F320645

General Info

Members Datasets Scaffolds Average Seq Length
210 144 203 281

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0937045|Ga0436363_0937045_1134_2036
Length 300
Sequence LRVSAQSRDIEGENKGIAMLLGFNMLLWSTHVTEEHFTLFADIKRAGFDGVELPIFEGTPEHFDKVGRAIRDNGLRSTAVTVIPDPQHDCASDDPTVRAASLKHLEWALDCLAAMGGETLCGPFHQPLGLFSGEPPTKGERANIASVHKEAAAYAARRGAKLSVEPLNRFECYALNTIADSADIVRQVNEPNYGVLYDTFHANIEEKDPVGVITPNIAHINHVHFSENDRGTPGKGHVPWAATMKALKHGGYDGWCVIEAFGRALPALAAATRVWRDFFPNREEVYQFGGKFLREQWAKA

Samples

Sample ID Description Type Environment
1 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
2 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
3 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
6 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
81 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
82 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.57
Nodule 0.95
Rhizoplane 3.81
Rhizosphere 63.81
Stem 0
Stem Tuber 0
Unclassified 12.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006555 3300002987 Bacteria 3468
2 JGI25151J46595_10000193 3300003187 Bacteria 75098
3 JGI25151J46595_10016496 3300003187 Bacteria 3229
4 JGI25153J46596_10000019 3300003215 Bacteria 260291
5 JGI25153J46596_10002272 3300003215 Bacteria 11198
6 rootH2_10125515 3300003320 Plasmid 3117
7 rootH2_10256735 3300003320 Bacteria 2976
8 rootL2_10097807 3300003322 Bacteria 4796
9 Ga0070674_100017239 3300005356 Bacteria 4539
10 Ga0070713_100369622 3300005436 Bacteria 1334
11 Ga0070700_100085657 3300005441 Bacteria 2044
12 Ga0070707_100102006 3300005468 Bacteria 2780
13 Ga0070699_100065730 3300005518 Bacteria 3148
14 Ga0070699_100215646 3300005518 Bacteria 1709
15 Ga0070686_100131653 3300005544 Bacteria 1730
16 Ga0070695_100326737 3300005545 Bacteria 1142
17 Ga0070696_100135084 3300005546 Bacteria 1798
18 Ga0070696_100178821 3300005546 Bacteria 1573
19 Ga0068856_100670852 3300005614 Unclassified 1057
20 Ga0068859_100017007 3300005617 Bacteria 7301
21 Ga0068864_100580388 3300005618 Unclassified 1086
22 Ga0068861_100193438 3300005719 Bacteria 1702
23 Ga0068861_100394922 3300005719 Bacteria 1226
24 Ga0068863_100003634 3300005841 Bacteria 15243
25 Ga0068863_100042801 3300005841 Bacteria 4302
26 Ga0068860_100000797 3300005843 Bacteria 35400
27 Ga0068862_100234054 3300005844 Bacteria 1667
28 Ga0068862_100451175 3300005844 Bacteria 1212
29 Ga0081455_10107856 3300005937 Bacteria 2219
30 Ga0081455_10337367 3300005937 Bacteria 1068
31 Ga0081538_10045182 3300005981 Bacteria 2734
32 Ga0081540_1022559 3300005983 Bacteria 3716
33 Ga0081540_1046446 3300005983 Bacteria 2192
34 Ga0075365_10162120 3300006038 Bacteria 1558
35 Ga0075363_100068893 3300006048 Bacteria 1919
36 Ga0075364_10002231 3300006051 Bacteria 10866
37 Ga0075362_10006535 3300006177 Bacteria 4353
38 Ga0075362_10039059 3300006177 Unclassified 2086
39 Ga0075362_10042871 3300006177 Bacteria 2002
40 Ga0075428_100014634 3300006844 Bacteria 8712
41 Ga0075428_100537139 3300006844 Bacteria 1250
42 Ga0075431_100715218 3300006847 Bacteria 978
43 Ga0111539_10000051 3300009094 Bacteria 117607
44 Ga0114129_10036003 3300009147 Bacteria 6990
