F320512

General Info

Members Datasets Scaffolds Average Seq Length
210 134 200 250

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10033503|Ga0265338_100335036
Length 303
Sequence MSHTLQVWKETNKVFFRTVEEAYFKPRKRGFKPDQLGSRLFHEAYQTGQAWNRKEIAMNNPVVLITGALTGIGHATALAFAKTGAKLVVAGRKADAGAAVELRAAGAEAEFVRADVRSEDDVRALIDATVKRFGRLDIAVNAAGTEGKPGPATEQTAESYAATFDTNVLGTVLSMKHELRAMLAQGSGSIVNISSTFGHEGGAGASIYSASKHAVEGLTKSAALEVGSKGVRVNAVAPGPIQTGMLDRFTGSEDVKAYLATLNAMKRIGKPDEIARAILYISSDAPSFVTGHILTVDGGKTAG

Samples

Sample ID Description Type Environment
1 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
2 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
3 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
4 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
5 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
6 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
7 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
125 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
128 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
133 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
134 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 2.38
Rhizoplane 0.48
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000146 3300000532 Bacteria 6191
2 JGI25154J39366_1001366 3300002738 Bacteria 8872
3 JGI25151J46595_10003677 3300003187 Bacteria 8351
4 JGI25151J46595_10003933 3300003187 Bacteria 8015
5 Ga0070709_10179145 3300005434 Bacteria 1487
6 Ga0070714_100188731 3300005435 Bacteria 1879
7 Ga0070713_100030393 3300005436 Bacteria 4289
8 Ga0070711_100008152 3300005439 Bacteria 6406
9 Ga0070708_100051695 3300005445 Bacteria 3641
10 Ga0070708_100193782 3300005445 Bacteria 1901
11 Ga0070708_100470664 3300005445 Bacteria 1185
12 Ga0070678_100000021 3300005456 Bacteria 49579
13 Ga0070678_100208563 3300005456 Bacteria 1617
14 Ga0068867_100055340 3300005459 Bacteria 2933
15 Ga0070706_100000326 3300005467 Bacteria 57972
16 Ga0070706_100074433 3300005467 Bacteria 3143
17 Ga0070706_100207839 3300005467 Bacteria 1828
18 Ga0070707_100025892 3300005468 Bacteria 5568
19 Ga0070707_100079383 3300005468 Bacteria 3167
20 Ga0070707_100328650 3300005468 Bacteria 1486
21 Ga0070707_100368055 3300005468 Bacteria 1396
22 Ga0070707_100773206 3300005468 Bacteria 924
23 Ga0070698_100013446 3300005471 Bacteria 8663
24 Ga0070698_100263481 3300005471 Bacteria 1656
25 Ga0070698_100457607 3300005471 Bacteria 1212
26 Ga0070699_100232396 3300005518 Bacteria 1644
27 Ga0070699_100527845 3300005518 Bacteria 1073
28 Ga0070697_100006281 3300005536 Bacteria 9200
29 Ga0070697_100029173 3300005536 Bacteria 4421
30 Ga0070697_100041011 3300005536 Bacteria 3745
31 Ga0068853_100084089 3300005539 Bacteria 2788
32 Ga0068853_100223839 3300005539 Bacteria 1719
33 Ga0070665_100141905 3300005548 Bacteria 2405
34 Ga0070717_10224070 3300006028 Bacteria 1653
35 Ga0070715_10000006 3300006163 Bacteria 216296
36 Ga0070715_10044913 3300006163 Bacteria 1871
37 Ga0070715_10139455 3300006163 Bacteria 1176
38 Ga0070712_100068709 3300006175 Bacteria 2525
39 Ga0097621_100042940 3300006237 Bacteria 3643
40 Ga0068871_100019625 3300006358 Bacteria 5165
