F320606

General Info

Members Datasets Scaffolds Average Seq Length
210 76 410 339

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0017865|Ga0316584_0017865_1913_3052
Length 379
Sequence MNINFAMWRKALAELIKMDDKKEWNSLDVISKWLIATRSAVTSVTLYSCAIAGLLAWRDGVFAWLPWIILTLGLFIAHGTNNLLNDYTDFSRGVDKDNYFRTQYGVHPLVQNFWTKRQQIQWFIVSGIVAFLSGVFALFYTGFNSTVIGLFVFGALLLLFYTWPLKYWALGELAIFLVWGPIMIAGVYFVLAAGKNGDFSNLWNVALAGVPFGLSVVSINFSKHIDKINDDKKKGVGTFPVRVGQTFARVINIIVFVLIYAIIIYLVVDGYFSTFVLLTIFALQRAFYAVAVLSKPRPDGPPEGFEAFWPTWFSGFSFYHNRLFGNLFILGVLLDTIFRKLPASSLPLSINWLGVVALGVGAIIAVVRYMQAKAKKATA

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
68 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
69 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
70 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
71 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
76 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 24.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0017865 3300036712 Bacteria 5109
2 SwRhRL2b_contig_23942 2162886007 Bacteria 6658
3 Ga0065704_10070900 3300005289 Bacteria 14813
4 Ga0065704_10085569 3300005289 Unclassified 3209
5 Ga0065712_10140226 3300005290 Bacteria 1457
6 Ga0065707_10000613 3300005295 Bacteria 16408
7 Ga0065707_10000645 3300005295 Bacteria 23027
8 Ga0065707_10091672 3300005295 Bacteria 3898
9 Ga0070705_100148681 3300005440 Unclassified 1551
10 Ga0070708_100094566 3300005445 Bacteria 2727
11 Ga0070706_100023527 3300005467 Bacteria 5674
12 Ga0070706_100054764 3300005467 Bacteria 3682
13 Ga0070706_100253508 3300005467 Unclassified 1643
14 Ga0070707_100080821 3300005468 Bacteria 3138
15 Ga0070707_100111187 3300005468 Bacteria 2657
16 Ga0070698_100050998 3300005471 Unclassified 4216
17 Ga0070698_100051018 3300005471 Bacteria 4215
18 Ga0070698_100069054 3300005471 Bacteria 3549
19 Ga0070698_100348424 3300005471 Bacteria 1412
20 Ga0070699_100008006 3300005518 Bacteria 9176
21 Ga0070699_100008686 3300005518 Bacteria 8806
22 Ga0070699_100117029 3300005518 Bacteria 2343
23 Ga0070699_100156313 3300005518 Bacteria 2018
24 Ga0070699_100192859 3300005518 Bacteria 1810
25 Ga0070699_100290608 3300005518 Unclassified 1466
26 Ga0070695_100070333 3300005545 Unclassified 2289
27 Ga0070696_100197572 3300005546 Bacteria 1500
28 Ga0070665_100075263 3300005548 Bacteria 3383
29 Ga0070704_100021861 3300005549 Unclassified 4154
30 Ga0070704_100095566 3300005549 Bacteria 2226
31 Ga0070704_100150884 3300005549 Bacteria 1827
32 Ga0068857_100294569 3300005577 Unclassified 1495
33 Ga0068862_100045931 3300005844 Bacteria 3728
34 Ga0068862_100088813 3300005844 Bacteria 2690
35 Ga0081539_10008656 3300005985 Bacteria 8769
36 Ga0081539_10010015 3300005985 Bacteria 7804
37 Ga0075427_10001735 3300006194 Bacteria 2838
38 Ga0075427_10004345 3300006194 Bacteria 1984
39 Ga0075428_100125819 3300006844 Bacteria 2789
40 Ga0075428_100197633 3300006844 Unclassified 2175