45 Ga0114129_10294760 3300009147 Bacteria 2164
46 Ga0105243_10825336 3300009148 Bacteria 916
47 Ga0105241_10563415 3300009174 Bacteria 1024
48 Ga0105237_10007440 3300009545 Bacteria 11983
49 Ga0105249_10081559 3300009553 Bacteria 3007
50 Ga0105239_10274990 3300010375 Bacteria 1895
51 Ga0163162_10395836 3300013306 Bacteria 1514
52 Ga0157380_10046124 3300014326 Bacteria 3422
53 Ga0157379_10052586 3300014968 Bacteria 3638
54 Ga0213872_10088039 3300021361 Bacteria 1391
55 Ga0209130_1001013 3300025284 Bacteria 21788
56 Ga0209676_1010524 3300025292 Bacteria 3838
57 Ga0209025_1000061 3300025294 Bacteria 304827
58 Ga0209025_1000180 3300025294 Bacteria 157372
59 Ga0209025_1043396 3300025294 Bacteria 1895
60 Ga0209758_1000028 3300025297 Bacteria 530102
61 Ga0209758_1005524 3300025297 Bacteria 9659
62 Ga0209758_1007934 3300025297 Bacteria 7041
63 Ga0209050_1004780 3300025298 Bacteria 8933
64 Ga0207426_1000451 3300025302 Bacteria 65459
65 Ga0209257_1000955 3300025304 Bacteria 39782
66 Ga0209257_1034537 3300025304 Bacteria 1576
67 Ga0209257_1063816 3300025304 Unclassified 992
68 Ga0207695_10102863 3300025913 Bacteria 2849
69 Ga0207700_10407457 3300025928 Bacteria 1192
70 Ga0207706_10007483 3300025933 Bacteria 10098
71 Ga0207709_10128446 3300025935 Bacteria 1723
72 Ga0207689_10004859 3300025942 Bacteria 12111
73 Ga0207668_10053025 3300025972 Bacteria 2809
74 Ga0207668_10113245 3300025972 Bacteria 2039
75 Ga0207668_10457277 3300025972 Bacteria 1091
76 Ga0207703_10172816 3300026035 Bacteria 1902
77 Ga0207708_10057619 3300026075 Bacteria 2964
78 Ga0207641_10039658 3300026088 Bacteria 3940
79 Ga0207675_100069929 3300026118 Bacteria 3281
80 Ga0207675_100116065 3300026118 Bacteria 2530
81 Ga0207428_10003036 3300027907 Bacteria 16519
82 Ga0268265_10034092 3300028380 Bacteria 3708
83 Ga0268265_10089789 3300028380 Bacteria 2452
84 Ga0268265_10250607 3300028380 Bacteria 1568
85 Ga0268264_10000020 3300028381 Bacteria 483593
86 Ga0265327_10015016 3300031251 Bacteria 5033
87 Ga0307513_10114998 3300031456 Bacteria 2674
88 Ga0307513_10203825 3300031456 Bacteria 1816
89 Ga0307513_10215991 3300031456 Bacteria 1744
90 Ga0307513_10334365 3300031456 Bacteria 1268
91 Ga0307408_100253106 3300031548 Unclassified 1454
92 Ga0307508_10090610 3300031616 Bacteria 2645
93 Ga0316579_10072141 3300031691 Bacteria 1637
94 Ga0307413_10072695 3300031824 Bacteria 2171
95 Ga0307416_100158085 3300032002 Unclassified 2090
96 Ga0373927_0024800 3300035695 Bacteria 3919
97 Ga0373925_0021399 3300037068 Bacteria 4712
98 Ga0400483_017169 3300039062 Bacteria 12778
99 Ga0400483_029441 3300039062 Bacteria 7342
100 Ga0400483_232856 3300039062 Bacteria 4763
101 Ga0436361_0576226 3300039447 Bacteria 2180
102 Ga0436363_0937045 3300039450 Bacteria 3285
103 Ga0436363_1668959 3300039450 Bacteria 4539
104 Ga0451795_0483603 3300041456 Bacteria 1101
105 Ga0451833_0849805 3300041491 Bacteria 1142
106 Ga0451849_1534819 3300041505 Bacteria 1349
107 Ga0439456_009451 3300042013 Bacteria 2014
108 Ga0439434_0058735 3300042435 Bacteria 1201
109 Ga0451576_0000458 3300045051 Bacteria 92512
110 Ga0495686_0072247 3300047472 Bacteria 2122
