3300025908 | Bacteria | 1158 |
| 121 | Ga0207693_10321406 | 3300025915 | Bacteria | 1211 |
| 122 | Ga0207649_10027415 | 3300025920 | Unclassified | 3342 |
| 123 | Ga0207681_10017320 | 3300025923 | Bacteria | 4523 |
| 124 | Ga0207681_10051427 | 3300025923 | Bacteria | 2792 |
| 125 | Ga0207681_10192416 | 3300025923 | Bacteria | 1561 |
| 126 | Ga0207694_10292746 | 3300025924 | Bacteria | 1339 |
| 127 | Ga0207650_10099653 | 3300025925 | Unclassified | 2234 |
| 128 | Ga0207659_10002191 | 3300025926 | Bacteria | 11611 |
| 129 | Ga0207659_10008525 | 3300025926 | Bacteria | 6372 |
| 130 | Ga0207644_10010406 | 3300025931 | Bacteria | 6129 |
| 131 | Ga0207644_10017003 | 3300025931 | Bacteria | 4903 |
| 132 | Ga0207706_10046163 | 3300025933 | Bacteria | 3857 |
| 133 | Ga0207706_10113614 | 3300025933 | Unclassified | 2382 |
| 134 | Ga0207706_10237079 | 3300025933 | Bacteria | 1595 |
| 135 | Ga0207709_10061302 | 3300025935 | Bacteria | 2350 |
| 136 | Ga0207670_10038460 | 3300025936 | Unclassified | 3125 |
| 137 | Ga0207670_10091543 | 3300025936 | Bacteria | 2151 |
| 138 | Ga0207670_10239466 | 3300025936 | Bacteria | 1397 |
| 139 | Ga0207669_10002901 | 3300025937 | Bacteria | 7359 |
| 140 | Ga0207704_10055899 | 3300025938 | Unclassified | 2414 |
| 141 | Ga0207704_10057553 | 3300025938 | Bacteria | 2389 |
| 142 | Ga0207704_10101290 | 3300025938 | Bacteria | 1921 |
| 143 | Ga0207704_10232100 | 3300025938 | Bacteria | 1373 |
| 144 | Ga0207665_10043185 | 3300025939 | Bacteria | 3014 |
| 145 | Ga0207665_10082615 | 3300025939 | Unclassified | 2214 |
| 146 | Ga0207691_10014827 | 3300025940 | Bacteria | 7427 |
| 147 | Ga0207691_10026300 | 3300025940 | Bacteria | 5462 |
| 148 | Ga0207691_10161636 | 3300025940 | Bacteria | 1964 |
| 149 | Ga0207691_10192992 | 3300025940 | Bacteria | 1776 |
| 150 | Ga0207711_10166849 | 3300025941 | Unclassified | 1996 |
| 151 | Ga0207689_10001155 | 3300025942 | Bacteria | 25406 |
| 152 | Ga0207661_10005267 | 3300025944 | Bacteria | 9102 |
| 153 | Ga0207679_10007680 | 3300025945 | Bacteria | 6850 |
| 154 | Ga0207651_10009181 | 3300025960 | Bacteria | 5391 |
| 155 | Ga0207651_10196616 | 3300025960 | Bacteria | 1612 |
| 156 | Ga0207658_10059932 | 3300025986 | Bacteria | 2838 |
| 157 | Ga0207658_10082671 | 3300025986 | Bacteria | 2467 |
| 158 | Ga0207658_10172099 | 3300025986 | Unclassified | 1785 |
| 159 | Ga0207703_10059466 | 3300026035 | Bacteria | 3121 |
| 160 | Ga0207703_10136927 | 3300026035 | Bacteria | 2121 |
| 161 | Ga0207678_10012858 | 3300026067 | Bacteria | 7348 |
| 162 | Ga0207678_10046877 | 3300026067 | Unclassified | 3738 |
| 163 | Ga0207702_10347104 | 3300026078 | Unclassified | 1419 |
| 164 | Ga0207648_10001137 | 3300026089 | Bacteria | 29904 |
| 165 | Ga0207675_100038801 | 3300026118 | Bacteria | 4445 |
