F320545

General Info

Members Datasets Scaffolds Average Seq Length
210 147 420 214

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10180420|Ga0307413_101804202
Length 235
Sequence VYCNSNTAVRQSAHRPWGEMTEHNFEQMRRAMVASQLRTTGVSDHRVIAAMGAVPRERFVPGELVSAAYADALVPLGHGRSLNSPMSLGRMLTEAHLKGDERALVIGAATGYAAAVVARLAASVVALEEQAELAAAARDALAETGVAVAVGPLAAGHAAGAPYDFILIDGAVEYVPQPIIDQLGDGGELAAAILDNGVPRLSIGRVVGGAFGAVAYADAAAPVLPGFQKPRGFSF

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
135 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
136 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
145 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.57
Nodule 0
Rhizoplane 2.38
Rhizosphere 81.43
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10180420 3300031824 Bacteria 1505
2 JGI24736J21556_1000014 3300001904 Bacteria 29181
3 JGI24741J21665_1005778 3300001915 Bacteria 2544
4 JGI24752J21851_1000141 3300001976 Bacteria 9701
5 JGI24740J21852_10010882 3300001979 Bacteria 3482
6 JGI24739J22299_10057566 3300001989 Bacteria 1237
7 JGI24737J22298_10021966 3300001990 Bacteria 2029
8 JGI24750J21931_1000017 3300002070 Bacteria 20816
9 JGI24748J21848_1000030 3300002074 Bacteria 85078
10 JGI24738J21930_10007309 3300002075 Bacteria 2556
11 JGI24034J26672_10000014 3300002239 Bacteria 139881
12 JGI24034J26672_10000046 3300002239 Bacteria 63764
13 Ga0065707_10082875 3300005295 Bacteria 11637
14 Ga0070658_10141124 3300005327 Unclassified 2013
15 Ga0070676_10004433 3300005328 Bacteria 7385
16 Ga0070676_10102389 3300005328 Bacteria 1771
17 Ga0070683_100393998 3300005329 Unclassified 1320
18 Ga0070690_100000004 3300005330 Bacteria 144000
19 Ga0070677_10000529 3300005333 Bacteria 13075
20 Ga0070666_10000011 3300005335 Bacteria 261736
21 Ga0070660_100000955 3300005339 Bacteria 19335
22 Ga0070660_100206697 3300005339 Bacteria 1593
23 Ga0070689_100001395 3300005340 Bacteria 15390
24 Ga0070661_100096808 3300005344 Unclassified 2190
25 Ga0070668_100020526 3300005347 Bacteria 4987
26 Ga0070669_100000123 3300005353 Bacteria 71501
27 Ga0070669_100043951 3300005353 Bacteria 3255
28 Ga0070669_100356151 3300005353 Bacteria 1189
29 Ga0070669_100465502 3300005353 Bacteria 1044
30 Ga0070671_100058586 3300005355 Bacteria 3206
31 Ga0070673_100439700 3300005364 Bacteria 1172
32 Ga0070688_100004164 3300005365 Bacteria 7506
33 Ga0070659_100007935 3300005366 Bacteria 7734
34 Ga0070659_100568921 3300005366 Unclassified 971
35 Ga0070667_100079618 3300005367 Bacteria 2801
36 Ga0070701_10073167 3300005438 Bacteria 1837
37 Ga0070663_100154824 3300005455 Bacteria 1760
38 Ga0070663_100430019 3300005455 Bacteria 1084
39 Ga0070662_100166560 3300005457 Unclassified 1727
40 Ga0070662_100184999 3300005457 Bacteria 1644
41 Ga0070662_100281931 3300005457 Bacteria 1345
42 Ga0070685_10000088 3300005466 Bacteria 56320
43 Ga0070684_100578164 3300005535 Bacteria 1044
44 Ga0068853_100621986 3300005539 Bacteria 1026
45 Ga0070672_100186587 3300005543 Bacteria 1730
46 Ga0070672_100369749 3300005543 Bacteria 1225
47 Ga0070686_100000001 3300005544 Bacteria 515830
48 Ga0070686_100000387 3300005544 Bacteria 28114
49 Ga0070665_100000004 3300005548 Bacteria 785500
50 Ga0070665_100000528 3300005548 Bacteria 53961
51 Ga0070665_100000531 3300005548 Bacteria 53926
52 Ga0070665_100356858 3300005548 Bacteria 1468
53 Ga0068855_100632182 3300005563 Unclassified 1151
54 Ga0068856_100254418 3300005614 Unclassified 1771
55 Ga0068852_100125758 3300005616 Bacteria 2354