111 Ga0496100_0290849 3300048903 Bacteria 1221
112 Ga0496101_0144022 3300048904 Bacteria 1819
113 Ga0496102_0079408 3300048905 Bacteria 3022
114 Ga0496102_0626908 3300048905 Bacteria 998
115 Ga0496109_0164464 3300048912 Bacteria 2080
116 Ga0496110_0037729 3300048913 Bacteria 4201
117 Ga0496115_0086256 3300048918 Bacteria 2561
118 Ga0496117_0080393 3300048920 Bacteria 2144
119 Ga0496118_0059170 3300048921 Bacteria 2856
120 Ga0496121_0254472 3300048924 Bacteria 1216
121 Ga0496122_0171984 3300048925 Bacteria 1304
122 Ga0496124_0014522 3300048927 Bacteria 7608
123 Ga0496125_0026096 3300048928 Bacteria 5335
124 Ga0496126_0000360 3300048929 Bacteria 94933
125 Ga0501031_0070735 3300049568 Bacteria 2273
126 Ga0501034_0192432 3300049571 Bacteria 2001
127 Ga0501034_0547448 3300049571 Unclassified 1067
128 Ga0501036_0168755 3300049572 Bacteria 1844
129 Ga0501037_0032337 3300049573 Bacteria 3863
130 Ga0501037_0074532 3300049573 Bacteria 2466
131 Ga0501037_0170480 3300049573 Bacteria 1547
132 Ga0501037_0173912 3300049573 Bacteria 1530
133 Ga0501038_0020478 3300049574 Bacteria 5944
134 Ga0501038_0026322 3300049574 Bacteria 5181
135 Ga0501038_0430798 3300049574 Bacteria 1016
136 Ga0501039_0354013 3300049575 Bacteria 1154
137 Ga0501040_0043539 3300049576 Bacteria 3060
138 Ga0501041_0010340 3300049577 Bacteria 5499
139 Ga0501042_0004682 3300049578 Bacteria 8726
140 Ga0501043_0044843 3300049579 Bacteria 3477
141 Ga0501046_0182039 3300049580 Bacteria 1571
142 Ga0501047_0005126 3300049581 Bacteria 12293
143 Ga0501047_0051455 3300049581 Bacteria 3980
144 Ga0501047_0258904 3300049581 Bacteria 1588
145 Ga0501048_0015560 3300049582 Bacteria 5619
146 Ga0501068_0010627 3300049584 Bacteria 5179
147 Ga0501068_0163034 3300049584 Bacteria 1405
148 Ga0501070_0034086 3300049586 Bacteria 4258
149 Ga0501070_0137336 3300049586 Bacteria 2018
150 Ga0501070_0185761 3300049586 Bacteria 1710
151 Ga0501071_0207610 3300049587 Bacteria 1472
152 Ga0501072_0490789 3300049588 Bacteria 971
153 Ga0501073_0003556 3300049589 Bacteria 11707
154 Ga0501073_0009620 3300049589 Bacteria 7129
155 Ga0501073_0229712 3300049589 Bacteria 1282
156 Ga0501074_0028003 3300049590 Bacteria 4085
157 Ga0501075_0017031 3300049591 Bacteria 5243
158 Ga0501076_0020827 3300049592 Bacteria 5022
159 Ga0501076_0429426 3300049592 Bacteria 1087
160 Ga0501079_0055864 3300049741 Bacteria 3046
161 Ga0501080_0015041 3300049742 Bacteria 7129
162 Ga0501080_0070722 3300049742 Bacteria 3245
163 Ga0501080_0311596 3300049742 Bacteria 1426
164 Ga0501081_0051520 3300049743 Bacteria 2839
165 Ga0501083_0006741 3300049744 Bacteria 8149
166 Ga0501083_0185557 3300049744 Bacteria 1358
167 Ga0501083_0319306 3300049744 Bacteria 1010
168 Ga0501035_0020889 3300049822 Bacteria 6017
169 Ga0501035_0120592 3300049822 Bacteria 2293
170 Ga0501035_0144725 3300049822 Bacteria 2065
171 Ga0501035_0204873 3300049822 Bacteria 1690
172 Ga0501035_0309587 3300049822 Bacteria 1329
173 Ga0501044_0020130 3300049823 Bacteria 7123
174 Ga0501044_0021798 3300049823 Bacteria 6832
175 Ga0501044_0136165 3300049823 Bacteria 2447
176 Ga0501044_0164221 3300049823 Bacteria 2195