| 166 | Ga0207675_100232888 | 3300026118 | Bacteria | 1777 |
| 167 | Ga0207428_10020012 | 3300027907 | Bacteria | 5699 |
| 168 | Ga0207428_10034075 | 3300027907 | Bacteria | 4176 |
| 169 | Ga0207428_10044155 | 3300027907 | Bacteria | 3596 |
| 170 | Ga0268265_10545766 | 3300028380 | Bacteria | 1100 |
| 171 | Ga0268264_10034357 | 3300028381 | Bacteria | 4170 |
| 172 | Ga0268264_10300119 | 3300028381 | Bacteria | 1512 |
| 173 | Ga0373944_0052193 | 3300035089 | Bacteria | 1291 |
| 174 | Ga0373947_0047378 | 3300035725 | Bacteria | 2576 |
| 175 | Ga0373937_0489262 | 3300036401 | Bacteria | 1169 |
| 176 | Ga0451577_0003991 | 3300042876 | Bacteria | 15889 |
| 177 | Ga0453684_0000428 | 3300044712 | Bacteria | 171577 |
| 178 | Ga0451576_0361208 | 3300045051 | Unclassified | 1521 |
| 179 | Ga0451576_0490608 | 3300045051 | Bacteria | 1290 |
| 180 | Ga0466967_0509995 | 3300045976 | Bacteria | 1181 |
| 181 | Ga0495639_0009452 | 3300046475 | Bacteria | 4181 |
| 182 | Ga0495586_0242330 | 3300046535 | Unclassified | 1028 |
| 183 | Ga0495599_0097385 | 3300046678 | Bacteria | 1834 |
| 184 | Ga0496104_0019148 | 3300048907 | Bacteria | 6257 |
| 185 | Ga0496105_0031951 | 3300048908 | Unclassified | 4317 |
| 186 | Ga0496106_0054730 | 3300048909 | Unclassified | 3015 |
| 187 | Ga0496108_0399706 | 3300048911 | Unclassified | 1200 |
| 188 | Ga0496109_0052839 | 3300048912 | Unclassified | 3704 |
| 189 | Ga0496110_0004522 | 3300048913 | Bacteria | 10790 |
| 190 | Ga0496111_0001625 | 3300048914 | Bacteria | 13018 |
| 191 | Ga0496114_0070209 | 3300048917 | Unclassified | 2942 |
| 192 | nmdc:mga05p37_1_c1 | 3300050507 | Bacteria | 177088 |
| 193 | nmdc:mga05p37_49530_c1 | 3300050507 | Bacteria | 5167 |
| 194 | nmdc:mga05p37_58623_c1 | 3300050507 | Bacteria | 4742 |
| 195 | nmdc:mga09592_3365_c1 | 3300050508 | Bacteria | 12924 |
| 196 | nmdc:mga0qj67_20815_c1 | 3300050509 | Bacteria | 5024 |
| 197 | nmdc:mga0qj67_241165_c1 | 3300050509 | Bacteria | 1467 |
| 198 | nmdc:mga06r32_129355_c1 | 3300050510 | Unclassified | 2495 |
| 199 | nmdc:mga06r32_418467_c1 | 3300050510 | Unclassified | 1321 |
| 200 | nmdc:mga06r32_468360_c1 | 3300050510 | Bacteria | 1239 |
| 201 | nmdc:mga08y16_22025_c1 | 3300050511 | Bacteria | 6729 |
| 202 | nmdc:mga08y16_29778_c1 | 3300050511 | Bacteria | 5748 |
| 203 | nmdc:mga08y16_5621_c1 | 3300050511 | Bacteria | 13132 |
| 204 | nmdc:mga0n895_55551_c1 | 3300050512 | Bacteria | 3897 |
| 205 | nmdc:mga08x19_5131_c1 | 3300050514 | Bacteria | 7746 |
| 206 | nmdc:mga0a205_135162_c1 | 3300050515 | Bacteria | 2366 |
| 207 | nmdc:mga0a205_367482_c1 | 3300050515 | Bacteria | 1305 |
| 208 | Ga0495595_0103341 | 3300053084 | Bacteria | 1377 |
| 209 | Ga0501084_0179161 | 3300054114 | Unclassified | 1789 |
| 210 | Ga0530510_0293496 | 3300061734 | Bacteria | 1216 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10236122 | Ga0105248_102361222 | 267 |
