F320504

General Info

Members Datasets Scaffolds Average Seq Length
210 146 421 185

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10043005|Ga0307517_100430054
Length 204
Sequence VRISLISMPGGGKSTVGRQLAKRLQIPFHDTDSVIEQRIGQTIREFFEAEGEPAFRDIESEVLAELLTPGLPPAVVSTGGGSVLRPANRVLLRERSCVLYLHNSPRELFRRLRHDTQRPLLQTADPLARLHQMAQQREPLYRETAHFVLEVGRPSVPLLVNTILMQLEVAGYLAKLPVSPPAAHDEPQPTTDAAEPLQISEDAS

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
68 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
69 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
73 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
74 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
75 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
76 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
77 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
78 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
81 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
82 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
100 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
101 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
102 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
109 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
110 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
111 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
112 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
113 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
114 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
115 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
116 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
119 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
120 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
121 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
122 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
123 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
136 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
139 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
142 2643221585 Pelomonas sp. Root662 Isolate Unclassified
143 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
144 2643221656 Pelomonas sp. Root405 Isolate Unclassified
145 2738541337 Pelomonas sp. BT06 Isolate Unclassified
146 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 1.9
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.33
Nodule 0
Rhizoplane 1.9
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10043005 3300028786 Bacteria 4825
2 JGI25152J39213_1001322 3300002773 Bacteria 11005
3 JGI25150J39212_1006748 3300002774 Bacteria 2346
4 JGI25153J46596_10001181 3300003215 Bacteria 15775
5 rootH1_10008575 3300003316 Bacteria 11244
6 rootH1_10008575 3300003323 Bacteria 2599
7 rootH1_10044567 3300003316 Bacteria 2612
8 rootH1_10108074 3300003316 Bacteria 2156
9 rootL2_10006020 3300003322 Bacteria 4706
10 rootL2_10120293 3300003322 Bacteria 1709
11 rootH1_10014994 3300003323 Bacteria 8653
12 Ga0055526_1001607 3300003771 Bacteria 15868
13 Ga0055531_10000108 3300003794 Bacteria 90059
14 Ga0070682_100011327 3300005337 Bacteria 5094
15 Ga0070671_100229020 3300005355 Bacteria 1577