41 Ga0075428_100176248 3300006844 Bacteria 2315
42 Ga0075428_100350074 3300006844 Bacteria 1585
43 Ga0075431_100511851 3300006847 Bacteria 1190
44 Ga0075433_10149634 3300006852 Unclassified 2076
45 Ga0075434_100148548 3300006871 Bacteria 2363
46 Ga0075434_100266922 3300006871 Bacteria 1731
47 Ga0075434_100605327 3300006871 Bacteria 1115
48 Ga0075429_100074349 3300006880 Bacteria 2960
49 Ga0075429_100254574 3300006880 Bacteria 1537
50 Ga0075429_100684693 3300006880 Bacteria 898
51 Ga0075436_100003639 3300006914 Bacteria 10557
52 Ga0075436_100083332 3300006914 Bacteria 2219
53 Ga0075436_100264677 3300006914 Bacteria 1226
54 Ga0075435_100150293 3300007076 Bacteria 1957
55 Ga0075435_100484440 3300007076 Bacteria 1069
56 Ga0099794_10017352 3300007265 Bacteria 3207
57 Ga0099794_10027073 3300007265 Bacteria 2655
58 Ga0099794_10184267 3300007265 Bacteria 1066
59 Ga0099795_10000829 3300007788 Bacteria 6134
60 Ga0105240_10039922 3300009093 Bacteria 6007
61 Ga0114129_10019037 3300009147 Bacteria 9779
62 Ga0114129_10108081 3300009147 Bacteria 3841
63 Ga0114129_10194401 3300009147 Bacteria 2752
64 Ga0105242_10492110 3300009176 Bacteria 1165
65 Ga0105237_10155258 3300009545 Bacteria 2285
66 Ga0099796_10003616 3300010159 Bacteria 3616
67 Ga0099796_10050818 3300010159 Bacteria 1438
68 Ga0099796_10117688 3300010159 Bacteria 1018
69 Ga0105239_10091756 3300010375 Bacteria 3352
70 Ga0157378_10059731 3300013297 Unclassified 3402
71 Ga0163162_10002744 3300013306 Bacteria 16705
72 Ga0163162_10181007 3300013306 Bacteria 2234
73 Ga0163162_10599835 3300013306 Bacteria 1227
74 Ga0163163_10141010 3300014325 Bacteria 2452
75 Ga0213872_10000005 3300021361 Bacteria 290165
76 Ga0213872_10003193 3300021361 Bacteria 9184
77 Ga0213872_10039436 3300021361 Bacteria 2155
78 Ga0209435_100271 3300025206 Bacteria 12690
79 Ga0209646_1000240 3300025246 Bacteria 56884
80 Ga0209759_1000312 3300025256 Bacteria 65707
81 Ga0209025_1000113 3300025294 Bacteria 218943
82 Ga0209025_1000307 3300025294 Bacteria 108704
83 Ga0207685_10000010 3300025905 Bacteria 216792
84 Ga0207685_10088380 3300025905 Bacteria 1299
85 Ga0207685_10136844 3300025905 Bacteria 1094
86 Ga0207699_10000006 3300025906 Bacteria 430147
87 Ga0207684_10000056 3300025910 Bacteria 215717
88 Ga0207684_10147294 3300025910 Bacteria 2025
89 Ga0207671_10003470 3300025914 Bacteria 15686
90 Ga0207671_10134436 3300025914 Bacteria 1901
91 Ga0207693_10009595 3300025915 Bacteria 7881
92 Ga0207663_10008256 3300025916 Bacteria 5435
93 Ga0207646_10047903 3300025922 Bacteria 3832
94 Ga0207694_10074210 3300025924 Bacteria 2662
95 Ga0207659_10161634 3300025926 Bacteria 1759
96 Ga0207700_10073185 3300025928 Bacteria 2645
97 Ga0207664_10004804 3300025929 Bacteria 9183
98 Ga0207664_10210131 3300025929 Bacteria 1683
99 Ga0207664_10304566 3300025929 Unclassified 1402
100 Ga0207669_10000072 3300025937 Bacteria 51702
101 Ga0207665_10136342 3300025939 Bacteria 1747
102 Ga0207712_10015668 3300025961 Bacteria 4893
103 Ga0207639_10015173 3300026041 Bacteria 5429
104 Ga0207639_10191080 3300026041 Bacteria 1749
105 Ga0207648_10070734 3300026089 Bacteria 3041
106 Ga0207648_10287302 3300026089 Bacteria 1472
