F320610

General Info

Members Datasets Scaffolds Average Seq Length
210 127 206 360

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000017|Ga0395899_0000017_91546_92688
Length 380
Sequence VVKLNKTNKKMIPSNKHKVMKRKYWLLAILPLFITACGGNQKPVDLTGDTAKTTGAKYKTGIVAEKALSSSAQLPGQLVAFNEVNLFPKVNGFVKELNVDRGSIVKKGELLAVLEAPEIAAQVAAANSRYLQAQENAEASKEKYNMLKEAAKEPGSVSPLDLTNASAKMKADEAMTQAEYSNLQSAKAMQNYLRIYAPFDGMIIERNVSPGALVAPGKATDQPMFILQDVNKMRLTVSVPEDYVDKLDLSKPVTFTFNALPGKQYTAKISRTANALGSMQQEAIEIDVMNKGGQLKPGMYAEVNIPMLSGAKSMLVPNKAIIRSTEHEYVITDDNSKANLVNIKEGLASNDSTEVFGNLKPGDKILLNGNDEIKQGDPVQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0
Rhizoplane 0.48
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002365 3300001989 Bacteria 7265
2 JGI24737J22298_10000496 3300001990 Bacteria 13684
3 JGI24735J21928_10000005 3300002067 Bacteria 356755
4 JGI25162J39368_1000008 3300002737 Bacteria 397212
5 JGI25162J39368_1001383 3300002737 Bacteria 13308
6 JGI25164J39214_1002205 3300002772 Bacteria 3212
7 JGI25165J46597_1000869 3300003214 Bacteria 21479
8 rootH1_10004676 3300003316 Bacteria 8395
9 rootH1_10093849 3300003316 Bacteria 3636
10 rootH1_10093849 3300003323 Bacteria 1783
11 rootH2_10002814 3300003320 Bacteria 49344
12 rootH2_10044515 3300003320 Bacteria 11301
13 rootH1_10003212 3300003323 Bacteria 182359
14 rootH1_10083522 3300003323 Bacteria 3050
15 rootH1_10166555 3300003323 Bacteria 9844
16 rootH1_10178407 3300003323 Bacteria 4138
17 rootH1_10204506 3300003323 Bacteria 4749
18 rootH1_10231562 3300003323 Bacteria 4287
19 rootH1_10277970 3300003323 Bacteria 1622
20 Ga0055536_1000001 3300003781 Bacteria 630663
21 Ga0055530_10012099 3300003791 Bacteria 3036
22 Ga0070658_10000011 3300005327 Bacteria 294396
23 Ga0070658_10151278 3300005327 Bacteria 1943
24 Ga0070658_10311331 3300005327 Unclassified 1343
25 Ga0070676_10000463 3300005328 Bacteria 19429
26 Ga0070680_100014616 3300005336 Bacteria 6140
27 Ga0070660_100057887 3300005339 Bacteria 3004
28 Ga0070673_100096755 3300005364 Bacteria 2423
29 Ga0070688_100267476 3300005365 Bacteria 1223
30 Ga0070659_100000016 3300005366 Bacteria 169522
31 Ga0070659_100100968 3300005366 Bacteria 2322
32 Ga0070663_100009969 3300005455 Bacteria 5906
33 Ga0070678_100106340 3300005456 Bacteria 2186
34 Ga0070662_100000032 3300005457 Bacteria 78824
35 Ga0070681_10008778 3300005458 Bacteria 9921
36 Ga0068867_100002392 3300005459 Bacteria 13197
37 Ga0070679_100027043 3300005530 Bacteria 5641
38 Ga0070684_100322787 3300005535 Bacteria 1418
39 Ga0070665_100000003 3300005548 Bacteria 811857
40 Ga0068855_100005580 3300005563 Bacteria 15354
41 Ga0068855_100047867 3300005563 Bacteria 5050
42 Ga0068855_100113315 3300005563 Bacteria 3111
43 Ga0068855_100155254 3300005563 Bacteria 2601
44 Ga0068855_100233299 3300005563 Bacteria 2059
45 Ga0068856_100000262 3300005614 Bacteria 57470
46 Ga0068856_100305368 3300005614 Bacteria 1609
47 Ga0068852_100039631 3300005616 Bacteria 3968
48 Ga0068866_10063353 3300005718 Bacteria 1927
49 Ga0075366_10028434 3300006195 Bacteria 3281
50 Ga0097621_100009837 3300006237 Bacteria 6963
51 Ga0068871_100001149 3300006358 Bacteria 17749
52 Ga0068865_100000574 3300006881 Bacteria 20568
53 Ga0105240_10000294 3300009093 Bacteria 97108
54 Ga0105240_10011203 3300009093 Bacteria 12511
55 Ga0105240_10093512 3300009093 Bacteria 3669