177 Ga0501044_0286637 3300049823 Bacteria 1579
178 Ga0501045_0009889 3300049824 Bacteria 6673
179 nmdc:mga05p37_127525_c1 3300050507 Bacteria 3124
180 nmdc:mga05p37_130064_c1 3300050507 Bacteria 3089
181 nmdc:mga0qj67_678900_c1 3300050509 Bacteria 820
182 nmdc:mga08y16_226300_c1 3300050511 Bacteria 1935
183 nmdc:mga08y16_237_c1 3300050511 Bacteria 49310
184 Ga0500651_0064837 3300053093 Bacteria 2277
185 Ga0500651_0133103 3300053093 Bacteria 1503
186 Ga0500641_0002135 3300053096 Bacteria 7001
187 Ga0500555_017177 3300053103 Bacteria 2085
188 Ga0500555_032676 3300053103 Bacteria 1469
189 Ga0500595_000302 3300053119 Bacteria 32439
190 Ga0500642_0000163 3300053130 Bacteria 27680
191 Ga0500658_0067461 3300053134 Bacteria 1502
192 Ga0500568_0010883 3300053139 Bacteria 4242
193 Ga0500577_0117782 3300053142 Bacteria 1103
194 Ga0500604_0002041 3300053151 Bacteria 5576
195 Ga0500616_0000715 3300053153 Bacteria 38448
196 Ga0500622_0054722 3300053156 Bacteria 2046
197 Ga0500609_000499 3300053731 Bacteria 5865
198 Ga0500609_001951 3300053731 Bacteria 2976
199 Ga0501084_0047548 3300054114 Bacteria 3593
200 Ga0501084_0343584 3300054114 Bacteria 1260
201 Ga0501084_0488402 3300054114 Bacteria 1041
202 Ga0501082_0014121 3300060353 Bacteria 6871
203 Ga0501082_0033910 3300060353 Bacteria 4403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0229712 Ga0501073_0229712_581_1267 227
2 3300053142 Ga0500577_0117782 Ga0500577_0117782_391_1077 227
3 3300041491 Ga0451833_0849805 Ga0451833_0849805_402_1091 229
4 3300049588 Ga0501072_0490789 Ga0501072_0490789_245_955 235
5 3300049744 Ga0501083_0319306 Ga0501083_0319306_253_996 246
6 3300050509 nmdc:mga0qj67_678900_c1 nmdc:mga0qj67_678900_c1_32_787 251
7 iso_pu_bacteria 2876808645 2876815995 259
8 iso_pu_bacteria 2879110137 2879119094 259
9 3300049576 Ga0501040_0043539 Ga0501040_0043539_23_814 262
10 3300049587 Ga0501071_0207610 Ga0501071_0207610_11_802 262
11 3300048924 Ga0496121_0254472 Ga0496121_0254472_31_822 263
12 3300048913 Ga0496110_0037729 Ga0496110_0037729_2082_2912 275
13 3300049589 Ga0501073_0009620 Ga0501073_0009620_4911_5741 275
14 3300005544 Ga0070686_100131653 Ga0070686_1001316532 277
15 3300045051 Ga0451576_0000458 Ga0451576_0000458_53133_53969 277
16 3300031456 Ga0307513_10114998 Ga0307513_101149982 278
17 iso_pu_bacteria 2643221634 2644194219 278
18 iso_pu_bacteria 2837651117 2837652024 278
19 iso_pu_bacteria 2821443989 2821450898 279
20 iso_pu_bacteria 2844533157 2844533266 279
21 iso_pu_bacteria 8006964411 8006971886 279
22 3300003187 JGI25151J46595_10016496 JGI25151J46595_100164963 280
23 3300025294 Ga0209025_1000180 Ga0209025_100018091 280
24 3300031251 Ga0265327_10015016 Ga0265327_100150164 280
25 3300003215 JGI25153J46596_10000019 JGI25153J46596_10000019104 281
26 3300005436 Ga0070713_100369622 Ga0070713_1003696221 281
27 3300005546 Ga0070696_100135084 Ga0070696_1001350842 281
28 3300005614 Ga0068856_100670852 Ga0068856_1006708521 281
29 3300005617 Ga0068859_100017007 Ga0068859_1000170079 281
30 3300005841 Ga0068863_100003634 Ga0068863_1000036348 281
31 3300005937 Ga0081455_10107856 Ga0081455_101078562 281