107 Ga0207683_10001519 3300026121 Bacteria 20898
108 Ga0268266_10197838 3300028379 Bacteria 1838
109 Ga0265338_10033503 3300028800 Bacteria 4982
110 Ga0265328_10016926 3300031239 Bacteria 2830
111 Ga0265327_10000776 3300031251 Bacteria 49288
112 Ga0265327_10006581 3300031251 Bacteria 9235
113 Ga0307513_10077999 3300031456 Bacteria 3428
114 Ga0307513_10097643 3300031456 Bacteria 2972
115 Ga0265342_10088075 3300031712 Bacteria 1783
116 Ga0373943_0050330 3300035170 Bacteria 2047
117 Ga0373935_0049681 3300035692 Bacteria 2659
118 Ga0373947_0051537 3300035725 Bacteria 2476
119 Ga0436361_0089479 3300039447 Bacteria 55221
120 Ga0436361_0189207 3300039447 Bacteria 31041
121 Ga0436361_0298003 3300039447 Bacteria 15847
122 Ga0436361_0339448 3300039447 Bacteria 2308
123 Ga0436361_0593175 3300039447 Bacteria 8012
124 Ga0436361_1051731 3300039447 Bacteria 2561
125 Ga0453683_0118638 3300044673 Bacteria 1665
126 Ga0495629_0002205 3300046459 Bacteria 15019
127 Ga0495641_0010715 3300046461 Bacteria 5283
128 Ga0495651_0421855 3300046462 Bacteria 867
129 Ga0495580_0139935 3300046472 Bacteria 1677
130 Ga0495582_0019500 3300046473 Bacteria 3708
131 Ga0495606_0060762 3300046507 Bacteria 2419
132 Ga0495630_0035034 3300046517 Bacteria 3751
133 Ga0495648_0026088 3300046524 Bacteria 3941
134 Ga0495648_0043388 3300046524 Bacteria 2819
135 Ga0495648_0203722 3300046524 Bacteria 988
136 Ga0495666_0003321 3300046526 Bacteria 8125
137 Ga0495642_0000614 3300046528 Bacteria 17935
138 Ga0495665_0160863 3300046531 Bacteria 1170
139 Ga0495640_0054653 3300046533 Bacteria 2734
140 Ga0495668_0000006 3300046616 Bacteria 553404
141 Ga0495668_0001366 3300046616 Bacteria 23914
142 Ga0495611_0000881 3300046648 Bacteria 16332
143 Ga0495611_0003298 3300046648 Bacteria 7133
144 Ga0495625_0009637 3300046660 Bacteria 8052
145 Ga0495599_0005996 3300046678 Bacteria 7312
146 Ga0495623_0164481 3300046679 Bacteria 1301
147 Ga0495624_0156343 3300046690 Bacteria 1393
148 Ga0495581_0100666 3300047315 Bacteria 1679
149 Ga0495636_0031624 3300047318 Bacteria 2170
150 Ga0495672_0026639 3300047320 Bacteria 3685
151 Ga0495672_0030565 3300047320 Bacteria 3376
152 Ga0495672_0035569 3300047320 Bacteria 3067
153 Ga0495672_0059202 3300047320 Bacteria 2217
154 Ga0495676_0130641 3300047321 Bacteria 1813
155 Ga0495680_0194844 3300047322 Bacteria 1456
156 Ga0495687_000136 3300047443 Bacteria 113298
157 Ga0495677_0006040 3300047445 Bacteria 4579
158 Ga0495679_001090 3300047446 Bacteria 16428
159 Ga0495679_012887 3300047446 Bacteria 3162
160 Ga0495673_0018698 3300047469 Bacteria 3488
161 Ga0495684_0154661 3300047471 Bacteria 1713
162 Ga0495686_0000670 3300047472 Bacteria 46425
163 Ga0495686_0022270 3300047472 Bacteria 4193
164 Ga0496115_0005312 3300048918 Bacteria 9367
165 Ga0496121_0000021 3300048924 Bacteria 478544
166 Ga0496121_0018037 3300048924 Bacteria 7148
167 Ga0496126_0000012 3300048929 Bacteria 727789
168 Ga0496126_0006819 3300048929 Bacteria 12671
169 Ga0495678_000216 3300049459 Bacteria 66661
170 Ga0495678_045919 3300049459 Bacteria 1720
171 Ga0501034_0000124 3300049571 Bacteria 142890
172 Ga0501034_0491844 3300049571 Bacteria 1141