56 Ga0105240_10182843 3300009093 Bacteria 2472
57 Ga0105240_10300249 3300009093 Bacteria 1837
58 Ga0105240_10401034 3300009093 Bacteria 1545
59 Ga0105240_10605131 3300009093 Bacteria 1206
60 Ga0105245_10213390 3300009098 Bacteria 1859
61 Ga0105241_10014132 3300009174 Bacteria 5850
62 Ga0105242_10010346 3300009176 Bacteria 7153
63 Ga0105237_10000109 3300009545 Bacteria 115699
64 Ga0105237_10003009 3300009545 Bacteria 20347
65 Ga0105237_10004150 3300009545 Bacteria 16882
66 Ga0105237_10006380 3300009545 Bacteria 13087
67 Ga0105237_10054676 3300009545 Bacteria 4000
68 Ga0105238_10063622 3300009551 Bacteria 3690
69 Ga0105238_10171994 3300009551 Bacteria 2142
70 Ga0105239_10000013 3300010375 Bacteria 327371
71 Ga0105239_10000068 3300010375 Bacteria 144666
72 Ga0105239_10000162 3300010375 Bacteria 95804
73 Ga0105239_10002839 3300010375 Bacteria 21676
74 Ga0105239_10004350 3300010375 Bacteria 16975
75 Ga0105239_10010918 3300010375 Bacteria 10148
76 Ga0105239_10017010 3300010375 Bacteria 8040
77 Ga0105239_10420068 3300010375 Bacteria 1515
78 Ga0157373_10000087 3300013100 Bacteria 80308
79 Ga0157373_10030603 3300013100 Bacteria 3873
80 Ga0157371_10000155 3300013102 Bacteria 100230
81 Ga0157371_10005332 3300013102 Bacteria 10875
82 Ga0157371_10023741 3300013102 Bacteria 4483
83 Ga0157371_10080467 3300013102 Bacteria 2307
84 Ga0157370_10005261 3300013104 Bacteria 14556
85 Ga0157370_10048102 3300013104 Bacteria 4086
86 Ga0157370_10109545 3300013104 Bacteria 2582
87 Ga0157369_10002036 3300013105 Bacteria 24366
88 Ga0157369_10178169 3300013105 Bacteria 2237
89 Ga0157374_10002228 3300013296 Bacteria 16336
90 Ga0157374_10094157 3300013296 Unclassified 2862
91 Ga0157374_10389087 3300013296 Bacteria 1390
92 Ga0157378_10012566 3300013297 Bacteria 7411
93 Ga0157378_10080258 3300013297 Bacteria 2947
94 Ga0163162_10000031 3300013306 Bacteria 157666
95 Ga0163162_10004725 3300013306 Bacteria 13139
96 Ga0163162_10006055 3300013306 Bacteria 11707
97 Ga0157372_10000400 3300013307 Bacteria 47864
98 Ga0157372_10000874 3300013307 Bacteria 32723
99 Ga0157372_10003009 3300013307 Bacteria 18174
100 Ga0157375_10091550 3300013308 Bacteria 3103
101 Ga0182006_1000168 3300015261 Bacteria 69340
102 Ga0163161_10152897 3300017792 Bacteria 1755
103 Ga0207427_100085 3300025231 Bacteria 142561
104 Ga0209437_100030 3300025233 Bacteria 532466
105 Ga0209437_100052 3300025233 Bacteria 380548
106 Ga0209026_1000840 3300025250 Bacteria 16216
107 Ga0209026_1003510 3300025250 Bacteria 5099
108 Ga0209026_1009850 3300025250 Bacteria 1835
109 Ga0209233_1000067 3300025261 Bacteria 380554
110 Ga0209233_1000495 3300025261 Bacteria 23831
111 Ga0209676_1000008 3300025292 Bacteria 991778
112 Ga0209050_1000045 3300025298 Bacteria 388022
113 Ga0207647_10000948 3300025904 Bacteria 22427
114 Ga0207647_10002233 3300025904 Bacteria 14751
115 Ga0207645_10000082 3300025907 Bacteria 68372
116 Ga0207705_10000015 3300025909 Bacteria 382901
117 Ga0207705_10178684 3300025909 Bacteria 1601
118 Ga0207654_10008036 3300025911 Bacteria 5316
119 Ga0207654_10039200 3300025911 Bacteria 2663
120 Ga0207707_10032002 3300025912 Bacteria 4605
121 Ga0207695_10000142 3300025913 Bacteria 214715
122 Ga0207695_10004328 3300025913 Bacteria 19447
123 Ga0207695_10007972 3300025913 Bacteria 13359
124 Ga0207695_10028745 3300025913 Bacteria 6155