56 Ga0068852_100240652 3300005616 Bacteria 1729
57 Ga0068852_100476682 3300005616 Unclassified 1239
58 Ga0068864_100015454 3300005618 Bacteria 6347
59 Ga0068861_100014195 3300005719 Bacteria 5587
60 Ga0068861_100073689 3300005719 Bacteria 2653
61 Ga0068851_10050932 3300005834 Unclassified 2103
62 Ga0068863_100000046 3300005841 Bacteria 143895
63 Ga0068863_100031474 3300005841 Bacteria 5061
64 Ga0068858_100017034 3300005842 Bacteria 6821
65 Ga0068860_100000030 3300005843 Bacteria 256364
66 Ga0068862_100001162 3300005844 Bacteria 24826
67 Ga0105240_10563207 3300009093 Unclassified 1259
68 Ga0105240_10587531 3300009093 Unclassified 1228
69 Ga0105240_10691754 3300009093 Bacteria 1114
70 Ga0105241_10171529 3300009174 Unclassified 1792
71 Ga0105241_10291437 3300009174 Bacteria 1397
72 Ga0105248_10552265 3300009177 Bacteria 1299
73 Ga0105248_10552266 3300009177 Bacteria 1299
74 Ga0105237_10249434 3300009545 Bacteria 1777
75 Ga0105237_10857436 3300009545 Unclassified 915
76 Ga0105238_10408904 3300009551 Bacteria 1351
77 Ga0105238_10549995 3300009551 Bacteria 1158
78 Ga0105249_10000016 3300009553 Bacteria 278643
79 Ga0105249_10556327 3300009553 Bacteria 1198
80 Ga0105239_10666722 3300010375 Unclassified 1188
81 Ga0157373_10050781 3300013100 Bacteria 2953
82 Ga0157370_10010493 3300013104 Bacteria 9757
83 Ga0157369_10064084 3300013105 Bacteria 3958
84 Ga0157378_10920318 3300013297 Bacteria 906
85 Ga0157372_10245549 3300013307 Bacteria 2078
86 Ga0157372_10618317 3300013307 Bacteria 1262
87 Ga0163163_10093774 3300014325 Bacteria 3019
88 Ga0157380_10000440 3300014326 Bacteria 25347
89 Ga0157380_10012016 3300014326 Bacteria 6265
90 Ga0157379_10064685 3300014968 Bacteria 3268
91 Ga0163161_10000037 3300017792 Bacteria 150124
92 Ga0213876_10000617 3300021384 Bacteria 26182
93 Ga0213876_10006501 3300021384 Bacteria 6371
94 Ga0207672_1000453 3300025223 Bacteria 5236
95 Ga0207656_10020853 3300025321 Bacteria 2609
96 Ga0207682_10001357 3300025893 Bacteria 11303
97 Ga0207680_10000008 3300025903 Bacteria 518177
98 Ga0207647_10000301 3300025904 Bacteria 40628
99 Ga0207705_10000002 3300025909 Bacteria 2046852
100 Ga0207705_10178309 3300025909 Bacteria 1602
101 Ga0207654_10042594 3300025911 Bacteria 2571
102 Ga0207695_10001633 3300025913 Bacteria 36237
103 Ga0207671_10000765 3300025914 Bacteria 40821
104 Ga0207657_10080762 3300025919 Bacteria 2733
105 Ga0207657_10082238 3300025919 Bacteria 2703
106 Ga0207657_10377677 3300025919 Bacteria 1116
107 Ga0207649_10079853 3300025920 Unclassified 2114
108 Ga0207681_10000038 3300025923 Bacteria 153694
109 Ga0207681_10234075 3300025923 Bacteria 1427
110 Ga0207681_10369590 3300025923 Unclassified 1152
111 Ga0207694_10003304 3300025924 Bacteria 12831
112 Ga0207690_10004958 3300025932 Bacteria 7857
113 Ga0207690_10368368 3300025932 Bacteria 1139
114 Ga0207706_10017495 3300025933 Bacteria 6462
115 Ga0207706_10183317 3300025933 Bacteria 1839
116 Ga0207691_10233703 3300025940 Bacteria 1591
117 Ga0207711_10057140 3300025941 Bacteria 3354
118 Ga0207661_10371077 3300025944 Unclassified 1294
119 Ga0207667_10000716 3300025949 Bacteria 43016
120 Ga0207667_10371690 3300025949 Unclassified 1457
121 Ga0207651_10619076 3300025960 Bacteria 948
122 Ga0207712_10000009 3300025961 Bacteria 518177
123 Ga0207668_10013424 3300025972 Bacteria 5044
124 Ga0207640_10466406 3300025981 Unclassified 1044
125 Ga0207658_10000778 3300025986 Bacteria 27254
126 Ga0207703_10000210 3300026035 Bacteria 68170
127 Ga0207639_10077318 3300026041 Bacteria 2623