| 2 | 3300054114 | Ga0501084_0179161 | Ga0501084_0179161_935_1762 | 269 |
| 3 | 3300048911 | Ga0496108_0399706 | Ga0496108_0399706_356_1189 | 276 |
| 4 | 3300009094 | Ga0111539_10285552 | Ga0111539_102855522 | 282 |
| 5 | 3300006914 | Ga0075436_100054024 | Ga0075436_1000540242 | 289 |
| 6 | 3300050514 | nmdc:mga08x19_5131_c1 | nmdc:mga08x19_5131_c1_1903_2775 | 289 |
| 7 | 3300050509 | nmdc:mga0qj67_241165_c1 | nmdc:mga0qj67_241165_c1_576_1451 | 290 |
| 8 | 3300009147 | Ga0114129_10160660 | Ga0114129_101606603 | 291 |
| 9 | 3300007076 | Ga0075435_100089519 | Ga0075435_1000895192 | 293 |
| 10 | 3300046678 | Ga0495599_0097385 | Ga0495599_0097385_578_1516 | 294 |
| 11 | 3300009176 | Ga0105242_10685930 | Ga0105242_106859301 | 295 |
| 12 | 3300014326 | Ga0157380_10046981 | Ga0157380_100469812 | 296 |
| 13 | 3300046535 | Ga0495586_0242330 | Ga0495586_0242330_34_975 | 296 |
| 14 | 3300061734 | Ga0530510_0293496 | Ga0530510_0293496_167_1066 | 296 |
| 15 | 3300005364 | Ga0070673_100038963 | Ga0070673_1000389632 | 297 |
| 16 | 3300006871 | Ga0075434_100130417 | Ga0075434_1001304172 | 299 |
| 17 | 3300009094 | Ga0111539_10013731 | Ga0111539_100137316 | 299 |
| 18 | 3300009147 | Ga0114129_10000323 | Ga0114129_1000032336 | 300 |
| 19 | 3300050507 | nmdc:mga05p37_1_c1 | nmdc:mga05p37_1_c1_161210_162190 | 300 |
| 20 | 3300050511 | nmdc:mga08y16_22025_c1 | nmdc:mga08y16_22025_c1_2739_3719 | 300 |
| 21 | 3300050515 | nmdc:mga0a205_135162_c1 | nmdc:mga0a205_135162_c1_882_1862 | 300 |
| 22 | 3300009177 | Ga0105248_10187431 | Ga0105248_101874312 | 301 |
| 23 | 3300005340 | Ga0070689_100240141 | Ga0070689_1002401412 | 302 |
| 24 | 3300005434 | Ga0070709_10000005 | Ga0070709_1000000514 | 302 |
| 25 | 3300005440 | Ga0070705_100116224 | Ga0070705_1001162242 | 302 |
| 26 | 3300005444 | Ga0070694_100242409 | Ga0070694_1002424091 | 302 |
| 27 | 3300006358 | Ga0068871_100008084 | Ga0068871_1000080847 | 302 |
| 28 | 3300006844 | Ga0075428_100000078 | Ga0075428_10000007823 | 302 |
| 29 | 3300006844 | Ga0075428_100191987 | Ga0075428_1001919872 | 302 |
| 30 | 3300006846 | Ga0075430_100040658 | Ga0075430_1000406582 | 302 |
| 31 | 3300006880 | Ga0075429_100099138 | Ga0075429_1000991382 | 302 |
| 32 | 3300009094 | Ga0111539_10073111 | Ga0111539_100731113 | 302 |
| 33 | 3300009147 | Ga0114129_10089253 | Ga0114129_100892532 | 302 |
| 34 | 3300009147 | Ga0114129_10118356 | Ga0114129_101183562 | 302 |
| 35 | 3300009147 | Ga0114129_10471406 | Ga0114129_104714062 | 302 |
| 36 | 3300025906 | Ga0207699_10000015 | Ga0207699_10000015138 | 302 |
| 37 | 3300025936 | Ga0207670_10239466 | Ga0207670_102394662 | 302 |
| 38 | 3300025939 | Ga0207665_10043185 | Ga0207665_100431852 | 302 |
| 39 | 3300027907 | Ga0207428_10034075 | Ga0207428_100340752 | 302 |