32 3300005983 Ga0081540_1022559 Ga0081540_10225592 281
33 3300005983 Ga0081540_1046446 Ga0081540_10464462 281
34 3300009148 Ga0105243_10825336 Ga0105243_108253361 281
35 3300014326 Ga0157380_10046124 Ga0157380_100461243 281
36 3300021361 Ga0213872_10088039 Ga0213872_100880391 281
37 3300025297 Ga0209758_1000028 Ga0209758_1000028304 281
38 3300025298 Ga0209050_1004780 Ga0209050_10047804 281
39 3300025304 Ga0209257_1000955 Ga0209257_100095515 281
40 3300025304 Ga0209257_1034537 Ga0209257_10345372 281
41 3300025304 Ga0209257_1063816 Ga0209257_10638162 281
42 3300025913 Ga0207695_10102863 Ga0207695_101028634 281
43 3300025928 Ga0207700_10407457 Ga0207700_104074572 281
44 3300031456 Ga0307513_10203825 Ga0307513_102038253 281
45 3300031456 Ga0307513_10215991 Ga0307513_102159912 281
46 3300031456 Ga0307513_10334365 Ga0307513_103343652 281
47 3300031616 Ga0307508_10090610 Ga0307508_100906102 281
48 3300039447 Ga0436361_0576226 Ga0436361_0576226_513_1361 281
49 3300039450 Ga0436363_0937045 Ga0436363_0937045_1134_2036 281
50 3300039450 Ga0436363_1668959 Ga0436363_1668959_3071_3919 281
51 3300042013 Ga0439456_009451 Ga0439456_009451_523_1371 281
52 3300047472 Ga0495686_0072247 Ga0495686_0072247_1096_1944 281
53 3300048904 Ga0496101_0144022 Ga0496101_0144022_883_1737 281
54 3300048905 Ga0496102_0079408 Ga0496102_0079408_479_1333 281
55 3300048912 Ga0496109_0164464 Ga0496109_0164464_472_1320 281
56 3300048918 Ga0496115_0086256 Ga0496115_0086256_1578_2432 281
57 3300049568 Ga0501031_0070735 Ga0501031_0070735_1172_2020 281
58 3300049571 Ga0501034_0192432 Ga0501034_0192432_276_1124 281
59 3300049571 Ga0501034_0547448 Ga0501034_0547448_64_912 281
60 3300049572 Ga0501036_0168755 Ga0501036_0168755_466_1314 281
61 3300049573 Ga0501037_0032337 Ga0501037_0032337_1095_1943 281
62 3300049573 Ga0501037_0074532 Ga0501037_0074532_925_1773 281
63 3300049573 Ga0501037_0170480 Ga0501037_0170480_591_1439 281
64 3300049574 Ga0501038_0026322 Ga0501038_0026322_3423_4271 281
65 3300049574 Ga0501038_0430798 Ga0501038_0430798_97_945 281
66 3300049579 Ga0501043_0044843 Ga0501043_0044843_1712_2560 281
67 3300049580 Ga0501046_0182039 Ga0501046_0182039_599_1447 281
68 3300049581 Ga0501047_0005126 Ga0501047_0005126_6633_7481 281
69 3300049581 Ga0501047_0051455 Ga0501047_0051455_2019_2867 281
70 3300049581 Ga0501047_0258904 Ga0501047_0258904_623_1471 281
71 3300049584 Ga0501068_0010627 Ga0501068_0010627_2946_3794 281
72 3300049586 Ga0501070_0034086 Ga0501070_0034086_919_1767 281
73 3300049586 Ga0501070_0137336 Ga0501070_0137336_1091_1939 281
74 3300049586 Ga0501070_0185761 Ga0501070_0185761_542_1390 281
75 3300049589 Ga0501073_0003556 Ga0501073_0003556_5959_6807 281
76 3300049592 Ga0501076_0429426 Ga0501076_0429426_210_1058 281
77 3300049742 Ga0501080_0015041 Ga0501080_0015041_2001_2849 281
78 3300049742 Ga0501080_0070722 Ga0501080_0070722_2031_2879 281
79 3300049744 Ga0501083_0006741 Ga0501083_0006741_2669_3517 281
80 3300049744 Ga0501083_0185557 Ga0501083_0185557_316_1164 281
81 3300049822 Ga0501035_0020889 Ga0501035_0020889_621_1469 281
82 3300049822 Ga0501035_0144725 Ga0501035_0144725_1162_2010 281