128 Ga0207639_11156962 3300026041 Bacteria 726
129 Ga0207678_10013231 3300026067 Bacteria 7240
130 Ga0207678_10426438 3300026067 Bacteria 1150
131 Ga0207702_10000727 3300026078 Bacteria 35312
132 Ga0207641_10000145 3300026088 Bacteria 100817
133 Ga0207641_10008862 3300026088 Bacteria 8308
134 Ga0207676_10001901 3300026095 Bacteria 15247
135 Ga0207675_100006730 3300026118 Bacteria 10869
136 Ga0207675_100125468 3300026118 Bacteria 2431
137 Ga0207675_100544946 3300026118 Bacteria 1159
138 Ga0207698_10022340 3300026142 Bacteria 4394
139 Ga0207698_10140075 3300026142 Bacteria 2082
140 Ga0207698_10691238 3300026142 Unclassified 1014
141 Ga0207698_10795679 3300026142 Bacteria 947
142 Ga0268266_10000009 3300028379 Bacteria 1097737
143 Ga0268266_10000187 3300028379 Bacteria 110229
144 Ga0268266_10000910 3300028379 Bacteria 38152
145 Ga0268265_10000488 3300028380 Bacteria 41437
146 Ga0268265_10213656 3300028380 Bacteria 1683
147 Ga0268264_10000003 3300028381 Bacteria 1141976
148 Ga0268264_10561885 3300028381 Bacteria 1120
149 Ga0307406_10156214 3300031901 Bacteria 1634
150 Ga0307409_100367381 3300031995 Bacteria 1363
151 Ga0307414_10681091 3300032004 Bacteria 929
152 Ga0307414_10710140 3300032004 Unclassified 911
153 Ga0307411_10037389 3300032005 Bacteria 3052
154 Ga0307411_11059118 3300032005 Bacteria 729
155 Ga0307415_100225174 3300032126 Unclassified 1506
156 Ga0373947_0076830 3300035725 Bacteria 2059
157 Ga0436365_1161979 3300039437 Bacteria 35526
158 Ga0436365_1282444 3300039437 Bacteria 9358
159 Ga0439443_003392 3300042003 Bacteria 2004
160 Ga0495638_0081600 3300046460 Bacteria 1963
161 Ga0495583_0000038 3300046506 Bacteria 243395
162 Ga0495606_0001950 3300046507 Bacteria 25500
163 Ga0495637_0032246 3300046520 Bacteria 2310
164 Ga0495643_0115540 3300046522 Bacteria 1360
165 Ga0495663_0007386 3300046525 Bacteria 3037
166 Ga0495668_0036010 3300046616 Bacteria 2774
167 Ga0495625_0173955 3300046660 Unclassified 1436
168 Ga0495661_0060975 3300046665 Bacteria 2240
169 Ga0495670_0046626 3300046691 Bacteria 2165
170 Ga0495673_0044306 3300047469 Bacteria 1985
171 Ga0495686_0000280 3300047472 Bacteria 90032
172 Ga0495686_0006613 3300047472 Bacteria 8835
173 Ga0495686_0039077 3300047472 Unclassified 3033
174 Ga0496101_0090081 3300048904 Bacteria 2281
175 Ga0496102_0110230 3300048905 Unclassified 2565
176 Ga0496103_0271716 3300048906 Bacteria 1090
177 Ga0496107_0114761 3300048910 Bacteria 1982
178 Ga0496111_0524454 3300048914 Eukaryota 871
179 Ga0496117_0009103 3300048920 Bacteria 9328
180 Ga0496118_0122878 3300048921 Unclassified 1687
181 Ga0496118_0168280 3300048921 Bacteria 1343
182 Ga0496118_0264706 3300048921 Bacteria 967
183 Ga0496121_0207234 3300048924 Unclassified 1392
184 Ga0496122_0046438 3300048925 Bacteria 3363
185 Ga0496123_0004859 3300048926 Bacteria 13837
186 Ga0496123_0230192 3300048926 Bacteria 928
187 Ga0496124_0010130 3300048927 Bacteria 9595
188 Ga0496124_0307111 3300048927 Bacteria 1143
189 Ga0496125_0185784 3300048928 Bacteria 1379
190 Ga0496126_0497162 3300048929 Bacteria 975
191 Ga0501071_0102553 3300049587 Bacteria 2110
192 Ga0500647_0010311 3300053091 Unclassified 4130
193 Ga0500555_000071 3300053103 Bacteria 50369
194 Ga0500555_004781 3300053103 Bacteria 3844
195 Ga0500608_041476 3300053122 Bacteria 2208
196 Ga0500618_003124 3300053125 Bacteria 5833
197 Ga0500658_0036018 3300053134 Bacteria 1962
198 Ga0500568_0007071 3300053139 Bacteria 5545
199 Ga0500577_0125365 3300053142 Bacteria 1072