173 nmdc:mga05p37_326366_c1 3300050507 Bacteria 1815
174 nmdc:mga05p37_87039_c1 3300050507 Bacteria 3851
175 nmdc:mga05p37_89434_c1 3300050507 Bacteria 3795
176 nmdc:mga09592_88505_c1 3300050508 Bacteria 2645
177 nmdc:mga0qj67_35067_c1 3300050509 Bacteria 3922
178 nmdc:mga06r32_14693_c1 3300050510 Bacteria 7106
179 nmdc:mga06r32_213492_c1 3300050510 Bacteria 1918
180 nmdc:mga06r32_808584_c1 3300050510 Bacteria 898
181 nmdc:mga08y16_256698_c1 3300050511 Bacteria 1805
182 nmdc:mga0n895_114023_c1 3300050512 Bacteria 2721
183 nmdc:mga0n895_207166_c1 3300050512 Bacteria 1991
184 nmdc:mga0n895_362770_c1 3300050512 Bacteria 1467
185 nmdc:mga0rr50_78435_c1 3300050513 Bacteria 2541
186 nmdc:mga08x19_108232_c1 3300050514 Bacteria 1851
187 nmdc:mga08x19_151854_c1 3300050514 Bacteria 1569
188 nmdc:mga08x19_5356_c1 3300050514 Bacteria 7585
189 Ga0500643_000481 3300053087 Bacteria 29124
190 Ga0500583_0000079 3300053092 Bacteria 57526
191 Ga0500607_091761 3300053121 Bacteria 1526
192 Ga0500618_000306 3300053125 Bacteria 36367
193 Ga0500568_0026810 3300053139 Bacteria 2415
194 Ga0500586_001571 3300053145 Bacteria 4870
195 Ga0500603_040372 3300053150 Bacteria 1243
196 Ga0500616_0003250 3300053153 Bacteria 12578
197 Ga0500616_0023718 3300053153 Bacteria 3415
198 Ga0500636_0180798 3300053177 Bacteria 1132
199 Ga0500645_001535 3300053730 Bacteria 11537
200 Ga0500601_004167 3300053737 Bacteria 1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0003250 Ga0500616_0003250_10985_11752 228
2 3300006163 Ga0070715_10044913 Ga0070715_100449132 231
3 3300025905 Ga0207685_10088380 Ga0207685_100883802 231
4 3300005539 Ga0068853_100084089 Ga0068853_1000840893 242
5 3300021361 Ga0213872_10000005 Ga0213872_10000005129 242
6 3300025924 Ga0207694_10074210 Ga0207694_100742103 242
7 3300039447 Ga0436361_0089479 Ga0436361_0089479_23433_24182 242
8 3300005467 Ga0070706_100000326 Ga0070706_10000032647 243
9 3300005468 Ga0070707_100328650 Ga0070707_1003286502 243
10 3300005471 Ga0070698_100263481 Ga0070698_1002634811 243
11 3300005536 Ga0070697_100006281 Ga0070697_10000628112 243
12 3300025910 Ga0207684_10000056 Ga0207684_10000056167 243
13 iso_pu_bacteria 2852387548 2852390613 244
14 iso_pu_bacteria 2852387548 2852390643 244
15 iso_pu_bacteria 2909399089 2909399225 244
16 iso_pu_bacteria 8046767195 8046768961 244
17 iso_pu_bacteria 8046767195 8046768990 244
18 iso_pu_bacteria 8057575449 8057582467 244
19 3300002738 JGI25154J39366_1001366 JGI25154J39366_10013662 246
20 3300025206 Ga0209435_100271 Ga0209435_10027112 246
21 3300025246 Ga0209646_1000240 Ga0209646_100024012 246
22 3300025256 Ga0209759_1000312 Ga0209759_100031212 246
23 3300028800 Ga0265338_10033503 Ga0265338_100335036 246
24 3300031712 Ga0265342_10088075 Ga0265342_100880752 246
25 3300005434 Ga0070709_10179145 Ga0070709_101791451 247
26 3300005435 Ga0070714_100188731 Ga0070714_1001887312 247
27 3300005436 Ga0070713_100030393 Ga0070713_1000303935 247
28 3300006880 Ga0075429_100684693 Ga0075429_1006846932 247
29 3300025928 Ga0207700_10073185 Ga0207700_100731852 247
30 3300025929 Ga0207664_10004804 Ga0207664_100048043 247