125 Ga0207671_10000407 3300025914 Bacteria 60207
126 Ga0207671_10001796 3300025914 Bacteria 24003
127 Ga0207671_10010295 3300025914 Bacteria 7729
128 Ga0207671_10010751 3300025914 Bacteria 7519
129 Ga0207660_10061854 3300025917 Bacteria 2696
130 Ga0207657_10057329 3300025919 Bacteria 3356
131 Ga0207652_10019847 3300025921 Bacteria 5533
132 Ga0207694_10029862 3300025924 Bacteria 4162
133 Ga0207694_10081230 3300025924 Bacteria 2546
134 Ga0207690_10000495 3300025932 Bacteria 25433
135 Ga0207690_10052491 3300025932 Bacteria 2731
136 Ga0207706_10000191 3300025933 Bacteria 68535
137 Ga0207686_10044918 3300025934 Bacteria 2715
138 Ga0207704_10000053 3300025938 Bacteria 79904
139 Ga0207667_10000039 3300025949 Bacteria 278843
140 Ga0207667_10000896 3300025949 Bacteria 37967
141 Ga0207667_10006347 3300025949 Bacteria 14333
142 Ga0207651_10168794 3300025960 Bacteria 1723
143 Ga0207639_10032523 3300026041 Bacteria 3840
144 Ga0207639_10093494 3300026041 Unclassified 2412
145 Ga0207678_10026651 3300026067 Bacteria 5043
146 Ga0207702_10000492 3300026078 Bacteria 44456
147 Ga0207674_10018328 3300026116 Bacteria 7612
148 Ga0207683_10090395 3300026121 Bacteria 2726
149 Ga0207698_10067036 3300026142 Bacteria 2829
150 Ga0268266_10000052 3300028379 Bacteria 296230
151 Ga0307517_10007927 3300028786 Bacteria 15349
152 Ga0307515_10001997 3300028794 Bacteria 45190
153 Ga0265338_10086243 3300028800 Bacteria 2614
154 Ga0307509_10155507 3300031507 Bacteria 2193
155 Ga0307510_10021552 3300033180 Bacteria 7508
156 Ga0395899_0000017 3300037312 Bacteria 440179
157 Ga0395899_0000055 3300037312 Bacteria 220579
158 Ga0395899_0028150 3300037312 Bacteria 4232
159 Ga0395900_0000014 3300037418 Bacteria 386513
160 Ga0395900_0000128 3300037418 Bacteria 127446
161 Ga0395900_0007404 3300037418 Bacteria 11346
162 Ga0395898_0022234 3300037466 Bacteria 6426
163 Ga0395898_0164247 3300037466 Bacteria 2124
164 Ga0395905_0000037 3300037471 Bacteria 261808
165 Ga0395905_0002800 3300037471 Bacteria 19106
166 Ga0395901_0000166 3300038443 Bacteria 86352
167 Ga0395901_0047546 3300038443 Bacteria 4455
168 Ga0395901_0087172 3300038443 Bacteria 3264
169 Ga0466969_0073076 3300044656 Bacteria 1646
170 Ga0466966_0055290 3300044684 Bacteria 2512
171 Ga0466961_0013945 3300044693 Bacteria 5151
172 Ga0466958_0118184 3300045836 Bacteria 1658
173 Ga0495629_0066134 3300046459 Bacteria 2523
174 Ga0495650_0000050 3300046471 Bacteria 318894
175 Ga0495585_0000198 3300046492 Bacteria 62640
176 Ga0495585_0000553 3300046492 Bacteria 35342
177 Ga0495583_0018695 3300046506 Bacteria 3642
178 Ga0495606_0023684 3300046507 Bacteria 4443
179 Ga0495616_0001519 3300046513 Bacteria 15997
180 Ga0495616_0002714 3300046513 Bacteria 11592
181 Ga0495637_0097165 3300046520 Bacteria 1155
182 Ga0495648_0078688 3300046524 Bacteria 1884
183 Ga0495652_0082959 3300046529 Bacteria 2640
184 Ga0495622_0092331 3300046557 Bacteria 1390
185 Ga0495633_0011926 3300046558 Bacteria 4650
186 Ga0495668_0000032 3300046616 Bacteria 254951
187 Ga0495625_0000105 3300046660 Bacteria 126078
188 Ga0495625_0001038 3300046660 Bacteria 36510
189 Ga0495625_0008344 3300046660 Bacteria 8844
190 Ga0495625_0032883 3300046660 Bacteria 3840
191 Ga0495625_0064921 3300046660 Bacteria 2574
192 Ga0495661_0025044 3300046665 Bacteria 3860