200 Ga0500604_0000003 3300053151 Bacteria 148800
201 Ga0500604_0075193 3300053151 Unclassified 1083
202 Ga0500616_0000087 3300053153 Bacteria 192225
203 Ga0500616_0008118 3300053153 Bacteria 6565
204 Ga0500616_0066678 3300053153 Unclassified 1847
205 Ga0500627_0033065 3300053158 Bacteria 2183
206 Ga0500627_0194087 3300053158 Bacteria 911
207 Ga0500636_0150940 3300053177 Bacteria 1276
208 Ga0500611_034459 3300053727 Bacteria 1072
209 Ga0500645_014752 3300053730 Bacteria 2486
210 Ga0501082_0276042 3300060353 Bacteria 1463
211 Ga0307413_10180420
212 JGI24736J21556_1000014
213 JGI24741J21665_1005778
214 JGI24752J21851_1000141
215 JGI24740J21852_10010882
216 JGI24739J22299_10057566
217 JGI24737J22298_10021966
218 JGI24750J21931_1000017
219 JGI24748J21848_1000030
220 JGI24738J21930_10007309
221 JGI24034J26672_10000014
222 JGI24034J26672_10000046
223 Ga0065707_10082875
224 Ga0070658_10141124
225 Ga0070676_10004433
226 Ga0070676_10102389
227 Ga0070683_100393998
228 Ga0070690_100000004
229 Ga0070677_10000529
230 Ga0070666_10000011
231 Ga0070660_100000955
232 Ga0070660_100206697
233 Ga0070689_100001395
234 Ga0070661_100096808
235 Ga0070668_100020526
236 Ga0070669_100000123
237 Ga0070669_100043951
238 Ga0070669_100356151
239 Ga0070669_100465502
240 Ga0070671_100058586
241 Ga0070673_100439700
242 Ga0070688_100004164
243 Ga0070659_100007935
244 Ga0070659_100568921
245 Ga0070667_100079618
246 Ga0070701_10073167
247 Ga0070663_100154824
248 Ga0070663_100430019
249 Ga0070662_100166560
250 Ga0070662_100184999
251 Ga0070662_100281931
252 Ga0070685_10000088
253 Ga0070684_100578164
254 Ga0068853_100621986
255 Ga0070672_100186587
256 Ga0070672_100369749
257 Ga0070686_100000001
258 Ga0070686_100000387
259 Ga0070665_100000004
260 Ga0070665_100000528
261 Ga0070665_100000531
262 Ga0070665_100356858
263 Ga0068855_100632182
264 Ga0068856_100254418
265 Ga0068852_100125758
266 Ga0068852_100240652
267 Ga0068852_100476682
268 Ga0068864_100015454
269 Ga0068861_100014195
270 Ga0068861_100073689
271 Ga0068851_10050932
272 Ga0068863_100000046
273 Ga0068863_100031474
274 Ga0068858_100017034
275 Ga0068860_100000030
276 Ga0068862_100001162
277 Ga0105240_10563207
278 Ga0105240_10587531
279 Ga0105240_10691754
280 Ga0105241_10171529
281 Ga0105241_10291437
282 Ga0105248_10552265
283 Ga0105248_10552266
284 Ga0105237_10249434
285 Ga0105237_10857436
286 Ga0105238_10408904
287 Ga0105238_10549995
288 Ga0105249_10000016
289 Ga0105249_10556327
290 Ga0105239_10666722
291 Ga0157373_10050781
292 Ga0157370_10010493
293 Ga0157369_10064084
294 Ga0157378_10920318
295 Ga0157372_10245549
296 Ga0157372_10618317
297 Ga0163163_10093774
298 Ga0157380_10000440
299 Ga0157380_10012016
300 Ga0157379_10064685
301 Ga0163161_10000037
302 Ga0213876_10000617
303 Ga0213876_10006501
304 Ga0207672_1000453
305 Ga0207656_10020853
306 Ga0207682_10001357
307 Ga0207680_10000008
308 Ga0207647_10000301
309 Ga0207705_10000002
310 Ga0207705_10178309
311 Ga0207654_10042594
312 Ga0207695_10001633
313 Ga0207671_10000765
314 Ga0207657_10080762
315 Ga0207657_10082238
316 Ga0207657_10377677
317 Ga0207649_10079853
318 Ga0207681_10000038
319 Ga0207681_10234075
320 Ga0207681_10369590
321 Ga0207694_10003304
322 Ga0207690_10004958
323 Ga0207690_10368368
324 Ga0207706_10017495
325 Ga0207706_10183317
326 Ga0207691_10233703
327 Ga0207711_10057140
328 Ga0207661_10371077
329 Ga0207667_10000716
330 Ga0207667_10371690
331 Ga0207651_10619076
332 Ga0207712_10000009
333 Ga0207668_10013424