31 3300025929 Ga0207664_10210131 Ga0207664_102101312 247
32 3300044673 Ga0453683_0118638 Ga0453683_0118638_623_1366 247
33 3300047320 Ga0495672_0059202 Ga0495672_0059202_679_1422 247
34 3300048918 Ga0496115_0005312 Ga0496115_0005312_2419_3168 247
35 3300049571 Ga0501034_0491844 Ga0501034_0491844_328_1071 247
36 3300000532 CNAas_1000146 CNAas_10001466 248
37 3300003187 JGI25151J46595_10003677 JGI25151J46595_100036773 248
38 3300003187 JGI25151J46595_10003933 JGI25151J46595_100039337 248
39 3300005439 Ga0070711_100008152 Ga0070711_1000081527 248
40 3300005445 Ga0070708_100051695 Ga0070708_1000516954 248
41 3300005445 Ga0070708_100193782 Ga0070708_1001937822 248
42 3300005445 Ga0070708_100470664 Ga0070708_1004706642 248
43 3300005456 Ga0070678_100000021 Ga0070678_10000002129 248
44 3300005456 Ga0070678_100208563 Ga0070678_1002085632 248
45 3300005459 Ga0068867_100055340 Ga0068867_1000553403 248
46 3300005467 Ga0070706_100074433 Ga0070706_1000744334 248
47 3300005467 Ga0070706_100207839 Ga0070706_1002078392 248
48 3300005468 Ga0070707_100025892 Ga0070707_1000258925 248
49 3300005468 Ga0070707_100079383 Ga0070707_1000793832 248
50 3300005468 Ga0070707_100368055 Ga0070707_1003680552 248
51 3300005468 Ga0070707_100773206 Ga0070707_1007732061 248
52 3300005471 Ga0070698_100013446 Ga0070698_1000134463 248
53 3300005471 Ga0070698_100457607 Ga0070698_1004576071 248
54 3300005518 Ga0070699_100232396 Ga0070699_1002323962 248
55 3300005518 Ga0070699_100527845 Ga0070699_1005278452 248
56 3300005536 Ga0070697_100029173 Ga0070697_1000291731 248
57 3300005536 Ga0070697_100041011 Ga0070697_1000410112 248
58 3300005539 Ga0068853_100223839 Ga0068853_1002238392 248
59 3300005548 Ga0070665_100141905 Ga0070665_1001419052 248
60 3300006028 Ga0070717_10224070 Ga0070717_102240702 248
61 3300006163 Ga0070715_10000006 Ga0070715_10000006187 248
62 3300006163 Ga0070715_10139455 Ga0070715_101394552 248
63 3300006175 Ga0070712_100068709 Ga0070712_1000687094 248
64 3300006237 Ga0097621_100042940 Ga0097621_1000429403 248
65 3300006358 Ga0068871_100019625 Ga0068871_1000196256 248
66 3300006844 Ga0075428_100176248 Ga0075428_1001762482 248
67 3300006844 Ga0075428_100350074 Ga0075428_1003500742 248
68 3300006847 Ga0075431_100511851 Ga0075431_1005118512 248
69 3300006852 Ga0075433_10149634 Ga0075433_101496342 248
70 3300006871 Ga0075434_100148548 Ga0075434_1001485483 248
71 3300006871 Ga0075434_100266922 Ga0075434_1002669222 248
72 3300006871 Ga0075434_100605327 Ga0075434_1006053272 248
73 3300006880 Ga0075429_100074349 Ga0075429_1000743494 248
74 3300006880 Ga0075429_100254574 Ga0075429_1002545741 248
75 3300006914 Ga0075436_100003639 Ga0075436_10000363916 248
76 3300006914 Ga0075436_100083332 Ga0075436_1000833323 248
77 3300006914 Ga0075436_100264677 Ga0075436_1002646772 248
78 3300007076 Ga0075435_100150293 Ga0075435_1001502932 248
79 3300007076 Ga0075435_100484440 Ga0075435_1004844401 248
80 3300007265 Ga0099794_10017352 Ga0099794_100173523 248
81 3300007265 Ga0099794_10027073 Ga0099794_100270731 248
82 3300007265 Ga0099794_10184267 Ga0099794_101842672 248
83 3300007788 Ga0099795_10000829 Ga0099795_100008296 248