16 Ga0070708_100336032 3300005445 Bacteria 1423
17 Ga0068867_100000039 3300005459 Bacteria 80301
18 Ga0068867_100645361 3300005459 Bacteria 928
19 Ga0068867_100955999 3300005459 Unclassified 774
20 Ga0070706_100001547 3300005467 Bacteria 24043
21 Ga0070707_100845602 3300005468 Bacteria 879
22 Ga0070698_100303000 3300005471 Bacteria 1529
23 Ga0070699_101227026 3300005518 Bacteria 688
24 Ga0070665_100002946 3300005548 Bacteria 18394
25 Ga0068855_100226307 3300005563 Bacteria 2096
26 Ga0068856_100095750 3300005614 Bacteria 2957
27 Ga0068856_100108649 3300005614 Bacteria 2770
28 Ga0068852_100009141 3300005616 Bacteria 7341
29 Ga0068866_10505485 3300005718 Unclassified 800
30 Ga0068863_100038779 3300005841 Bacteria 4532
31 Ga0068860_100657836 3300005843 Bacteria 1056
32 Ga0075364_10079230 3300006051 Bacteria 2170
33 Ga0075362_10031619 3300006177 Bacteria 2291
34 Ga0075367_10001980 3300006178 Bacteria 9118
35 Ga0075367_10018773 3300006178 Bacteria 3821
36 Ga0075367_10037452 3300006178 Bacteria 2819
37 Ga0075369_10000791 3300006186 Bacteria 10346
38 Ga0075369_10048938 3300006186 Bacteria 1825
39 Ga0075366_10001479 3300006195 Bacteria 11712
40 Ga0075366_10008019 3300006195 Bacteria 5852
41 Ga0075366_10017652 3300006195 Bacteria 4110
42 Ga0075366_10024373 3300006195 Bacteria 3529
43 Ga0075366_10029275 3300006195 Bacteria 3235
44 Ga0075366_10042460 3300006195 Bacteria 2692
45 Ga0075366_10086829 3300006195 Bacteria 1872
46 Ga0075366_10137806 3300006195 Bacteria 1474
47 Ga0075366_10278328 3300006195 Bacteria 1022
48 Ga0075370_10004481 3300006353 Bacteria 6788
49 Ga0075370_10015745 3300006353 Bacteria 4056
50 Ga0075370_10018730 3300006353 Bacteria 3759
51 Ga0075370_10021022 3300006353 Bacteria 3573
52 Ga0075370_10030009 3300006353 Bacteria 3032
53 Ga0075370_10031234 3300006353 Bacteria 2973
54 Ga0075370_10084371 3300006353 Bacteria 1828
55 Ga0075370_10202096 3300006353 Bacteria 1172
56 Ga0105245_10150107 3300009098 Bacteria 2203
57 Ga0105243_10006397 3300009148 Bacteria 9101
58 Ga0105248_10094898 3300009177 Bacteria 3358
59 Ga0105237_10048991 3300009545 Bacteria 4247
60 Ga0105238_10010770 3300009551 Bacteria 9186
61 Ga0105239_10161337 3300010375 Bacteria 2504
62 Ga0157372_10208624 3300013307 Bacteria 2264
63 Ga0157377_10000044 3300014745 Bacteria 100420
64 Ga0157379_10109860 3300014968 Bacteria 2476
65 Ga0209050_1016239 3300025298 Bacteria 3061
66 Ga0209051_1090502 3300025303 Bacteria 853
67 Ga0209257_1000033 3300025304 Bacteria 671006
68 Ga0207684_10003302 3300025910 Bacteria 15830
69 Ga0207671_10035289 3300025914 Bacteria 3712
70 Ga0207694_10392737 3300025924 Bacteria 1153
71 Ga0207709_10004230 3300025935 Bacteria 8321
72 Ga0207709_10008440 3300025935 Bacteria 5697
73 Ga0207711_10814268 3300025941 Bacteria 870
74 Ga0207667_10186401 3300025949 Bacteria 2130
75 Ga0207702_10082524 3300026078 Bacteria 2795
76 Ga0207702_10095375 3300026078 Bacteria 2614
77 Ga0207648_10000109 3300026089 Bacteria 80648
78 Ga0207698_10005546 3300026142 Bacteria 7807
79 Ga0209813_10001784 3300027866 Bacteria 4849
80 Ga0209813_10016808 3300027866 Bacteria 2001
81 Ga0268266_10005139 3300028379 Bacteria 12327