41 Ga0075428_100644053 3300006844 Unclassified 1130
42 Ga0075430_100167069 3300006846 Bacteria 1831
43 Ga0075431_100008492 3300006847 Bacteria 10286
44 Ga0075431_100076152 3300006847 Bacteria 3462
45 Ga0075431_100409112 3300006847 Bacteria 1357
46 Ga0075433_10022704 3300006852 Bacteria 5271
47 Ga0075433_10092733 3300006852 Bacteria 2671
48 Ga0075434_100585249 3300006871 Unclassified 1135
49 Ga0075429_100007282 3300006880 Bacteria 9602
50 Ga0075429_100007422 3300006880 Bacteria 9514
51 Ga0075429_100080095 3300006880 Bacteria 2847
52 Ga0075429_100082493 3300006880 Bacteria 2802
53 Ga0097620_100128789 3300006931 Bacteria 2602
54 Ga0111539_10395021 3300009094 Bacteria 1611
55 Ga0111539_10536930 3300009094 Bacteria 1362
56 Ga0105245_10207860 3300009098 Unclassified 1883
57 Ga0114129_10003339 3300009147 Bacteria 22542
58 Ga0114129_10009378 3300009147 Bacteria 13951
59 Ga0114129_10018644 3300009147 Bacteria 9879
60 Ga0114129_10027647 3300009147 Bacteria 8031
61 Ga0114129_10047573 3300009147 Bacteria 6027
62 Ga0114129_10067268 3300009147 Unclassified 4998
63 Ga0114129_10227729 3300009147 Bacteria 2511
64 Ga0114129_10329578 3300009147 Bacteria 2027
65 Ga0105243_10018466 3300009148 Bacteria 5283
66 Ga0105243_10049548 3300009148 Unclassified 3314
67 Ga0105243_10252575 3300009148 Bacteria 1575
68 Ga0105249_10093690 3300009553 Bacteria 2814
69 Ga0105249_10115210 3300009553 Bacteria 2546
70 Ga0105249_10278155 3300009553 Bacteria 1670
71 Ga0105249_10459709 3300009553 Bacteria 1313
72 Ga0105246_10046186 3300011119 Bacteria 2969
73 Ga0207684_10042624 3300025910 Bacteria 3848
74 Ga0207646_10061968 3300025922 Bacteria 3339
75 Ga0207646_10227955 3300025922 Bacteria 1683
76 Ga0207709_10027669 3300025935 Unclassified 3269
77 Ga0207709_10138635 3300025935 Bacteria 1669
78 Ga0207709_10306354 3300025935 Bacteria 1183
79 Ga0207712_10100632 3300025961 Bacteria 2148
80 Ga0207674_10210876 3300026116 Unclassified 1891
81 Ga0207674_10321898 3300026116 Unclassified 1496
82 Ga0207675_100044542 3300026118 Bacteria 4147
83 Ga0268266_10243314 3300028379 Archaea 1661
84 Ga0268265_10054165 3300028380 Bacteria 3042
85 Ga0268265_10521662 3300028380 Bacteria 1123
86 Ga0265334_10018910 3300028573 Unclassified 2840
87 Ga0265318_10007388 3300028577 Bacteria 4971
88 Ga0265318_10031641 3300028577 Bacteria 2051
89 Ga0265338_10112692 3300028800 Unclassified 2186
90 Ga0265330_10045811 3300031235 Bacteria 1928
91 Ga0265332_10096595 3300031238 Unclassified 1248
92 Ga0265320_10003174 3300031240 Bacteria 11146
93 Ga0265329_10007543 3300031242 Unclassified 4198
94 Ga0265340_10059165 3300031247 Unclassified 1838
95 Ga0265316_10000466 3300031344 Bacteria 46064
96 Ga0265316_10123231 3300031344 Unclassified 1956
97 Ga0265316_10137264 3300031344 Unclassified 1839
98 Ga0316575_10025113 3300031665 Bacteria 2309
99 Ga0316575_10045851 3300031665 Bacteria 1736