| 40 | 3300027907 | Ga0207428_10044155 | Ga0207428_100441552 | 302 |
| 41 | 3300045051 | Ga0451576_0361208 | Ga0451576_0361208_557_1468 | 302 |
| 42 | 3300045051 | Ga0451576_0490608 | Ga0451576_0490608_295_1260 | 302 |
| 43 | 3300046475 | Ga0495639_0009452 | Ga0495639_0009452_1909_2820 | 302 |
| 44 | 3300050510 | nmdc:mga06r32_418467_c1 | nmdc:mga06r32_418467_c1_121_1050 | 302 |
| 45 | 3300050511 | nmdc:mga08y16_5621_c1 | nmdc:mga08y16_5621_c1_11946_12911 | 302 |
| 46 | 3300005617 | Ga0068859_100324736 | Ga0068859_1003247362 | 303 |
| 47 | 3300006847 | Ga0075431_100041614 | Ga0075431_1000416141 | 303 |
| 48 | 3300006852 | Ga0075433_10103611 | Ga0075433_101036112 | 303 |
| 49 | 3300006881 | Ga0068865_100226248 | Ga0068865_1002262482 | 303 |
| 50 | 3300006931 | Ga0097620_100324756 | Ga0097620_1003247562 | 303 |
| 51 | 3300009147 | Ga0114129_10009555 | Ga0114129_100095554 | 303 |
| 52 | 3300025938 | Ga0207704_10232100 | Ga0207704_102321002 | 303 |
| 53 | 3300050515 | nmdc:mga0a205_367482_c1 | nmdc:mga0a205_367482_c1_93_1010 | 303 |
| 54 | 3300042876 | Ga0451577_0003991 | Ga0451577_0003991_3140_4072 | 304 |
| 55 | 3300044712 | Ga0453684_0000428 | Ga0453684_0000428_109770_110702 | 304 |
| 56 | 3300036401 | Ga0373937_0489262 | Ga0373937_0489262_56_976 | 305 |
| 57 | 3300005844 | Ga0068862_100146636 | Ga0068862_1001466362 | 307 |
| 58 | 3300006237 | Ga0097621_100285660 | Ga0097621_1002856602 | 307 |
| 59 | 3300006852 | Ga0075433_10117413 | Ga0075433_101174132 | 307 |
| 60 | 3300009094 | Ga0111539_10010736 | Ga0111539_100107365 | 307 |
| 61 | 3300009094 | Ga0111539_10045352 | Ga0111539_100453523 | 307 |
| 62 | 3300009094 | Ga0111539_10072412 | Ga0111539_100724123 | 307 |
| 63 | 3300009553 | Ga0105249_10272843 | Ga0105249_102728432 | 307 |
| 64 | 3300014326 | Ga0157380_10088214 | Ga0157380_100882142 | 307 |
| 65 | 3300025936 | Ga0207670_10038460 | Ga0207670_100384602 | 307 |
| 66 | 3300025940 | Ga0207691_10192992 | Ga0207691_101929922 | 307 |
| 67 | 3300026118 | Ga0207675_100232888 | Ga0207675_1002328882 | 307 |
| 68 | 3300027907 | Ga0207428_10020012 | Ga0207428_100200124 | 307 |
| 69 | 3300028380 | Ga0268265_10545766 | Ga0268265_105457662 | 307 |
| 70 | 3300050511 | nmdc:mga08y16_29778_c1 | nmdc:mga08y16_29778_c1_4754_5680 | 307 |
| 71 | 3300005458 | Ga0070681_10321481 | Ga0070681_103214811 | 309 |
| 72 | 3300005530 | Ga0070679_100299313 | Ga0070679_1002993131 | 309 |
| 73 | 3300005719 | Ga0068861_100300348 | Ga0068861_1003003481 | 309 |
| 74 | 3300005842 | Ga0068858_100119106 | Ga0068858_1001191062 | 309 |
| 75 | 3300009101 | Ga0105247_10204649 | Ga0105247_102046492 | 309 |
| 76 | 3300014325 | Ga0163163_10352871 | Ga0163163_103528712 | 309 |
| 77 | 3300014326 | Ga0157380_10076691 | Ga0157380_100766912 | 309 |
| 78 | 3300014326 | Ga0157380_10162799 | Ga0157380_101627992 | 309 |