193 Ga0495658_0079115 3300046683 Bacteria 1925
194 Ga0495649_0000011 3300046694 Bacteria 416695
195 Ga0495660_0015366 3300046810 Bacteria 4424
196 Ga0495687_000552 3300047443 Bacteria 44401
197 Ga0495686_0000098 3300047472 Bacteria 183131
198 Ga0495686_0001801 3300047472 Bacteria 21688
199 Ga0495686_0132968 3300047472 Bacteria 1473
200 Ga0495678_014109 3300049459 Bacteria 3725
201 nmdc:mga0k408_42058_c1 3300050493 Bacteria 2632
202 Ga0500608_001643 3300053122 Bacteria 8034
203 Ga0500618_000037 3300053125 Bacteria 117320
204 Ga0500642_0009894 3300053130 Unclassified 3336
205 Ga0500616_0129262 3300053153 Bacteria 1195
206 Ga0500624_000530 3300053157 Bacteria 10893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10152897 Ga0163161_101528972 311
2 3300025921 Ga0207652_10019847 Ga0207652_100198474 318
3 3300009545 Ga0105237_10054676 Ga0105237_100546765 321
4 3300025914 Ga0207671_10010295 Ga0207671_100102953 321
5 3300053157 Ga0500624_000530 Ga0500624_000530_4366_5463 330
6 3300005563 Ga0068855_100233299 Ga0068855_1002332992 331
7 3300046616 Ga0495668_0000032 Ga0495668_0000032_73905_74987 331
8 3300028800 Ga0265338_10086243 Ga0265338_100862432 335
9 3300010375 Ga0105239_10002839 Ga0105239_100028396 338
10 3300003320 rootH2_10044515 rootH2_100445157 341
11 3300009093 Ga0105240_10401034 Ga0105240_104010342 341
12 3300005327 Ga0070658_10151278 Ga0070658_101512782 342
13 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008164 345
14 3300010375 Ga0105239_10000068 Ga0105239_10000068129 345
15 3300025233 Ga0209437_100030 Ga0209437_100030226 345
16 3300005336 Ga0070680_100014616 Ga0070680_1000146165 346
17 3300005458 Ga0070681_10008778 Ga0070681_100087787 346
18 3300005530 Ga0070679_100027043 Ga0070679_1000270432 346
19 3300009093 Ga0105240_10182843 Ga0105240_101828431 346
20 3300025912 Ga0207707_10032002 Ga0207707_100320023 346
21 3300025917 Ga0207660_10061854 Ga0207660_100618542 346
22 3300005327 Ga0070658_10311331 Ga0070658_103113311 347
23 3300046660 Ga0495625_0008344 Ga0495625_0008344_2505_3548 347
24 3300003323 rootH1_10277970 rootH1_102779702 348
25 3300009545 Ga0105237_10006380 Ga0105237_100063805 349
26 3300025250 Ga0209026_1000840 Ga0209026_100084012 349
27 3300025914 Ga0207671_10001796 Ga0207671_100017963 349
28 3300003316 rootH1_10004676 rootH1_100046766 353
29 3300010375 Ga0105239_10000162 Ga0105239_1000016260 353
30 3300013105 Ga0157369_10178169 Ga0157369_101781692 354
31 3300025909 Ga0207705_10178684 Ga0207705_101786842 355
32 iso_pu_bacteria 2857627736 2857632635 355
33 iso_pu_bacteria 2928078545 2928081133 358
34 iso_pu_bacteria 2928147474 2928152446 358
35 3300003781 Ga0055536_1000001 Ga0055536_100000183 359
36 3300003791 Ga0055530_10012099 Ga0055530_100120994 359
37 3300005455 Ga0070663_100009969 Ga0070663_1000099693 359
38 3300005563 Ga0068855_100005580 Ga0068855_10000558010 359
39 3300006195 Ga0075366_10028434 Ga0075366_100284341 359
40 3300013104 Ga0157370_10109545 Ga0157370_101095453 359
41 3300015261 Ga0182006_1000168 Ga0182006_100016811 359
42 3300025292 Ga0209676_1000008 Ga0209676_1000008774 359
43 3300025298 Ga0209050_1000045 Ga0209050_100004511 359
44 3300025949 Ga0207667_10000896 Ga0207667_1000089610 359
45 3300026067 Ga0207678_10026651 Ga0207678_100266513 359
46 3300002737 JGI25162J39368_1001383 JGI25162J39368_100138310 360