100 Ga0316579_10003802 3300031691 Bacteria 5944
101 Ga0316579_10043184 3300031691 Unclassified 2096
102 Ga0265342_10010256 3300031712 Bacteria 6521
103 Ga0265342_10028459 3300031712 Bacteria 3481
104 Ga0316576_10047222 3300031727 Bacteria 3119
105 Ga0316576_10164814 3300031727 Unclassified 1672
106 Ga0316576_10251830 3300031727 Bacteria 1326
107 Ga0316578_10126951 3300031728 Unclassified 1534
108 Ga0316577_10033683 3300031733 Bacteria 2862
109 Ga0316577_10034965 3300031733 Bacteria 2808
110 Ga0307407_10019948 3300031903 Bacteria 3423
111 Ga0307407_10098111 3300031903 Unclassified 1812
112 Ga0307409_100048155 3300031995 Unclassified 3241
113 Ga0307409_100136168 3300031995 Bacteria 2108
114 Ga0307416_100165242 3300032002 Unclassified 2052
115 Ga0307416_100170857 3300032002 Unclassified 2023
116 Ga0307411_10068225 3300032005 Bacteria 2396
117 Ga0316574_0005339 3300035398 Bacteria 6845
118 Ga0316574_0006894 3300035398 Bacteria 6182
119 Ga0316574_0096612 3300035398 Unclassified 1888
120 Ga0316574_0141842 3300035398 Bacteria 1548
121 Ga0316582_0111625 3300036647 Unclassified 1820
122 Ga0316582_0136953 3300036647 Bacteria 1648
123 Ga0316584_0003171 3300036712 Bacteria 10628
124 Ga0316584_0003756 3300036712 Bacteria 9944
125 Ga0316584_0093351 3300036712 Unclassified 2253
126 Ga0451577_0014043 3300042876 Bacteria 7473
127 Ga0451577_0019458 3300042876 Bacteria 6242
128 Ga0451577_0024147 3300042876 Bacteria 5532
129 Ga0451577_0127148 3300042876 Bacteria 2284
130 Ga0451577_0154261 3300042876 Bacteria 2066
131 Ga0453683_0001151 3300044673 Bacteria 24005
132 Ga0453683_0004133 3300044673 Bacteria 10421
133 Ga0453683_0009171 3300044673 Bacteria 6608
134 Ga0453683_0013294 3300044673 Bacteria 5379
135 Ga0453683_0078134 3300044673 Bacteria 2072
136 Ga0453683_0148746 3300044673 Unclassified 1479
137 Ga0453684_0000003 3300044712 Bacteria 1481694
138 Ga0453684_0000271 3300044712 Bacteria 223654
139 Ga0453684_0000420 3300044712 Bacteria 172995
140 Ga0453684_0000458 3300044712 Bacteria 163146
141 Ga0453684_0000666 3300044712 Bacteria 122914
142 Ga0453684_0002193 3300044712 Bacteria 48647
143 Ga0453684_0006953 3300044712 Bacteria 21178
144 Ga0453684_0012350 3300044712 Bacteria 14118
145 Ga0453684_0020550 3300044712 Bacteria 9947
146 Ga0453684_0026779 3300044712 Bacteria 8307
147 Ga0453684_0032802 3300044712 Bacteria 7256
148 Ga0453684_0040018 3300044712 Bacteria 6375
149 Ga0453684_0041447 3300044712 Bacteria 6227
150 Ga0453684_0048493 3300044712 Bacteria 5615
151 Ga0453684_0063849 3300044712 Bacteria 4707
152 Ga0453684_0065642 3300044712 Bacteria 4627
153 Ga0453684_0077007 3300044712 Bacteria 4184
154 Ga0453684_0078939 3300044712 Bacteria 4116
155 Ga0453684_0106797 3300044712 Bacteria 3411
156 Ga0453684_0127938 3300044712 Bacteria 3053
157 Ga0453684_0147811 3300044712 Bacteria 2797
158 Ga0453684_0150317 3300044712 Bacteria 2768