| 79 | 3300026078 | Ga0207702_10347104 | Ga0207702_103471041 | 309 |
| 80 | 3300045976 | Ga0466967_0509995 | Ga0466967_0509995_22_954 | 309 |
| 81 | 3300005328 | Ga0070676_10019085 | Ga0070676_100190853 | 310 |
| 82 | 3300005333 | Ga0070677_10019248 | Ga0070677_100192481 | 310 |
| 83 | 3300005353 | Ga0070669_100026329 | Ga0070669_1000263291 | 310 |
| 84 | 3300005354 | Ga0070675_100003488 | Ga0070675_1000034884 | 310 |
| 85 | 3300005354 | Ga0070675_100083640 | Ga0070675_1000836401 | 310 |
| 86 | 3300005355 | Ga0070671_100090684 | Ga0070671_1000906842 | 310 |
| 87 | 3300005356 | Ga0070674_100021562 | Ga0070674_1000215624 | 310 |
| 88 | 3300005364 | Ga0070673_100011620 | Ga0070673_1000116202 | 310 |
| 89 | 3300005364 | Ga0070673_100024091 | Ga0070673_1000240912 | 310 |
| 90 | 3300005364 | Ga0070673_100347977 | Ga0070673_1003479771 | 310 |
| 91 | 3300005367 | Ga0070667_100191213 | Ga0070667_1001912132 | 310 |
| 92 | 3300005438 | Ga0070701_10007187 | Ga0070701_100071872 | 310 |
| 93 | 3300005455 | Ga0070663_100029527 | Ga0070663_1000295272 | 310 |
| 94 | 3300005457 | Ga0070662_100231892 | Ga0070662_1002318921 | 310 |
| 95 | 3300005459 | Ga0068867_100000708 | Ga0068867_1000007084 | 310 |
| 96 | 3300005543 | Ga0070672_100037038 | Ga0070672_1000370382 | 310 |
| 97 | 3300005543 | Ga0070672_100062089 | Ga0070672_1000620893 | 310 |
| 98 | 3300005543 | Ga0070672_100152705 | Ga0070672_1001527052 | 310 |
| 99 | 3300005544 | Ga0070686_100134656 | Ga0070686_1001346562 | 310 |
| 100 | 3300005549 | Ga0070704_100067617 | Ga0070704_1000676172 | 310 |
| 101 | 3300005617 | Ga0068859_100072865 | Ga0068859_1000728652 | 310 |
| 102 | 3300005719 | Ga0068861_100036879 | Ga0068861_1000368792 | 310 |
| 103 | 3300005834 | Ga0068851_10061297 | Ga0068851_100612972 | 310 |
| 104 | 3300005840 | Ga0068870_10036439 | Ga0068870_100364391 | 310 |
| 105 | 3300005841 | Ga0068863_100120814 | Ga0068863_1001208142 | 310 |
| 106 | 3300005842 | Ga0068858_100040297 | Ga0068858_1000402973 | 310 |
| 107 | 3300005842 | Ga0068858_100207227 | Ga0068858_1002072272 | 310 |
| 108 | 3300005843 | Ga0068860_100137159 | Ga0068860_1001371592 | 310 |
| 109 | 3300005843 | Ga0068860_100508751 | Ga0068860_1005087512 | 310 |
| 110 | 3300006237 | Ga0097621_100030980 | Ga0097621_1000309803 | 310 |
| 111 | 3300006844 | Ga0075428_100117399 | Ga0075428_1001173992 | 310 |
| 112 | 3300006846 | Ga0075430_100003650 | Ga0075430_1000036509 | 310 |
| 113 | 3300006846 | Ga0075430_100003689 | Ga0075430_1000036896 | 310 |
| 114 | 3300006847 | Ga0075431_100003019 | Ga0075431_1000030195 | 310 |
| 115 | 3300006847 | Ga0075431_100046884 | Ga0075431_1000468842 | 310 |
| 116 | 3300006880 | Ga0075429_100002680 | Ga0075429_10000268011 | 310 |
| 117 | 3300006881 | Ga0068865_100007674 | Ga0068865_1000076744 | 310 |