84 3300009093 Ga0105240_10039922 Ga0105240_100399223 248
85 3300009147 Ga0114129_10019037 Ga0114129_100190372 248
86 3300009147 Ga0114129_10108081 Ga0114129_101080812 248
87 3300009147 Ga0114129_10194401 Ga0114129_101944011 248
88 3300009176 Ga0105242_10492110 Ga0105242_104921102 248
89 3300009545 Ga0105237_10155258 Ga0105237_101552583 248
90 3300010159 Ga0099796_10003616 Ga0099796_100036167 248
91 3300010159 Ga0099796_10050818 Ga0099796_100508181 248
92 3300010159 Ga0099796_10117688 Ga0099796_101176882 248
93 3300010375 Ga0105239_10091756 Ga0105239_100917563 248
94 3300013297 Ga0157378_10059731 Ga0157378_100597315 248
95 3300013306 Ga0163162_10002744 Ga0163162_100027449 248
96 3300013306 Ga0163162_10181007 Ga0163162_101810072 248
97 3300013306 Ga0163162_10599835 Ga0163162_105998352 248
98 3300014325 Ga0163163_10141010 Ga0163163_101410103 248
99 3300021361 Ga0213872_10003193 Ga0213872_100031938 248
100 3300021361 Ga0213872_10039436 Ga0213872_100394363 248
101 3300025294 Ga0209025_1000113 Ga0209025_1000113167 248
102 3300025294 Ga0209025_1000307 Ga0209025_100030773 248
103 3300025905 Ga0207685_10000010 Ga0207685_100000106 248
104 3300025905 Ga0207685_10136844 Ga0207685_101368442 248
105 3300025906 Ga0207699_10000006 Ga0207699_10000006305 248
106 3300025910 Ga0207684_10147294 Ga0207684_101472942 248
107 3300025914 Ga0207671_10003470 Ga0207671_100034708 248
108 3300025914 Ga0207671_10134436 Ga0207671_101344362 248
109 3300025915 Ga0207693_10009595 Ga0207693_100095958 248
110 3300025916 Ga0207663_10008256 Ga0207663_100082563 248
111 3300025922 Ga0207646_10047903 Ga0207646_100479036 248
112 3300025926 Ga0207659_10161634 Ga0207659_101616342 248
113 3300025929 Ga0207664_10304566 Ga0207664_103045661 248
114 3300025937 Ga0207669_10000072 Ga0207669_1000007235 248
115 3300025939 Ga0207665_10136342 Ga0207665_101363422 248
116 3300025961 Ga0207712_10015668 Ga0207712_100156685 248
117 3300026041 Ga0207639_10015173 Ga0207639_100151734 248
118 3300026041 Ga0207639_10191080 Ga0207639_101910802 248
119 3300026089 Ga0207648_10070734 Ga0207648_100707342 248
120 3300026089 Ga0207648_10287302 Ga0207648_102873022 248
121 3300026121 Ga0207683_10001519 Ga0207683_1000151912 248
122 3300028379 Ga0268266_10197838 Ga0268266_101978382 248
123 3300031239 Ga0265328_10016926 Ga0265328_100169261 248
124 3300031251 Ga0265327_10000776 Ga0265327_1000077611 248
125 3300031251 Ga0265327_10006581 Ga0265327_100065819 248
126 3300031456 Ga0307513_10077999 Ga0307513_100779994 248
127 3300031456 Ga0307513_10097643 Ga0307513_100976432 248
128 3300035170 Ga0373943_0050330 Ga0373943_0050330_35_781 248
129 3300035692 Ga0373935_0049681 Ga0373935_0049681_864_1610 248
130 3300035725 Ga0373947_0051537 Ga0373947_0051537_558_1304 248
131 3300039447 Ga0436361_0189207 Ga0436361_0189207_8331_9080 248
132 3300039447 Ga0436361_0298003 Ga0436361_0298003_8353_9102 248
133 3300039447 Ga0436361_0339448 Ga0436361_0339448_1191_1937 248
134 3300039447 Ga0436361_0593175 Ga0436361_0593175_4155_4913 248
135 3300039447 Ga0436361_1051731 Ga0436361_1051731_931_1677 248
136 3300046459 Ga0495629_0002205 Ga0495629_0002205_5347_6093 248
137 3300046461 Ga0495641_0010715 Ga0495641_0010715_1442_2188 248