83 3300049822 Ga0501035_0204873 Ga0501035_0204873_829_1677 281
84 3300049822 Ga0501035_0309587 Ga0501035_0309587_32_880 281
85 3300049823 Ga0501044_0020130 Ga0501044_0020130_4952_5800 281
86 3300049823 Ga0501044_0021798 Ga0501044_0021798_2498_3346 281
87 3300049823 Ga0501044_0136165 Ga0501044_0136165_1052_1900 281
88 3300049823 Ga0501044_0164221 Ga0501044_0164221_415_1263 281
89 3300049823 Ga0501044_0286637 Ga0501044_0286637_584_1432 281
90 3300053093 Ga0500651_0064837 Ga0500651_0064837_906_1754 281
91 3300053093 Ga0500651_0133103 Ga0500651_0133103_595_1443 281
92 3300053096 Ga0500641_0002135 Ga0500641_0002135_257_1105 281
93 3300053103 Ga0500555_032676 Ga0500555_032676_169_1017 281
94 3300053119 Ga0500595_000302 Ga0500595_000302_28873_29721 281
95 3300053130 Ga0500642_0000163 Ga0500642_0000163_21707_22555 281
96 3300053134 Ga0500658_0067461 Ga0500658_0067461_601_1449 281
97 3300053139 Ga0500568_0010883 Ga0500568_0010883_836_1684 281
98 3300053151 Ga0500604_0002041 Ga0500604_0002041_2683_3531 281
99 3300053153 Ga0500616_0000715 Ga0500616_0000715_2512_3360 281
100 3300053156 Ga0500622_0054722 Ga0500622_0054722_231_1079 281
101 3300053731 Ga0500609_000499 Ga0500609_000499_1973_2821 281
102 3300053731 Ga0500609_001951 Ga0500609_001951_1603_2451 281
103 3300054114 Ga0501084_0343584 Ga0501084_0343584_332_1180 281
104 3300054114 Ga0501084_0488402 Ga0501084_0488402_146_994 281
105 3300060353 Ga0501082_0014121 Ga0501082_0014121_4613_5461 281
106 3300005468 Ga0070707_100102006 Ga0070707_1001020063 282
107 3300005518 Ga0070699_100065730 Ga0070699_1000657302 282
108 3300005937 Ga0081455_10337367 Ga0081455_103373671 282
109 3300005981 Ga0081538_10045182 Ga0081538_100451821 282
110 3300009174 Ga0105241_10563415 Ga0105241_105634152 282
111 3300009545 Ga0105237_10007440 Ga0105237_1000744014 282
112 3300025972 Ga0207668_10457277 Ga0207668_104572771 282
113 3300028380 Ga0268265_10250607 Ga0268265_102506071 282
114 3300031691 Ga0316579_10072141 Ga0316579_100721411 282
115 3300035695 Ga0373927_0024800 Ga0373927_0024800_465_1313 282
116 3300037068 Ga0373925_0021399 Ga0373925_0021399_2102_2950 282
117 3300041505 Ga0451849_1534819 Ga0451849_1534819_392_1240 282
118 3300042435 Ga0439434_0058735 Ga0439434_0058735_175_1026 282
119 3300048920 Ga0496117_0080393 Ga0496117_0080393_590_1468 282
120 3300048925 Ga0496122_0171984 Ga0496122_0171984_379_1257 282
121 3300048927 Ga0496124_0014522 Ga0496124_0014522_5611_6489 282
122 3300048928 Ga0496125_0026096 Ga0496125_0026096_936_1814 282
123 3300048929 Ga0496126_0000360 Ga0496126_0000360_15494_16372 282
124 3300049573 Ga0501037_0173912 Ga0501037_0173912_609_1460 282
125 3300049574 Ga0501038_0020478 Ga0501038_0020478_2781_3632 282
126 3300049575 Ga0501039_0354013 Ga0501039_0354013_231_1082 282
127 3300049577 Ga0501041_0010340 Ga0501041_0010340_1128_1979 282
128 3300049578 Ga0501042_0004682 Ga0501042_0004682_813_1664 282
129 3300049582 Ga0501048_0015560 Ga0501048_0015560_2141_2992 282
130 3300049584 Ga0501068_0163034 Ga0501068_0163034_453_1304 282
131 3300049590 Ga0501074_0028003 Ga0501074_0028003_993_1844 282
132 3300049591 Ga0501075_0017031 Ga0501075_0017031_1461_2312 282