159 Ga0453684_0167304 3300044712 Bacteria 2595
160 Ga0453684_0198009 3300044712 Bacteria 2344
161 Ga0453684_0209930 3300044712 Unclassified 2264
162 Ga0453684_0292448 3300044712 Bacteria 1854
163 Ga0453684_0299244 3300044712 Bacteria 1829
164 Ga0453684_0305436 3300044712 Unclassified 1807
165 Ga0453684_0423319 3300044712 Unclassified 1487
166 Ga0453684_0498941 3300044712 Bacteria 1348
167 Ga0453684_0499948 3300044712 Unclassified 1346
168 Ga0453684_0585599 3300044712 Bacteria 1225
169 Ga0453684_0620606 3300044712 Unclassified 1183
170 Ga0451576_0000142 3300045051 Bacteria 181506
171 Ga0451576_0002880 3300045051 Bacteria 24607
172 Ga0451576_0007027 3300045051 Bacteria 13609
173 Ga0451576_0016899 3300045051 Bacteria 8038
174 Ga0451576_0138021 3300045051 Unclassified 2543
175 Ga0451576_0339279 3300045051 Bacteria 1573
176 Ga0451576_0803993 3300045051 Unclassified 987
177 Ga0495594_0069578 3300046499 Bacteria 1955
178 Ga0501075_0020042 3300049591 Bacteria 4857
179 Ga0501075_0045323 3300049591 Bacteria 3301
180 Ga0501075_0068935 3300049591 Unclassified 2673
181 Ga0501076_0119184 3300049592 Bacteria 2137
182 Ga0501079_0155780 3300049741 Unclassified 1781
183 Ga0501081_0046527 3300049743 Bacteria 2983
184 Ga0501081_0142143 3300049743 Bacteria 1720
185 nmdc:mga05p37_10097_c1 3300050507 Bacteria 11208
186 nmdc:mga05p37_154528_c1 3300050507 Bacteria 2805
187 nmdc:mga05p37_154972_c1 3300050507 Bacteria 2800
188 nmdc:mga05p37_347564_c1 3300050507 Unclassified 1747
189 nmdc:mga05p37_43527_c1 3300050507 Bacteria 5524
190 nmdc:mga05p37_58265_c1 3300050507 Unclassified 4757
191 nmdc:mga05p37_71530_c1 3300050507 Bacteria 4267
192 nmdc:mga05p37_78518_c1 3300050507 Bacteria 4065
193 nmdc:mga05p37_98553_c1 3300050507 Bacteria 3600
194 nmdc:mga09592_188742_c1 3300050508 Unclassified 1784
195 nmdc:mga09592_56676_c1 3300050508 Bacteria 3311
196 nmdc:mga09592_85624_c1 3300050508 Bacteria 2688
197 nmdc:mga09592_89890_c1 3300050508 Bacteria 2623
198 nmdc:mga0qj67_217426_c1 3300050509 Unclassified 1551
199 nmdc:mga06r32_185350_c1 3300050510 Bacteria 2068
200 nmdc:mga06r32_29315_c1 3300050510 Bacteria 5156
201 nmdc:mga06r32_397618_c1 3300050510 Unclassified 1360
202 nmdc:mga0a205_424696_c1 3300050515 Unclassified 1191
203 nmdc:mga0a205_51206_c1 3300050515 Bacteria 3986
204 Ga0501084_0111886 3300054114 Unclassified 2295
205 Ga0501084_0325192 3300054114 Bacteria 1299
206 Ga0316584_0017865
207 SwRhRL2b_contig_23942
208 Ga0065704_10070900
209 Ga0065704_10085569
210 Ga0065712_10140226
211 Ga0065707_10000613
212 Ga0065707_10000645
213 Ga0065707_10091672
214 Ga0070705_100148681
215 Ga0070708_100094566
216 Ga0070706_100023527
217 Ga0070706_100054764
218 Ga0070706_100253508
219 Ga0070707_100080821
220 Ga0070707_100111187
221 Ga0070698_100050998
222 Ga0070698_100051018
223 Ga0070698_100069054
224 Ga0070698_100348424
225 Ga0070699_100008006
226 Ga0070699_100008686
227 Ga0070699_100117029