| 118 | 3300006931 | Ga0097620_100072862 | Ga0097620_1000728622 | 310 |
| 119 | 3300009147 | Ga0114129_10038168 | Ga0114129_100381683 | 310 |
| 120 | 3300009147 | Ga0114129_10072695 | Ga0114129_100726953 | 310 |
| 121 | 3300009147 | Ga0114129_10194831 | Ga0114129_101948312 | 310 |
| 122 | 3300009177 | Ga0105248_10091188 | Ga0105248_100911882 | 310 |
| 123 | 3300009551 | Ga0105238_10018859 | Ga0105238_100188594 | 310 |
| 124 | 3300013296 | Ga0157374_10223336 | Ga0157374_102233362 | 310 |
| 125 | 3300014325 | Ga0163163_10033389 | Ga0163163_100333892 | 310 |
| 126 | 3300014326 | Ga0157380_10264041 | Ga0157380_102640411 | 310 |
| 127 | 3300025893 | Ga0207682_10018624 | Ga0207682_100186242 | 310 |
| 128 | 3300025907 | Ga0207645_10003966 | Ga0207645_1000396610 | 310 |
| 129 | 3300025908 | Ga0207643_10107846 | Ga0207643_101078462 | 310 |
| 130 | 3300025908 | Ga0207643_10221553 | Ga0207643_102215532 | 310 |
| 131 | 3300025923 | Ga0207681_10017320 | Ga0207681_100173205 | 310 |
| 132 | 3300025923 | Ga0207681_10051427 | Ga0207681_100514272 | 310 |
| 133 | 3300025923 | Ga0207681_10192416 | Ga0207681_101924162 | 310 |
| 134 | 3300025924 | Ga0207694_10292746 | Ga0207694_102927462 | 310 |
| 135 | 3300025926 | Ga0207659_10002191 | Ga0207659_100021918 | 310 |
| 136 | 3300025926 | Ga0207659_10008525 | Ga0207659_100085256 | 310 |
| 137 | 3300025931 | Ga0207644_10010406 | Ga0207644_100104065 | 310 |
| 138 | 3300025931 | Ga0207644_10017003 | Ga0207644_100170032 | 310 |
| 139 | 3300025933 | Ga0207706_10046163 | Ga0207706_100461633 | 310 |
| 140 | 3300025933 | Ga0207706_10237079 | Ga0207706_102370792 | 310 |
| 141 | 3300025935 | Ga0207709_10061302 | Ga0207709_100613022 | 310 |
| 142 | 3300025936 | Ga0207670_10091543 | Ga0207670_100915432 | 310 |
| 143 | 3300025937 | Ga0207669_10002901 | Ga0207669_100029012 | 310 |
| 144 | 3300025938 | Ga0207704_10057553 | Ga0207704_100575532 | 310 |
| 145 | 3300025940 | Ga0207691_10014827 | Ga0207691_100148272 | 310 |
| 146 | 3300025940 | Ga0207691_10026300 | Ga0207691_100263002 | 310 |
| 147 | 3300025940 | Ga0207691_10161636 | Ga0207691_101616362 | 310 |
| 148 | 3300025942 | Ga0207689_10001155 | Ga0207689_100011557 | 310 |
| 149 | 3300025960 | Ga0207651_10009181 | Ga0207651_100091815 | 310 |
| 150 | 3300025960 | Ga0207651_10196616 | Ga0207651_101966162 | 310 |
| 151 | 3300025986 | Ga0207658_10059932 | Ga0207658_100599322 | 310 |
| 152 | 3300025986 | Ga0207658_10082671 | Ga0207658_100826712 | 310 |
| 153 | 3300026035 | Ga0207703_10059466 | Ga0207703_100594663 | 310 |
| 154 | 3300026035 | Ga0207703_10136927 | Ga0207703_101369272 | 310 |
| 155 | 3300026067 | Ga0207678_10046877 | Ga0207678_100468773 | 310 |
| 156 | 3300026089 | Ga0207648_10001137 | Ga0207648_100011378 | 310 |
| 157 | 3300026118 | Ga0207675_100038801 | Ga0207675_1000388012 | 310 |