334 Ga0207640_10466406
335 Ga0207658_10000778
336 Ga0207703_10000210
337 Ga0207639_10077318
338 Ga0207639_11156962
339 Ga0207678_10013231
340 Ga0207678_10426438
341 Ga0207702_10000727
342 Ga0207641_10000145
343 Ga0207641_10008862
344 Ga0207676_10001901
345 Ga0207675_100006730
346 Ga0207675_100125468
347 Ga0207675_100544946
348 Ga0207698_10022340
349 Ga0207698_10140075
350 Ga0207698_10691238
351 Ga0207698_10795679
352 Ga0268266_10000009
353 Ga0268266_10000187
354 Ga0268266_10000910
355 Ga0268265_10000488
356 Ga0268265_10213656
357 Ga0268264_10000003
358 Ga0268264_10561885
359 Ga0307406_10156214
360 Ga0307409_100367381
361 Ga0307414_10681091
362 Ga0307414_10710140
363 Ga0307411_10037389
364 Ga0307411_11059118
365 Ga0307415_100225174
366 Ga0373947_0076830
367 Ga0436365_1161979
368 Ga0436365_1282444
369 Ga0439443_003392
370 Ga0495638_0081600
371 Ga0495583_0000038
372 Ga0495606_0001950
373 Ga0495637_0032246
374 Ga0495643_0115540
375 Ga0495663_0007386
376 Ga0495668_0036010
377 Ga0495625_0173955
378 Ga0495661_0060975
379 Ga0495670_0046626
380 Ga0495673_0044306
381 Ga0495686_0000280
382 Ga0495686_0006613
383 Ga0495686_0039077
384 Ga0496101_0090081
385 Ga0496102_0110230
386 Ga0496103_0271716
387 Ga0496107_0114761
388 Ga0496111_0524454
389 Ga0496117_0009103
390 Ga0496118_0122878
391 Ga0496118_0168280
392 Ga0496118_0264706
393 Ga0496121_0207234
394 Ga0496122_0046438
395 Ga0496123_0004859
396 Ga0496123_0230192
397 Ga0496124_0010130
398 Ga0496124_0307111
399 Ga0496125_0185784
400 Ga0496126_0497162
401 Ga0501071_0102553
402 Ga0500647_0010311
403 Ga0500555_000071
404 Ga0500555_004781
405 Ga0500608_041476
406 Ga0500618_003124
407 Ga0500658_0036018
408 Ga0500568_0007071
409 Ga0500577_0125365
410 Ga0500604_0000003
411 Ga0500604_0075193
412 Ga0500616_0000087
413 Ga0500616_0008118
414 Ga0500616_0066678
415 Ga0500627_0033065
416 Ga0500627_0194087
417 Ga0500636_0150940
418 Ga0500611_034459
419 Ga0500645_014752
420 Ga0501082_0276042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

28

202

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.9401 8 205
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.9254 7 207
3lbf-assembly3.cif.gz_C crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9212 10 205
3lbf-assembly4.cif.gz_D crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9079 8 205
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.9073 3 209
ID Description Score Start End Superfamily
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9401 8 205 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9073 3 209 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8968 8 205 3.40.50.150
af_Q8IHR1_96_382_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8946 82 120 3.40.50.150
4l7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8783 8 209 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D0RCZ6-F1-model_v4 Protein-L-isoaspartate O-methyltransferase 0.9958 14 114 GO:0008168
GO:0032259
AF-A0A383C8Z7-F1-model_v4 protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) 0.9829 6 107 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A520ICQ8-F1-model_v4 Uncharacterized protein 0.9819 4 98
AF-A0A523S1Q4-F1-model_v4 protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC 2.1.1.77) 0.9773 6 110 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A3D2GPL1-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (Protein L-isoaspartyl methyltransferase) 0.9765 5 189 GO:0004719
GO:0005737
GO:0032259
GO:0036211

Map