228 Ga0070699_100156313
229 Ga0070699_100192859
230 Ga0070699_100290608
231 Ga0070695_100070333
232 Ga0070696_100197572
233 Ga0070665_100075263
234 Ga0070704_100021861
235 Ga0070704_100095566
236 Ga0070704_100150884
237 Ga0068857_100294569
238 Ga0068862_100045931
239 Ga0068862_100088813
240 Ga0081539_10008656
241 Ga0081539_10010015
242 Ga0075427_10001735
243 Ga0075427_10004345
244 Ga0075428_100125819
245 Ga0075428_100197633
246 Ga0075428_100644053
247 Ga0075430_100167069
248 Ga0075431_100008492
249 Ga0075431_100076152
250 Ga0075431_100409112
251 Ga0075433_10022704
252 Ga0075433_10092733
253 Ga0075434_100585249
254 Ga0075429_100007282
255 Ga0075429_100007422
256 Ga0075429_100080095
257 Ga0075429_100082493
258 Ga0097620_100128789
259 Ga0111539_10395021
260 Ga0111539_10536930
261 Ga0105245_10207860
262 Ga0114129_10003339
263 Ga0114129_10009378
264 Ga0114129_10018644
265 Ga0114129_10027647
266 Ga0114129_10047573
267 Ga0114129_10067268
268 Ga0114129_10227729
269 Ga0114129_10329578
270 Ga0105243_10018466
271 Ga0105243_10049548
272 Ga0105243_10252575
273 Ga0105249_10093690
274 Ga0105249_10115210
275 Ga0105249_10278155
276 Ga0105249_10459709
277 Ga0105246_10046186
278 Ga0207684_10042624
279 Ga0207646_10061968
280 Ga0207646_10227955
281 Ga0207709_10027669
282 Ga0207709_10138635
283 Ga0207709_10306354
284 Ga0207712_10100632
285 Ga0207674_10210876
286 Ga0207674_10321898
287 Ga0207675_100044542
288 Ga0268266_10243314
289 Ga0268265_10054165
290 Ga0268265_10521662
291 Ga0265334_10018910
292 Ga0265318_10007388
293 Ga0265318_10031641
294 Ga0265338_10112692
295 Ga0265330_10045811
296 Ga0265332_10096595
297 Ga0265320_10003174
298 Ga0265329_10007543
299 Ga0265340_10059165
300 Ga0265316_10000466
301 Ga0265316_10123231
302 Ga0265316_10137264
303 Ga0316575_10025113
304 Ga0316575_10045851
305 Ga0316579_10003802
306 Ga0316579_10043184
307 Ga0265342_10010256
308 Ga0265342_10028459
309 Ga0316576_10047222
310 Ga0316576_10164814
311 Ga0316576_10251830
312 Ga0316578_10126951
313 Ga0316577_10033683
314 Ga0316577_10034965
315 Ga0307407_10019948
316 Ga0307407_10098111
317 Ga0307409_100048155
318 Ga0307409_100136168
319 Ga0307416_100165242
320 Ga0307416_100170857
321 Ga0307411_10068225
322 Ga0316574_0005339
323 Ga0316574_0006894
324 Ga0316574_0096612
325 Ga0316574_0141842
326 Ga0316582_0111625
327 Ga0316582_0136953
328 Ga0316584_0003171
329 Ga0316584_0003756
330 Ga0316584_0093351
331 Ga0451577_0014043
332 Ga0451577_0019458
333 Ga0451577_0024147
334 Ga0451577_0127148
335 Ga0451577_0154261
336 Ga0453683_0001151
337 Ga0453683_0004133
338 Ga0453683_0009171
339 Ga0453683_0013294
340 Ga0453683_0078134
341 Ga0453683_0148746
342 Ga0453684_0000003
343 Ga0453684_0000271
344 Ga0453684_0000420
345 Ga0453684_0000458
346 Ga0453684_0000666
347 Ga0453684_0002193
348 Ga0453684_0006953
349 Ga0453684_0012350
350 Ga0453684_0020550
351 Ga0453684_0026779
352 Ga0453684_0032802