82 Ga0268264_10676983 3300028381 Bacteria 1023
83 Ga0307515_10018168 3300028794 Bacteria 12755
84 Ga0307515_10022245 3300028794 Bacteria 11182
85 Ga0307515_10030011 3300028794 Bacteria 9160
86 Ga0307515_10081597 3300028794 Bacteria 4198
87 Ga0307515_10261098 3300028794 Bacteria 1468
88 Ga0307512_10370585 3300030522 Bacteria 618
89 Ga0265332_10000027 3300031238 Bacteria 190796
90 Ga0265328_10043513 3300031239 Bacteria 1652
91 Ga0265316_10000005 3300031344 Bacteria 304442
92 Ga0307408_100000023 3300031548 Bacteria 295931
93 Ga0307516_10000237 3300031730 Bacteria 70929
94 Ga0307516_10000476 3300031730 Bacteria 53151
95 Ga0307516_10437283 3300031730 Bacteria 965
96 Ga0307414_10177389 3300032004 Bacteria 1710
97 Ga0307411_10029408 3300032005 Bacteria 3354
98 Ga0373939_0000110 3300035114 Bacteria 25000
99 Ga0373931_0000092 3300035691 Bacteria 41580
100 Ga0395905_0000027 3300037471 Bacteria 297239
101 Ga0395905_0000151 3300037471 Bacteria 115485
102 Ga0395905_0003411 3300037471 Bacteria 17002
103 Ga0395905_0018805 3300037471 Bacteria 6553
104 Ga0395905_0023903 3300037471 Bacteria 5769
105 Ga0395905_0036751 3300037471 Bacteria 4601
106 Ga0439461_0038744 3300041410 Bacteria 1022
107 Ga0451798_0924843 3300041458 Unclassified 645
108 Ga0451800_0783843 3300041459 Bacteria 718
109 Ga0451807_0469672 3300041486 Bacteria 1048
110 Ga0451807_0923753 3300041486 Bacteria 1719
111 Ga0451853_2591822 3300041512 Unclassified 2328
112 Ga0439437_005100 3300042000 Bacteria 1441
113 Ga0439455_0057120 3300042012 Bacteria 1029
114 Ga0450888_000030 3300042126 Bacteria 9886
115 Ga0450890_000900 3300042127 Bacteria 4307
116 Ga0450891_000900 3300042129 Bacteria 3113
117 Ga0450892_000688 3300042130 Bacteria 3810
118 Ga0450904_009213 3300042139 Bacteria 972
119 Ga0439458_0128350 3300042157 Bacteria 671
120 Ga0450916_001472 3300042530 Bacteria 2364
121 Ga0450893_0000563 3300042532 Bacteria 5280
122 Ga0450901_003066 3300042533 Bacteria 1756
123 Ga0466969_0000046 3300044656 Bacteria 63999
124 Ga0466972_0003115 3300044658 Bacteria 8230
125 Ga0466966_0282320 3300044684 Bacteria 998
126 Ga0453684_0097441 3300044712 Bacteria 3609
127 Ga0466970_0027758 3300044765 Bacteria 2971
128 Ga0466959_0071524 3300045049 Bacteria 2511
129 Ga0451576_0024819 3300045051 Bacteria 6469
130 Ga0451576_0115715 3300045051 Bacteria 2791
131 Ga0451576_0841103 3300045051 Bacteria 963
132 Ga0495590_0006362 3300046457 Bacteria 4614
133 Ga0495590_0030986 3300046457 Bacteria 1873
134 Ga0495610_0157234 3300046512 Bacteria 964
135 Ga0495620_0231114 3300046515 Bacteria 707
136 Ga0495643_0180791 3300046522 Bacteria 1025
137 Ga0495649_0004870 3300046694 Bacteria 8675
138 Ga0495660_0005497 3300046810 Bacteria 7591
139 Ga0495687_011786 3300047443 Bacteria 4671
140 Ga0501309_002421 3300049129 Bacteria 2006
141 Ga0501310_000503 3300049130 Unclassified 3413
142 Ga0501294_000808 3300049517 Bacteria 3423
143 Ga0501300_002807 3300049523 Bacteria 2604
144 Ga0501301_004065 3300049524 Bacteria 1027
145 Ga0501314_000802 3300049530 Bacteria 2083
146 Ga0501323_007999 3300049539 Bacteria 1219
147 Ga0501043_0000002 3300049579 Bacteria 351081
148 Ga0501046_0000008 3300049580 Bacteria 351167