| 158 | 3300028381 | Ga0268264_10034357 | Ga0268264_100343572 | 310 |
| 159 | 3300028381 | Ga0268264_10300119 | Ga0268264_103001191 | 310 |
| 160 | 3300050507 | nmdc:mga05p37_49530_c1 | nmdc:mga05p37_49530_c1_92_1033 | 310 |
| 161 | 3300050507 | nmdc:mga05p37_58623_c1 | nmdc:mga05p37_58623_c1_2562_3548 | 310 |
| 162 | 3300050508 | nmdc:mga09592_3365_c1 | nmdc:mga09592_3365_c1_7473_8459 | 310 |
| 163 | 3300050509 | nmdc:mga0qj67_20815_c1 | nmdc:mga0qj67_20815_c1_1962_2915 | 310 |
| 164 | 3300050510 | nmdc:mga06r32_129355_c1 | nmdc:mga06r32_129355_c1_867_1811 | 310 |
| 165 | 3300050510 | nmdc:mga06r32_468360_c1 | nmdc:mga06r32_468360_c1_160_1101 | 310 |
| 166 | 3300053084 | Ga0495595_0103341 | Ga0495595_0103341_207_1151 | 310 |
| 167 | 3300005290 | Ga0065712_10070697 | Ga0065712_100706973 | 311 |
| 168 | 3300005329 | Ga0070683_100013210 | Ga0070683_1000132102 | 311 |
| 169 | 3300005331 | Ga0070670_100001174 | Ga0070670_10000117414 | 311 |
| 170 | 3300005344 | Ga0070661_100029230 | Ga0070661_1000292303 | 311 |
| 171 | 3300005347 | Ga0070668_100159356 | Ga0070668_1001593563 | 311 |
| 172 | 3300005355 | Ga0070671_100018452 | Ga0070671_1000184522 | 311 |
| 173 | 3300005367 | Ga0070667_100327231 | Ga0070667_1003272312 | 311 |
| 174 | 3300005455 | Ga0070663_100018918 | Ga0070663_1000189182 | 311 |
| 175 | 3300005457 | Ga0070662_100131774 | Ga0070662_1001317742 | 311 |
| 176 | 3300005466 | Ga0070685_10074228 | Ga0070685_100742282 | 311 |
| 177 | 3300005535 | Ga0070684_100000941 | Ga0070684_1000009419 | 311 |
| 178 | 3300005543 | Ga0070672_100046579 | Ga0070672_1000465792 | 311 |
| 179 | 3300005547 | Ga0070693_100004577 | Ga0070693_1000045774 | 311 |
| 180 | 3300005564 | Ga0070664_100002693 | Ga0070664_10000269310 | 311 |
| 181 | 3300006173 | Ga0070716_100027702 | Ga0070716_1000277022 | 311 |
| 182 | 3300006852 | Ga0075433_10179934 | Ga0075433_101799342 | 311 |
| 183 | 3300006871 | Ga0075434_100013121 | Ga0075434_1000131214 | 311 |
| 184 | 3300006881 | Ga0068865_100227793 | Ga0068865_1002277932 | 311 |
| 185 | 3300009177 | Ga0105248_10046686 | Ga0105248_100466864 | 311 |
| 186 | 3300013296 | Ga0157374_10026540 | Ga0157374_100265403 | 311 |
| 187 | 3300014968 | Ga0157379_10052759 | Ga0157379_100527591 | 311 |
| 188 | 3300025906 | Ga0207699_10131265 | Ga0207699_101312652 | 311 |
| 189 | 3300025915 | Ga0207693_10321406 | Ga0207693_103214061 | 311 |
| 190 | 3300025920 | Ga0207649_10027415 | Ga0207649_100274152 | 311 |
| 191 | 3300025925 | Ga0207650_10099653 | Ga0207650_100996532 | 311 |
| 192 | 3300025933 | Ga0207706_10113614 | Ga0207706_101136142 | 311 |
| 193 | 3300025938 | Ga0207704_10055899 | Ga0207704_100558992 | 311 |
| 194 | 3300025938 | Ga0207704_10101290 | Ga0207704_101012901 | 311 |
| 195 | 3300025939 | Ga0207665_10082615 | Ga0207665_100826152 | 311 |