133 3300049592 Ga0501076_0020827 Ga0501076_0020827_3260_4111 282
134 3300049741 Ga0501079_0055864 Ga0501079_0055864_1502_2353 282
135 3300049742 Ga0501080_0311596 Ga0501080_0311596_123_974 282
136 3300049743 Ga0501081_0051520 Ga0501081_0051520_1161_2012 282
137 3300049822 Ga0501035_0120592 Ga0501035_0120592_448_1299 282
138 3300049824 Ga0501045_0009889 Ga0501045_0009889_3470_4321 282
139 3300053103 Ga0500555_017177 Ga0500555_017177_280_1131 282
140 3300054114 Ga0501084_0047548 Ga0501084_0047548_79_930 282
141 3300060353 Ga0501082_0033910 Ga0501082_0033910_3220_4071 282
142 3300002987 JGI25159J45721_1006555 JGI25159J45721_10065554 283
143 3300003187 JGI25151J46595_10000193 JGI25151J46595_1000019328 283
144 3300003215 JGI25153J46596_10002272 JGI25153J46596_100022728 283
145 3300003320 rootH2_10125515 rootH2_101255152 283
146 3300003320 rootH2_10256735 rootH2_102567352 283
147 3300003322 rootL2_10097807 rootL2_100978074 283
148 3300005356 Ga0070674_100017239 Ga0070674_1000172392 283
149 3300005441 Ga0070700_100085657 Ga0070700_1000856572 283
150 3300005518 Ga0070699_100215646 Ga0070699_1002156463 283
151 3300005545 Ga0070695_100326737 Ga0070695_1003267371 283
152 3300005546 Ga0070696_100178821 Ga0070696_1001788211 283
153 3300005618 Ga0068864_100580388 Ga0068864_1005803881 283
154 3300005719 Ga0068861_100193438 Ga0068861_1001934383 283
155 3300005719 Ga0068861_100394922 Ga0068861_1003949222 283
156 3300005841 Ga0068863_100042801 Ga0068863_1000428012 283
157 3300005843 Ga0068860_100000797 Ga0068860_10000079734 283
158 3300005844 Ga0068862_100234054 Ga0068862_1002340542 283
159 3300005844 Ga0068862_100451175 Ga0068862_1004511752 283
160 3300006038 Ga0075365_10162120 Ga0075365_101621202 283
161 3300006048 Ga0075363_100068893 Ga0075363_1000688932 283
162 3300006051 Ga0075364_10002231 Ga0075364_100022312 283
163 3300006177 Ga0075362_10006535 Ga0075362_100065353 283
164 3300006177 Ga0075362_10039059 Ga0075362_100390593 283
165 3300006177 Ga0075362_10042871 Ga0075362_100428712 283
166 3300006844 Ga0075428_100014634 Ga0075428_1000146342 283
167 3300006844 Ga0075428_100537139 Ga0075428_1005371391 283
168 3300006847 Ga0075431_100715218 Ga0075431_1007152181 283
169 3300009094 Ga0111539_10000051 Ga0111539_1000005159 283
170 3300009147 Ga0114129_10036003 Ga0114129_100360032 283
171 3300009147 Ga0114129_10294760 Ga0114129_102947603 283
172 3300009553 Ga0105249_10081559 Ga0105249_100815593 283
173 3300010375 Ga0105239_10274990 Ga0105239_102749902 283
174 3300013306 Ga0163162_10395836 Ga0163162_103958362 283
175 3300014968 Ga0157379_10052586 Ga0157379_100525864 283
176 3300025284 Ga0209130_1001013 Ga0209130_100101318 283
177 3300025292 Ga0209676_1010524 Ga0209676_10105243 283
178 3300025294 Ga0209025_1000061 Ga0209025_1000061195 283
179 3300025294 Ga0209025_1043396 Ga0209025_10433962 283
180 3300025297 Ga0209758_1005524 Ga0209758_10055249 283
181 3300025297 Ga0209758_1007934 Ga0209758_10079344 283
182 3300025302 Ga0207426_1000451 Ga0207426_100045118 283
183 3300025933 Ga0207706_10007483 Ga0207706_100074832 283
184 3300025935 Ga0207709_10128446 Ga0207709_101284462 283