149 Ga0501047_0000003 3300049581 Bacteria 508375
150 Ga0501048_0001116 3300049582 Bacteria 20152
151 Ga0501206_010722 3300049653 Bacteria 1231
152 Ga0501211_001642 3300049658 Unclassified 2395
153 Ga0501227_001014 3300049665 Bacteria 6226
154 Ga0501235_006360 3300049669 Bacteria 2571
155 Ga0501242_031654 3300049674 Bacteria 719
156 Ga0501252_000620 3300049682 Bacteria 2841
157 Ga0501258_019645 3300049687 Bacteria 786
158 Ga0501221_000641 3300049704 Bacteria 5603
159 Ga0501229_000486 3300049706 Bacteria 4483
160 Ga0501083_0269002 3300049744 Bacteria 1109
161 Ga0501232_001537 3300049757 Bacteria 1858
162 Ga0501264_011805 3300049761 Bacteria 853
163 Ga0501267_000160 3300049764 Bacteria 4483
164 Ga0501269_011133 3300049766 Bacteria 1096
165 Ga0501272_008027 3300049769 Bacteria 1153
166 Ga0501283_007830 3300049779 Bacteria 1530
167 Ga0501045_0018977 3300049824 Bacteria 4897
168 nmdc:mga03683_38376_c1 3300050489 Bacteria 1956
169 nmdc:mga03n38_247499_c1 3300050490 Bacteria 940
170 nmdc:mga03n38_42133_c1 3300050490 Bacteria 1994
171 nmdc:mga03n38_709848_c1 3300050490 Bacteria 580
172 nmdc:mga00v17_570538_c1 3300050491 Bacteria 731
173 nmdc:mga0yw44_288796_c1 3300050492 Bacteria 1097
174 nmdc:mga0yw44_90477_c1 3300050492 Bacteria 1933
175 nmdc:mga0k408_1932_c1 3300050493 Bacteria 11089
176 nmdc:mga0k408_2242_c1 3300050493 Bacteria 10328
177 nmdc:mga0k408_22573_c1 3300050493 Bacteria 3543
178 nmdc:mga0k408_2381_c1 3300050493 Bacteria 10002
179 nmdc:mga0k408_4638_c1 3300050493 Bacteria 7281
180 nmdc:mga0k408_5467_c1 3300050493 Bacteria 6763
181 nmdc:mga0k408_93424_c1 3300050493 Bacteria 1769
182 nmdc:mga0k408_9949_c1 3300050493 Bacteria 5134
183 nmdc:mga06z11_119135_c1 3300050494 Bacteria 1471
184 nmdc:mga06z11_2567_c1 3300050494 Bacteria 6949
185 nmdc:mga06z11_59347_c1 3300050494 Bacteria 1988
186 nmdc:mga04h51_4041_c1 3300050495 Bacteria 3616
187 nmdc:mga04h51_5062_c1 3300050495 Bacteria 3334
188 nmdc:mga07m45_1525_c1 3300050496 Bacteria 10625
189 nmdc:mga07m45_160584_c1 3300050496 Bacteria 1305
190 nmdc:mga07m45_210307_c1 3300050496 Bacteria 1132
191 nmdc:mga07m45_3009_c1 3300050496 Bacteria 8031
192 nmdc:mga07m45_3544_c1 3300050496 Bacteria 7541
193 nmdc:mga07m45_38101_c1 3300050496 Bacteria 2682
194 nmdc:mga07m45_4836_c1 3300050496 Bacteria 6624
195 nmdc:mga07m45_7715_c1 3300050496 Bacteria 5506
196 nmdc:mga0sz30_217329_c1 3300050516 Bacteria 850
197 nmdc:mga0sz30_9476_c1 3300050516 Bacteria 3708
198 Ga0500651_0016745 3300053093 Bacteria 4512
199 Ga0500651_0338492 3300053093 Bacteria 856
200 Ga0500593_001276 3300053117 Bacteria 9103
201 Ga0500597_242922 3300053120 Bacteria 740
202 Ga0500658_0002363 3300053134 Bacteria 7316
203 Ga0500590_002385 3300053148 Bacteria 8302
204 Ga0590071_002628 3300059421 Bacteria 4513
205 Ga0590074_013979 3300059423 Bacteria 1357
206 2643743092 2643221544 Bacteria 5886209
207 2643932882 2643221585 Bacteria 5812563
208 2644260385 2643221646 Bacteria 6433402
209 2644314132 2643221656 Bacteria 5809961
210 2739055954 2738541337 Bacteria 6183410
211 2904482887 2904479285 Bacteria 5073931
212 Ga0307517_10043005
213 JGI25152J39213_1001322
214 JGI25150J39212_1006748
215 JGI25153J46596_10001181
216 rootH1_10008575