47 3300002772 JGI25164J39214_1002205 JGI25164J39214_10022052 360
48 3300003214 JGI25165J46597_1000869 JGI25165J46597_100086911 360
49 3300003323 rootH1_10003212 rootH1_1000321281 360
50 3300003323 rootH1_10204506 rootH1_102045062 360
51 3300003323 rootH1_10231562 rootH1_102315623 360
52 3300005328 Ga0070676_10000463 Ga0070676_1000046318 360
53 3300005339 Ga0070660_100057887 Ga0070660_1000578872 360
54 3300005364 Ga0070673_100096755 Ga0070673_1000967551 360
55 3300005365 Ga0070688_100267476 Ga0070688_1002674761 360
56 3300005366 Ga0070659_100000016 Ga0070659_10000001670 360
57 3300005366 Ga0070659_100100968 Ga0070659_1001009681 360
58 3300005456 Ga0070678_100106340 Ga0070678_1001063402 360
59 3300005459 Ga0068867_100002392 Ga0068867_10000239210 360
60 3300005535 Ga0070684_100322787 Ga0070684_1003227871 360
61 3300005614 Ga0068856_100000262 Ga0068856_10000026221 360
62 3300005614 Ga0068856_100305368 Ga0068856_1003053682 360
63 3300005616 Ga0068852_100039631 Ga0068852_1000396312 360
64 3300005718 Ga0068866_10063353 Ga0068866_100633532 360
65 3300006237 Ga0097621_100009837 Ga0097621_1000098372 360
66 3300006358 Ga0068871_100001149 Ga0068871_10000114910 360
67 3300006881 Ga0068865_100000574 Ga0068865_1000005747 360
68 3300009093 Ga0105240_10000294 Ga0105240_1000029432 360
69 3300009174 Ga0105241_10014132 Ga0105241_100141323 360
70 3300009176 Ga0105242_10010346 Ga0105242_100103462 360
71 3300009545 Ga0105237_10000109 Ga0105237_1000010923 360
72 3300009545 Ga0105237_10003009 Ga0105237_100030093 360
73 3300009545 Ga0105237_10004150 Ga0105237_1000415013 360
74 3300009551 Ga0105238_10171994 Ga0105238_101719942 360
75 3300010375 Ga0105239_10010918 Ga0105239_100109183 360
76 3300013100 Ga0157373_10030603 Ga0157373_100306034 360
77 3300013102 Ga0157371_10000155 Ga0157371_1000015537 360
78 3300013104 Ga0157370_10005261 Ga0157370_100052616 360
79 3300013296 Ga0157374_10002228 Ga0157374_1000222811 360
80 3300013297 Ga0157378_10080258 Ga0157378_100802582 360
81 3300013306 Ga0163162_10006055 Ga0163162_100060557 360
82 3300013307 Ga0157372_10003009 Ga0157372_100030095 360
83 3300013308 Ga0157375_10091550 Ga0157375_100915503 360
84 3300025231 Ga0207427_100085 Ga0207427_1000858 360
85 3300025233 Ga0209437_100052 Ga0209437_100052236 360
86 3300025250 Ga0209026_1009850 Ga0209026_10098502 360
87 3300025261 Ga0209233_1000067 Ga0209233_1000067236 360
88 3300025261 Ga0209233_1000495 Ga0209233_10004959 360
89 3300025904 Ga0207647_10002233 Ga0207647_100022332 360
90 3300025907 Ga0207645_10000082 Ga0207645_1000008215 360
91 3300025911 Ga0207654_10008036 Ga0207654_100080362 360
92 3300025911 Ga0207654_10039200 Ga0207654_100392002 360
93 3300025913 Ga0207695_10000142 Ga0207695_10000142148 360
94 3300025914 Ga0207671_10000407 Ga0207671_1000040746 360
95 3300025914 Ga0207671_10010751 Ga0207671_100107512 360
96 3300025919 Ga0207657_10057329 Ga0207657_100573294 360
97 3300025924 Ga0207694_10029862 Ga0207694_100298623 360
98 3300025924 Ga0207694_10081230 Ga0207694_100812302 360
99 3300025932 Ga0207690_10000495 Ga0207690_1000049515 360
100 3300025932 Ga0207690_10052491 Ga0207690_100524912 360
101 3300025934 Ga0207686_10044918 Ga0207686_100449182 360
102 3300025938 Ga0207704_10000053 Ga0207704_1000005362 360
103 3300025949 Ga0207667_10000039 Ga0207667_10000039132 360