138 3300046462 Ga0495651_0421855 Ga0495651_0421855_18_764 248
139 3300046472 Ga0495580_0139935 Ga0495580_0139935_723_1469 248
140 3300046473 Ga0495582_0019500 Ga0495582_0019500_2908_3654 248
141 3300046507 Ga0495606_0060762 Ga0495606_0060762_403_1149 248
142 3300046517 Ga0495630_0035034 Ga0495630_0035034_1539_2285 248
143 3300046524 Ga0495648_0026088 Ga0495648_0026088_1333_2079 248
144 3300046524 Ga0495648_0043388 Ga0495648_0043388_700_1446 248
145 3300046524 Ga0495648_0203722 Ga0495648_0203722_143_889 248
146 3300046526 Ga0495666_0003321 Ga0495666_0003321_3532_4278 248
147 3300046528 Ga0495642_0000614 Ga0495642_0000614_15082_15828 248
148 3300046531 Ga0495665_0160863 Ga0495665_0160863_199_945 248
149 3300046533 Ga0495640_0054653 Ga0495640_0054653_782_1528 248
150 3300046616 Ga0495668_0000006 Ga0495668_0000006_409104_409853 248
151 3300046616 Ga0495668_0001366 Ga0495668_0001366_22983_23729 248
152 3300046648 Ga0495611_0000881 Ga0495611_0000881_15305_16051 248
153 3300046648 Ga0495611_0003298 Ga0495611_0003298_4239_5150 248
154 3300046660 Ga0495625_0009637 Ga0495625_0009637_2382_3293 248
155 3300046678 Ga0495599_0005996 Ga0495599_0005996_4479_5225 248
156 3300046679 Ga0495623_0164481 Ga0495623_0164481_79_825 248
157 3300046690 Ga0495624_0156343 Ga0495624_0156343_494_1240 248
158 3300047315 Ga0495581_0100666 Ga0495581_0100666_763_1509 248
159 3300047318 Ga0495636_0031624 Ga0495636_0031624_83_865 248
160 3300047320 Ga0495672_0026639 Ga0495672_0026639_1659_2405 248
161 3300047320 Ga0495672_0030565 Ga0495672_0030565_461_1207 248
162 3300047320 Ga0495672_0035569 Ga0495672_0035569_73_855 248
163 3300047321 Ga0495676_0130641 Ga0495676_0130641_53_799 248
164 3300047322 Ga0495680_0194844 Ga0495680_0194844_671_1417 248
165 3300047443 Ga0495687_000136 Ga0495687_000136_35250_36161 248
166 3300047445 Ga0495677_0006040 Ga0495677_0006040_3605_4351 248
167 3300047446 Ga0495679_001090 Ga0495679_001090_1609_2355 248
168 3300047446 Ga0495679_012887 Ga0495679_012887_513_1259 248
169 3300047469 Ga0495673_0018698 Ga0495673_0018698_1117_1866 248
170 3300047471 Ga0495684_0154661 Ga0495684_0154661_75_821 248
171 3300047472 Ga0495686_0000670 Ga0495686_0000670_34375_35124 248
172 3300047472 Ga0495686_0022270 Ga0495686_0022270_457_1215 248
173 3300048924 Ga0496121_0000021 Ga0496121_0000021_62138_62893 248
174 3300048924 Ga0496121_0018037 Ga0496121_0018037_4641_5405 248
175 3300048929 Ga0496126_0000012 Ga0496126_0000012_112426_113172 248
176 3300048929 Ga0496126_0006819 Ga0496126_0006819_2147_2905 248
177 3300049459 Ga0495678_000216 Ga0495678_000216_27296_28042 248
178 3300049459 Ga0495678_045919 Ga0495678_045919_822_1571 248
179 3300049571 Ga0501034_0000124 Ga0501034_0000124_30325_31143 248
180 3300050507 nmdc:mga05p37_326366_c1 nmdc:mga05p37_326366_c1_157_903 248
181 3300050507 nmdc:mga05p37_87039_c1 nmdc:mga05p37_87039_c1_2511_3257 248
182 3300050507 nmdc:mga05p37_89434_c1 nmdc:mga05p37_89434_c1_1062_1808 248
183 3300050508 nmdc:mga09592_88505_c1 nmdc:mga09592_88505_c1_997_1743 248
184 3300050509 nmdc:mga0qj67_35067_c1 nmdc:mga0qj67_35067_c1_1659_2405 248