217 rootH1_10044567
218 rootH1_10108074
219 rootL2_10006020
220 rootL2_10120293
221 rootH1_10014994
222 Ga0055526_1001607
223 Ga0055531_10000108
224 Ga0070682_100011327
225 Ga0070671_100229020
226 Ga0070708_100336032
227 Ga0068867_100000039
228 Ga0068867_100645361
229 Ga0068867_100955999
230 Ga0070706_100001547
231 Ga0070707_100845602
232 Ga0070698_100303000
233 Ga0070699_101227026
234 Ga0070665_100002946
235 Ga0068855_100226307
236 Ga0068856_100095750
237 Ga0068856_100108649
238 Ga0068852_100009141
239 Ga0068866_10505485
240 Ga0068863_100038779
241 Ga0068860_100657836
242 Ga0075364_10079230
243 Ga0075362_10031619
244 Ga0075367_10001980
245 Ga0075367_10018773
246 Ga0075367_10037452
247 Ga0075369_10000791
248 Ga0075369_10048938
249 Ga0075366_10001479
250 Ga0075366_10008019
251 Ga0075366_10017652
252 Ga0075366_10024373
253 Ga0075366_10029275
254 Ga0075366_10042460
255 Ga0075366_10086829
256 Ga0075366_10137806
257 Ga0075366_10278328
258 Ga0075370_10004481
259 Ga0075370_10015745
260 Ga0075370_10018730
261 Ga0075370_10021022
262 Ga0075370_10030009
263 Ga0075370_10031234
264 Ga0075370_10084371
265 Ga0075370_10202096
266 Ga0105245_10150107
267 Ga0105243_10006397
268 Ga0105248_10094898
269 Ga0105237_10048991
270 Ga0105238_10010770
271 Ga0105239_10161337
272 Ga0157372_10208624
273 Ga0157377_10000044
274 Ga0157379_10109860
275 Ga0209050_1016239
276 Ga0209051_1090502
277 Ga0209257_1000033
278 Ga0207684_10003302
279 Ga0207671_10035289
280 Ga0207694_10392737
281 Ga0207709_10004230
282 Ga0207709_10008440
283 Ga0207711_10814268
284 Ga0207667_10186401
285 Ga0207702_10082524
286 Ga0207702_10095375
287 Ga0207648_10000109
288 Ga0207698_10005546
289 Ga0209813_10001784
290 Ga0209813_10016808
291 Ga0268266_10005139
292 Ga0268264_10676983
293 Ga0307515_10018168
294 Ga0307515_10022245
295 Ga0307515_10030011
296 Ga0307515_10081597
297 Ga0307515_10261098
298 Ga0307512_10370585
299 Ga0265332_10000027
300 Ga0265328_10043513
301 Ga0265316_10000005
302 Ga0307408_100000023
303 Ga0307516_10000237
304 Ga0307516_10000476
305 Ga0307516_10437283
306 Ga0307414_10177389
307 Ga0307411_10029408
308 Ga0373939_0000110
309 Ga0373931_0000092
310 Ga0395905_0000027
311 Ga0395905_0000151
312 Ga0395905_0003411
313 Ga0395905_0018805
314 Ga0395905_0023903
315 Ga0395905_0036751
316 Ga0439461_0038744
317 Ga0451798_0924843
318 Ga0451800_0783843
319 Ga0451807_0469672
320 Ga0451807_0923753
321 Ga0451853_2591822
322 Ga0439437_005100
323 Ga0439455_0057120
324 Ga0450888_000030
325 Ga0450890_000900
326 Ga0450891_000900
327 Ga0450892_000688
328 Ga0450904_009213
329 Ga0439458_0128350
330 Ga0450916_001472
331 Ga0450893_0000563
332 Ga0450901_003066
333 Ga0466969_0000046
334 Ga0466972_0003115
335 Ga0466966_0282320
336 Ga0453684_0097441
337 Ga0466970_0027758
338 Ga0466959_0071524
339 Ga0451576_0024819
340 Ga0451576_0115715
341 Ga0451576_0841103
342 Ga0495590_0006362
343 Ga0495590_0030986
344 Ga0495610_0157234
345 Ga0495620_0231114
346 Ga0495643_0180791
347 Ga0495649_0004870
348 Ga0495660_0005497
349 Ga0495687_011786
350 Ga0501309_002421
351 Ga0501310_000503
352 Ga0501294_000808
353 Ga0501300_002807
354 Ga0501301_004065
355 Ga0501314_000802
356 Ga0501323_007999