104 3300025960 Ga0207651_10168794 Ga0207651_101687941 360
105 3300026041 Ga0207639_10032523 Ga0207639_100325232 360
106 3300026078 Ga0207702_10000492 Ga0207702_100004924 360
107 3300026116 Ga0207674_10018328 Ga0207674_100183282 360
108 3300026121 Ga0207683_10090395 Ga0207683_100903952 360
109 3300026142 Ga0207698_10067036 Ga0207698_100670362 360
110 3300028786 Ga0307517_10007927 Ga0307517_1000792710 360
111 3300028794 Ga0307515_10001997 Ga0307515_1000199738 360
112 3300033180 Ga0307510_10021552 Ga0307510_100215523 360
113 3300038443 Ga0395901_0087172 Ga0395901_0087172_469_1551 360
114 3300046459 Ga0495629_0066134 Ga0495629_0066134_167_1249 360
115 3300046492 Ga0495585_0000553 Ga0495585_0000553_34085_35167 360
116 3300046524 Ga0495648_0078688 Ga0495648_0078688_195_1277 360
117 3300046529 Ga0495652_0082959 Ga0495652_0082959_840_1922 360
118 3300046557 Ga0495622_0092331 Ga0495622_0092331_191_1273 360
119 3300046660 Ga0495625_0001038 Ga0495625_0001038_35250_36332 360
120 3300046660 Ga0495625_0032883 Ga0495625_0032883_38_1120 360
121 3300046683 Ga0495658_0079115 Ga0495658_0079115_167_1249 360
122 3300046810 Ga0495660_0015366 Ga0495660_0015366_1421_2503 360
123 3300047472 Ga0495686_0001801 Ga0495686_0001801_12596_13678 360
124 3300047472 Ga0495686_0132968 Ga0495686_0132968_231_1313 360
125 3300053122 Ga0500608_001643 Ga0500608_001643_261_1343 360
126 3300053153 Ga0500616_0129262 Ga0500616_0129262_26_1111 360
127 3300003323 rootH1_10166555 rootH1_101665555 361
128 3300009093 Ga0105240_10093512 Ga0105240_100935122 361
129 3300010375 Ga0105239_10004350 Ga0105239_100043502 361
130 3300013102 Ga0157371_10005332 Ga0157371_1000533214 361
131 3300013104 Ga0157370_10048102 Ga0157370_100481023 361
132 3300013105 Ga0157369_10002036 Ga0157369_1000203615 361
133 3300013306 Ga0163162_10004725 Ga0163162_1000472511 361
134 3300013307 Ga0157372_10000400 Ga0157372_1000040030 361
135 3300025250 Ga0209026_1003510 Ga0209026_10035103 361
136 3300025913 Ga0207695_10007972 Ga0207695_100079722 361
137 3300044656 Ga0466969_0073076 Ga0466969_0073076_217_1302 361
138 3300044684 Ga0466966_0055290 Ga0466966_0055290_1255_2340 361
139 3300045836 Ga0466958_0118184 Ga0466958_0118184_141_1226 361
140 3300046471 Ga0495650_0000050 Ga0495650_0000050_48142_49227 361
141 3300046492 Ga0495585_0000198 Ga0495585_0000198_16445_17530 361
142 3300046506 Ga0495583_0018695 Ga0495583_0018695_2333_3418 361
143 3300046507 Ga0495606_0023684 Ga0495606_0023684_3111_4199 361
144 3300046520 Ga0495637_0097165 Ga0495637_0097165_44_1129 361
145 3300046665 Ga0495661_0025044 Ga0495661_0025044_484_1569 361
146 3300003320 rootH2_10002814 rootH2_1000281427 362
147 3300003323 rootH1_10083522 rootH1_100835222 362
148 3300005457 Ga0070662_100000032 Ga0070662_10000003234 362
149 3300005548 Ga0070665_100000003 Ga0070665_100000003644 362
150 3300005563 Ga0068855_100047867 Ga0068855_1000478673 362
151 3300009093 Ga0105240_10011203 Ga0105240_100112032 362
152 3300009098 Ga0105245_10213390 Ga0105245_102133902 362
153 3300010375 Ga0105239_10017010 Ga0105239_100170103 362
154 3300013102 Ga0157371_10080467 Ga0157371_100804672 362
155 3300013306 Ga0163162_10000031 Ga0163162_1000003154 362
156 3300025904 Ga0207647_10000948 Ga0207647_100009487 362
157 3300025913 Ga0207695_10004328 Ga0207695_1000432810 362