185 3300025942 Ga0207689_10004859 Ga0207689_100048593 283
186 3300025972 Ga0207668_10053025 Ga0207668_100530253 283
187 3300025972 Ga0207668_10113245 Ga0207668_101132452 283
188 3300026035 Ga0207703_10172816 Ga0207703_101728162 283
189 3300026075 Ga0207708_10057619 Ga0207708_100576193 283
190 3300026088 Ga0207641_10039658 Ga0207641_100396582 283
191 3300026118 Ga0207675_100069929 Ga0207675_1000699292 283
192 3300026118 Ga0207675_100116065 Ga0207675_1001160653 283
193 3300027907 Ga0207428_10003036 Ga0207428_100030369 283
194 3300028380 Ga0268265_10034092 Ga0268265_100340922 283
195 3300028380 Ga0268265_10089789 Ga0268265_100897892 283
196 3300028381 Ga0268264_10000020 Ga0268264_10000020441 283
197 3300031548 Ga0307408_100253106 Ga0307408_1002531062 283
198 3300031824 Ga0307413_10072695 Ga0307413_100726952 283
199 3300032002 Ga0307416_100158085 Ga0307416_1001580851 283
200 3300039062 Ga0400483_017169 Ga0400483_017169_7857_8711 283
201 3300039062 Ga0400483_029441 Ga0400483_029441_4665_5522 283
202 3300039062 Ga0400483_232856 Ga0400483_232856_2051_2905 283
203 3300041456 Ga0451795_0483603 Ga0451795_0483603_143_994 283
204 3300048903 Ga0496100_0290849 Ga0496100_0290849_47_907 283
205 3300048905 Ga0496102_0626908 Ga0496102_0626908_69_920 283
206 3300048921 Ga0496118_0059170 Ga0496118_0059170_589_1440 283
207 3300050507 nmdc:mga05p37_127525_c1 nmdc:mga05p37_127525_c1_352_1203 283
208 3300050507 nmdc:mga05p37_130064_c1 nmdc:mga05p37_130064_c1_1666_2517 283
209 3300050511 nmdc:mga08y16_226300_c1 nmdc:mga08y16_226300_c1_106_957 283
210 3300050511 nmdc:mga08y16_237_c1 nmdc:mga08y16_237_c1_40030_40881 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

40

296

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.9388 2 281
7cj9-assembly4.cif.gz_H crystal structure of n-terminal his-tagged d-allulose 3-epimerase from methylomonas sp. with additional c-terminal residues 0.9279 1 278
5zfs-assembly1.cif.gz_B crystal structure of arthrobacter globiformis m30 sugar epimerase which can produce d-allulose from d-fructose 0.926 1 281
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.926 2 281
7cj4-assembly1.cif.gz_A crystal structure of homo dimeric d-allulose 3-epimerase from methylomonas sp. 0.9252 1 278
ID Description Score Start End Superfamily
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9388 2 281 3.20.20.150
5zfsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.926 1 281 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.926 2 281 3.20.20.150
5zfsB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9166 1 281 3.20.20.150
4xslC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.912 2 283 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A530ZY04-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9898 1 203 GO:0016853
AF-A0A7V5Q007-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9853 1 182 GO:0016853
AF-A0A659YMW3-F1-model_v4 deleted 0.9845 1 231
AF-A0A800E835-F1-model_v4 deleted 0.9821 1 223
AF-A0A2G2D8Z7-F1-model_v4 Isomerase 0.9803 1 162 GO:0016853

Feature Viewer

pLDDT pTM Quality
91.36 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map