357 Ga0501043_0000002
358 Ga0501046_0000008
359 Ga0501047_0000003
360 Ga0501048_0001116
361 Ga0501206_010722
362 Ga0501211_001642
363 Ga0501227_001014
364 Ga0501235_006360
365 Ga0501242_031654
366 Ga0501252_000620
367 Ga0501258_019645
368 Ga0501221_000641
369 Ga0501229_000486
370 Ga0501083_0269002
371 Ga0501232_001537
372 Ga0501264_011805
373 Ga0501267_000160
374 Ga0501269_011133
375 Ga0501272_008027
376 Ga0501283_007830
377 Ga0501045_0018977
378 nmdc:mga03683_38376_c1
379 nmdc:mga03n38_247499_c1
380 nmdc:mga03n38_42133_c1
381 nmdc:mga03n38_709848_c1
382 nmdc:mga00v17_570538_c1
383 nmdc:mga0yw44_288796_c1
384 nmdc:mga0yw44_90477_c1
385 nmdc:mga0k408_1932_c1
386 nmdc:mga0k408_2242_c1
387 nmdc:mga0k408_22573_c1
388 nmdc:mga0k408_2381_c1
389 nmdc:mga0k408_4638_c1
390 nmdc:mga0k408_5467_c1
391 nmdc:mga0k408_93424_c1
392 nmdc:mga0k408_9949_c1
393 nmdc:mga06z11_119135_c1
394 nmdc:mga06z11_2567_c1
395 nmdc:mga06z11_59347_c1
396 nmdc:mga04h51_4041_c1
397 nmdc:mga04h51_5062_c1
398 nmdc:mga07m45_1525_c1
399 nmdc:mga07m45_160584_c1
400 nmdc:mga07m45_210307_c1
401 nmdc:mga07m45_3009_c1
402 nmdc:mga07m45_3544_c1
403 nmdc:mga07m45_38101_c1
404 nmdc:mga07m45_4836_c1
405 nmdc:mga07m45_7715_c1
406 nmdc:mga0sz30_217329_c1
407 nmdc:mga0sz30_9476_c1
408 Ga0500651_0016745
409 Ga0500651_0338492
410 Ga0500593_001276
411 Ga0500597_242922
412 Ga0500658_0002363
413 Ga0500590_002385
414 Ga0590071_002628
415 Ga0590074_013979
416 2643743092
417 2643932882
418 2644260385
419 2644314132
420 2739055954
421 2904482887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

9

168

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1shk-assembly1.cif.gz_A the three-dimensional structure of shikimate kinase from erwinia chrysanthemi 0.9627 1 168
1shk-assembly2.cif.gz_B the three-dimensional structure of shikimate kinase from erwinia chrysanthemi 0.9457 1 169
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.9448 1 167
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.9412 5 168
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.938 5 167
ID Description Score Start End Superfamily
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9592 1 169 3.40.50.300
2shkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 1 169 3.40.50.300
af_P0A6E1_1_171_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9259 1 169 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9195 3 174 3.40.50.300
3n2eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9148 3 173 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I1FPH3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9915 2 174 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7Y9UIG9-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9908 2 177 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A0Q7CG40-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9888 5 174 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A1I4NV85-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9879 23 175 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A520CDB9-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9868 3 177 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map