158 3300025913 Ga0207695_10028745 Ga0207695_100287453 362
159 3300025933 Ga0207706_10000191 Ga0207706_1000019136 362
160 3300025949 Ga0207667_10006347 Ga0207667_100063472 362
161 3300026041 Ga0207639_10093494 Ga0207639_100934941 362
162 3300028379 Ga0268266_10000052 Ga0268266_10000052235 362
163 3300037418 Ga0395900_0000014 Ga0395900_0000014_79423_80511 362
164 3300037466 Ga0395898_0022234 Ga0395898_0022234_58_1146 362
165 3300037471 Ga0395905_0000037 Ga0395905_0000037_79413_80501 362
166 3300038443 Ga0395901_0000166 Ga0395901_0000166_79277_80365 362
167 3300047443 Ga0495687_000552 Ga0495687_000552_28898_29986 362
168 3300037418 Ga0395900_0000128 Ga0395900_0000128_118332_119423 363
169 3300050493 nmdc:mga0k408_42058_c1 nmdc:mga0k408_42058_c1_209_1300 363
170 3300005327 Ga0070658_10000011 Ga0070658_1000001177 364
171 3300005563 Ga0068855_100113315 Ga0068855_1001133152 364
172 3300009093 Ga0105240_10300249 Ga0105240_103002492 364
173 3300009551 Ga0105238_10063622 Ga0105238_100636222 364
174 3300010375 Ga0105239_10000013 Ga0105239_1000001311 364
175 3300013296 Ga0157374_10094157 Ga0157374_100941573 364
176 3300013296 Ga0157374_10389087 Ga0157374_103890871 364
177 3300025909 Ga0207705_10000015 Ga0207705_1000001577 364
178 3300037312 Ga0395899_0028150 Ga0395899_0028150_2857_3954 364
179 3300037418 Ga0395900_0007404 Ga0395900_0007404_6164_7261 364
180 3300037466 Ga0395898_0164247 Ga0395898_0164247_81_1178 364
181 3300037471 Ga0395905_0002800 Ga0395905_0002800_4000_5097 364
182 3300038443 Ga0395901_0047546 Ga0395901_0047546_1980_3077 364
183 3300046513 Ga0495616_0001519 Ga0495616_0001519_197_1309 364
184 3300046660 Ga0495625_0064921 Ga0495625_0064921_1260_2357 364
185 3300049459 Ga0495678_014109 Ga0495678_014109_2514_3626 364
186 3300053130 Ga0500642_0009894 Ga0500642_0009894_1609_2706 364
187 3300037312 Ga0395899_0000055 Ga0395899_0000055_11652_12770 365
188 3300044693 Ga0466961_0013945 Ga0466961_0013945_2648_3766 365
189 3300047472 Ga0495686_0000098 Ga0495686_0000098_154935_156041 366
190 3300013297 Ga0157378_10012566 Ga0157378_100125663 368
191 3300013100 Ga0157373_10000087 Ga0157373_100000872 369
192 3300003316 rootH1_10093849 rootH1_100938492 370
193 3300009093 Ga0105240_10605131 Ga0105240_106051311 373
194 3300031507 Ga0307509_10155507 Ga0307509_101555071 373
195 iso_pu_bacteria 2599185184 2599480002 373
196 iso_pu_bacteria 2932082852 2932087783 373
197 3300037312 Ga0395899_0000017 Ga0395899_0000017_91546_92688 376
198 3300046513 Ga0495616_0002714 Ga0495616_0002714_1024_2154 376
199 3300046558 Ga0495633_0011926 Ga0495633_0011926_1254_2384 376
200 3300046660 Ga0495625_0000105 Ga0495625_0000105_90492_91622 376
201 3300046694 Ga0495649_0000011 Ga0495649_0000011_34436_35566 376
202 3300053125 Ga0500618_000037 Ga0500618_000037_8234_9370 376
203 3300001989 JGI24739J22299_10002365 JGI24739J22299_100023655 377
204 3300001990 JGI24737J22298_10000496 JGI24737J22298_100004963 377
205 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005137 377
206 3300003323 rootH1_10178407 rootH1_101784072 377
207 3300005563 Ga0068855_100155254 Ga0068855_1001552543 377
208 3300010375 Ga0105239_10420068 Ga0105239_104200682 377
209 3300013102 Ga0157371_10023741 Ga0157371_100237412 377
210 3300013307 Ga0157372_10000874 Ga0157372_1000087426 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