185 3300050510 nmdc:mga06r32_14693_c1 nmdc:mga06r32_14693_c1_1019_1765 248
186 3300050510 nmdc:mga06r32_213492_c1 nmdc:mga06r32_213492_c1_157_903 248
187 3300050510 nmdc:mga06r32_808584_c1 nmdc:mga06r32_808584_c1_98_844 248
188 3300050511 nmdc:mga08y16_256698_c1 nmdc:mga08y16_256698_c1_941_1687 248
189 3300050512 nmdc:mga0n895_114023_c1 nmdc:mga0n895_114023_c1_596_1342 248
190 3300050512 nmdc:mga0n895_207166_c1 nmdc:mga0n895_207166_c1_913_1659 248
191 3300050512 nmdc:mga0n895_362770_c1 nmdc:mga0n895_362770_c1_457_1203 248
192 3300050513 nmdc:mga0rr50_78435_c1 nmdc:mga0rr50_78435_c1_1031_1777 248
193 3300050514 nmdc:mga08x19_108232_c1 nmdc:mga08x19_108232_c1_37_783 248
194 3300050514 nmdc:mga08x19_151854_c1 nmdc:mga08x19_151854_c1_37_783 248
195 3300050514 nmdc:mga08x19_5356_c1 nmdc:mga08x19_5356_c1_5153_5899 248
196 3300053087 Ga0500643_000481 Ga0500643_000481_11500_12246 248
197 3300053092 Ga0500583_0000079 Ga0500583_0000079_51052_51963 248
198 3300053121 Ga0500607_091761 Ga0500607_091761_680_1510 248
199 3300053125 Ga0500618_000306 Ga0500618_000306_31725_32471 248
200 3300053139 Ga0500568_0026810 Ga0500568_0026810_26_808 248
201 3300053145 Ga0500586_001571 Ga0500586_001571_3661_4461 248
202 3300053150 Ga0500603_040372 Ga0500603_040372_188_934 248
203 3300053153 Ga0500616_0023718 Ga0500616_0023718_26_808 248
204 3300053177 Ga0500636_0180798 Ga0500636_0180798_118_864 248
205 3300053730 Ga0500645_001535 Ga0500645_001535_3800_4546 248
206 3300053737 Ga0500601_004167 Ga0500601_004167_623_1369 248
207 iso_pu_bacteria 2841911363 2841914140 248
208 iso_pu_bacteria 2841917233 2841919631 248
209 iso_pu_bacteria 2903748898 2903754382 248
210 iso_pu_bacteria 2935959822 2935960795 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

61

254

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

67

301

0.96

PF08659

KR

KR domain

61

242

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

63

284

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9773 3 248
5k9z-assembly2.cif.gz_D crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 0.972 4 248
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9712 3 244
5h5x-assembly3.cif.gz_I crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor 0.9699 3 248
2cdh-assembly1.cif.gz_G architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9699 4 245
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9773 3 248 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.973 4 246 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 3 248 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9689 1 247 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 4 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W8P7L1-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9894 1 248 GO:0016491
AF-A0A1M5PN43-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9874 1 248 GO:0016491
AF-A0A7W8P7L1-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9854 1 248 GO:0016491
AF-A0A2V8C846-F1-model_v4 SDR family oxidoreductase 0.9839 37 248 GO:0016491
AF-A0A5W0B9N7-F1-model_v4 SDR family oxidoreductase 0.9827 1 245 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map