353 Ga0453684_0040018
354 Ga0453684_0041447
355 Ga0453684_0048493
356 Ga0453684_0063849
357 Ga0453684_0065642
358 Ga0453684_0077007
359 Ga0453684_0078939
360 Ga0453684_0106797
361 Ga0453684_0127938
362 Ga0453684_0147811
363 Ga0453684_0150317
364 Ga0453684_0167304
365 Ga0453684_0198009
366 Ga0453684_0209930
367 Ga0453684_0292448
368 Ga0453684_0299244
369 Ga0453684_0305436
370 Ga0453684_0423319
371 Ga0453684_0498941
372 Ga0453684_0499948
373 Ga0453684_0585599
374 Ga0453684_0620606
375 Ga0451576_0000142
376 Ga0451576_0002880
377 Ga0451576_0007027
378 Ga0451576_0016899
379 Ga0451576_0138021
380 Ga0451576_0339279
381 Ga0451576_0803993
382 Ga0495594_0069578
383 Ga0501075_0020042
384 Ga0501075_0045323
385 Ga0501075_0068935
386 Ga0501076_0119184
387 Ga0501079_0155780
388 Ga0501081_0046527
389 Ga0501081_0142143
390 nmdc:mga05p37_10097_c1
391 nmdc:mga05p37_154528_c1
392 nmdc:mga05p37_154972_c1
393 nmdc:mga05p37_347564_c1
394 nmdc:mga05p37_43527_c1
395 nmdc:mga05p37_58265_c1
396 nmdc:mga05p37_71530_c1
397 nmdc:mga05p37_78518_c1
398 nmdc:mga05p37_98553_c1
399 nmdc:mga09592_188742_c1
400 nmdc:mga09592_56676_c1
401 nmdc:mga09592_85624_c1
402 nmdc:mga09592_89890_c1
403 nmdc:mga0qj67_217426_c1
404 nmdc:mga06r32_185350_c1
405 nmdc:mga06r32_29315_c1
406 nmdc:mga06r32_397618_c1
407 nmdc:mga0a205_424696_c1
408 nmdc:mga0a205_51206_c1
409 Ga0501084_0111886
410 Ga0501084_0325192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

46

312

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.791 39 331
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7848 36 329
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7733 39 331
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7223 36 329
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.6962 15 331
ID Description Score Start End Superfamily
af_D3ZG27_215_338_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8916 200 329 1.20.120.550
af_Q2FZM0_184_310_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8872 201 331 1.20.120.1780
af_Q2FZM0_184_310_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8609 201 331 1.20.120.1780
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8574 40 289 1.10.357.140
af_Q54K99_53_319_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8492 40 320 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A3N5UM47-F1-model_v4 Prenyltransferase 0.9991 167 349 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A3N5U8R5-F1-model_v4 Prenyltransferase 0.993 2 182 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A3N5UM47-F1-model_v4 Prenyltransferase 0.9883 167 349 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A419E453-F1-model_v4 Prenyltransferase 0.9808 2 347 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A1F8TTD9-F1-model_v4 Ubiquinone biosynthesis protein UbiA 0.9797 2 305 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371

Map