72

135

0.94

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

67

301

0.89

PF13437

HlyD_3

HlyD family secretion protein

194

298

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aal-assembly1.cif.gz_B crystal structure of the f-bar domain of pstipip1, g258a mutant 0.9587 115 190
6qpq-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9083 115 190
2v0o-assembly2.cif.gz_C fcho2 f-bar domain 0.9077 115 190
8h9e-assembly1.cif.gz_G human atp synthase f1 domain, state 1 0.9062 115 188
8cok-assembly1.cif.gz_A structural analysis of ing3 protein and its binding to histone h3 0.9027 115 190
ID Description Score Start End Superfamily
af_Q6AHQ8_8_294_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9717 115 188 1.20.1270.60
af_B0BNK4_2_275_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9545 115 190 1.20.1270.60
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9537 115 186 1.10.287.470
af_Q9URW7_247_458_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.947 115 186 1.20.1270.60
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9388 115 186 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A850K9D2-F1-model_v4 deleted 0.8189 64 302
AF-A0A4Z0IHK2-F1-model_v4 deleted 0.7971 71 306
AF-A0A4R2P814-F1-model_v4 RND family efflux transporter MFP subunit 0.769 34 306 GO:0015562
GO:1990281
AF-A0A380TSS0-F1-model_v4 Membrane-fusion protein 0.7671 69 302 GO:0005886
AF-A0A0G3G4C0-F1-model_v4 Secretion protein HlyD 0.7612 35 300 GO:0005886
GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
80.79 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map