| 196 | 3300025941 | Ga0207711_10166849 | Ga0207711_101668492 | 311 |
| 197 | 3300025944 | Ga0207661_10005267 | Ga0207661_100052673 | 311 |
| 198 | 3300025945 | Ga0207679_10007680 | Ga0207679_100076805 | 311 |
| 199 | 3300025986 | Ga0207658_10172099 | Ga0207658_101720992 | 311 |
| 200 | 3300026067 | Ga0207678_10012858 | Ga0207678_100128584 | 311 |
| 201 | 3300035089 | Ga0373944_0052193 | Ga0373944_0052193_280_1215 | 311 |
| 202 | 3300035725 | Ga0373947_0047378 | Ga0373947_0047378_966_1901 | 311 |
| 203 | 3300048907 | Ga0496104_0019148 | Ga0496104_0019148_1539_2474 | 311 |
| 204 | 3300048908 | Ga0496105_0031951 | Ga0496105_0031951_2170_3105 | 311 |
| 205 | 3300048909 | Ga0496106_0054730 | Ga0496106_0054730_1800_2741 | 311 |
| 206 | 3300048912 | Ga0496109_0052839 | Ga0496109_0052839_840_1775 | 311 |
| 207 | 3300048913 | Ga0496110_0004522 | Ga0496110_0004522_5408_6343 | 311 |
| 208 | 3300048914 | Ga0496111_0001625 | Ga0496111_0001625_6269_7204 | 311 |
| 209 | 3300048917 | Ga0496114_0070209 | Ga0496114_0070209_333_1274 | 311 |
| 210 | 3300050512 | nmdc:mga0n895_55551_c1 | nmdc:mga0n895_55551_c1_1891_2826 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p61-assembly2.cif.gz_B | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7531 | 1 | 219 |
| 6p61-assembly2.cif.gz_B | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7496 | 1 | 219 |
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7439 | 1 | 220 |
| 6p61-assembly3.cif.gz_C | structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) | 0.7403 | 1 | 220 |
| 3bcv-assembly1.cif.gz_B | crystal structure of a putative glycosyltransferase from bacteroides fragilis | 0.7356 | 1 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMX1_74_289_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.827 | 1 | 224 | 3.90.550.10 |
| af_P75905_64_287_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8145 | 3 | 222 | 3.90.550.10 |
| af_Q9RQP9_29_257_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8089 | 3 | 222 | 3.90.550.10 |
| af_P9WMX1_74_289_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7989 | 1 | 224 | 3.90.550.10 |
| af_A9C3Q0_26_206_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.771 | 3 | 106 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2REV6-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9577 | 1 | 311 |
|
| AF-A0A1F2REV6-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9517 | 1 | 311 |
|
| AF-A0A522A668-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9493 | 5 | 311 |
GO:0016740
GO:0044010 GO:0045226 |
| AF-A0A2D6A245-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9424 | 5 | 306 |
|
| AF-A0A522A668-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9345 | 5 | 311 |
GO:0016740
GO:0044010 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar