F320825

General Info

Members Datasets Scaffolds Average Seq Length
210 153 210 179

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0020047|Ga0496105_0020047_3024_3776
Length 214
Sequence MARGKKGPRAVPARGEDSQGSRFSIPKPKGPLGEVYALAVTQAWVAKPFQIPSGSMEPTLDIGQRIIVNRLSYHLGDPDLGDIVVFHPPAGAETDECGAQINVSEPCPMPTADQSGQYYVKRLVAGPGDTLSIRDGHPVVNGVEKTDEPYARPCGVNIRCNMPTTITIPPDHYFMMGDNRGESDDSRVWGPVPRDWIVGKAFASYWPLDRWELF

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.57
Nodule 0
Rhizoplane 11.43
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001646 3300001977 Bacteria 3580
2 JGI24740J21852_10001258 3300001979 Bacteria 11467
3 JGI24034J26672_10004974 3300002239 Bacteria 1896
4 JGI24742J22300_10003165 3300002244 Bacteria 2661
5 Ga0070683_100013302 3300005329 Bacteria 7174
6 Ga0070683_100050434 3300005329 Bacteria 3853
7 Ga0070683_100070232 3300005329 Bacteria 3267
8 Ga0070677_10000010 3300005333 Bacteria 64402
9 Ga0070680_100066128 3300005336 Bacteria 2964
10 Ga0070682_100626750 3300005337 Bacteria 853
11 Ga0070691_10000007 3300005341 Bacteria 64190
12 Ga0070691_10004548 3300005341 Bacteria 6298
13 Ga0070668_100357305 3300005347 Bacteria 1238
14 Ga0070674_100000005 3300005356 Bacteria 168443
15 Ga0070711_100076149 3300005439 Bacteria 2378
16 Ga0070663_100003274 3300005455 Bacteria 9326
17 Ga0070681_10050311 3300005458 Bacteria 4158
18 Ga0070679_100000244 3300005530 Bacteria 45433
19 Ga0070679_100005041 3300005530 Bacteria 12189
20 Ga0070684_100039446 3300005535 Bacteria 4062
21 Ga0070684_100170832 3300005535 Bacteria 1975
22 Ga0070665_100000040 3300005548 Bacteria 305480
23 Ga0070664_100133670 3300005564 Bacteria 2180
24 Ga0068854_100007581 3300005578 Bacteria 6939
25 Ga0068854_100953625 3300005578 Bacteria 757
26 Ga0068856_100026306 3300005614 Bacteria 5674
27 Ga0068859_100770324 3300005617 Bacteria 1051
28 Ga0068866_10000123 3300005718 Bacteria 33904
29 Ga0068861_100164547 3300005719 Bacteria 1833
30 Ga0068863_100051936 3300005841 Bacteria 3885
31 Ga0068863_100146588 3300005841 Bacteria 2258
32 Ga0068858_100001211 3300005842 Bacteria 26757
33 Ga0068860_100152231 3300005843 Bacteria 2228
34 Ga0075365_10214679 3300006038 Bacteria 1349
35 Ga0075365_10386325 3300006038 Bacteria 988
36 Ga0075365_10468673 3300006038 Bacteria 890
37 Ga0075364_10077575 3300006051 Bacteria 2193
38 Ga0075364_10180971 3300006051 Bacteria 1426
39 Ga0075364_10611761 3300006051 Bacteria 744
40 Ga0075433_10000370 3300006852 Bacteria 28281
41 Ga0097620_100770404 3300006931 Bacteria 1051
42 Ga0105240_10090918 3300009093 Bacteria 3730
43 Ga0111539_10404647 3300009094 Bacteria 1590
44 Ga0111539_10948597 3300009094 Bacteria 1000
45 Ga0105245_10000444 3300009098 Bacteria 37905
46 Ga0105247_10001040 3300009101 Bacteria 20849
47 Ga0114129_10115148 3300009147 Bacteria 3706
48 Ga0105243_10431282 3300009148 Bacteria 1232
49 Ga0105242_10000427 3300009176 Bacteria 33600
50 Ga0105242_10003430 3300009176 Bacteria 12322
51 Ga0105242_10031828 3300009176 Bacteria 4216
52 Ga0105238_10000009 3300009551 Bacteria 288729
53 Ga0105249_10000050 3300009553 Bacteria 169617
54 Ga0157375_10000286 3300013308 Bacteria 46112
55 Ga0163163_10454449 3300014325 Bacteria 1341
56 Ga0157380_10001651 3300014326 Bacteria 14700
57 Ga0157379_10134869 3300014968 Bacteria 2224
58 Ga0163161_10000021 3300017792 Bacteria 208779
59 Ga0207682_10000013 3300025893 Bacteria 83196
60 Ga0207642_10000154 3300025899 Bacteria 19565
61 Ga0207710_10001339 3300025900 Bacteria 12370
62 Ga0207707_10038898 3300025912 Bacteria 4158
63 Ga0207695_10101671 3300025913 Bacteria 2868
64 Ga0207663_10006932 3300025916 Bacteria 5840
65 Ga0207652_10000395 3300025921 Bacteria 45460
66 Ga0207652_10004379 3300025921 Bacteria 11507
67 Ga0207694_10000004 3300025924 Bacteria 967075
68 Ga0207687_10000013 3300025927 Bacteria 299826
69 Ga0207687_10078749 3300025927 Bacteria 2374
70 Ga0207686_10000061 3300025934 Bacteria 97978
71 Ga0207686_10004139 3300025934 Bacteria 7782
72 Ga0207686_10091132 3300025934 Bacteria 2013
73 Ga0207686_10189505 3300025934 Bacteria 1465
74 Ga0207669_10000006 3300025937 Bacteria 176348
75 Ga0207689_10133897 3300025942 Bacteria 2040
76 Ga0207661_10008569 3300025944 Bacteria 7310
77 Ga0207661_10035280 3300025944 Bacteria 3896
78 Ga0207661_10132018 3300025944 Bacteria 2140
79 Ga0207712_10000019 3300025961 Bacteria 317060
80 Ga0207668_10131036 3300025972 Bacteria 1914
81 Ga0207703_10000078 3300026035 Bacteria 115634
82 Ga0207639_10000615 3300026041 Bacteria 24547
83 Ga0207639_10249119 3300026041 Bacteria 1548
84 Ga0207678_10004900 3300026067 Bacteria 12024
85 Ga0207702_10773896 3300026078 Bacteria 948
86 Ga0207641_10121074 3300026088 Bacteria 2335
87 Ga0207648_10000669 3300026089 Bacteria 38380
88 Ga0207675_100238712 3300026118 Bacteria 1756
89 Ga0268266_10000045 3300028379 Bacteria 312955
90 Ga0268264_10127432 3300028381 Bacteria 2252
91 Ga0265319_1000073 3300028563 Bacteria 81138
92 Ga0265338_10000464 3300028800 Bacteria 72259
93 Ga0265325_10020702 3300031241 Bacteria 3622
94 Ga0265331_10017974 3300031250 Bacteria 3676
95 Ga0373955_0099795 3300035172 Bacteria 1665
96 Ga0373937_0040415 3300036401 Bacteria 4251
97 Ga0451849_0414404 3300041505 Bacteria 929
98 Ga0451853_2169840 3300041512 Bacteria 5718
99 Ga0466963_0000157 3300044694 Bacteria 27251
100 Ga0495592_0000510 3300046454 Bacteria 28216
101 Ga0495592_0050344 3300046454 Bacteria 3095
102 Ga0495603_0000389 3300046455 Bacteria 24062
103 Ga0495591_030647 3300046458 Bacteria 1622
104 Ga0495629_0005767 3300046459 Bacteria 9243
105 Ga0495629_0135159 3300046459 Bacteria 1717
106 Ga0495641_0000050 3300046461 Bacteria 73259
107 Ga0495653_0053044 3300046463 Bacteria 3104
108 Ga0495653_0180685 3300046463 Bacteria 1448
109 Ga0495653_0363502 3300046463 Bacteria 928
110 Ga0495662_0006289 3300046476 Bacteria 5937
111 Ga0495608_0023747 3300046511 Bacteria 4197
112 Ga0495608_0030751 3300046511 Bacteria 3633
113 Ga0495618_0000134 3300046514 Bacteria 53541
114 Ga0495620_0000227 3300046515 Bacteria 42462
115 Ga0495628_0006112 3300046516 Bacteria 10532
116 Ga0495628_0035320 3300046516 Bacteria 4018
117 Ga0495628_0056857 3300046516 Bacteria 3079
118 Ga0495628_0125786 3300046516 Bacteria 1964
119 Ga0495630_0019550 3300046517 Bacteria 4980
120 Ga0495644_0000663 3300046523 Bacteria 14401
121 Ga0495640_0057734 3300046533 Bacteria 2648
122 Ga0495640_0272610 3300046533 Bacteria 1055
123 Ga0495586_0001646 3300046535 Bacteria 12255
124 Ga0495598_0095508 3300046537 Bacteria 976
125 Ga0495667_0000047 3300046559 Bacteria 117718
126 Ga0495667_0112944 3300046559 Bacteria 1755
127 Ga0495656_0000261 3300046615 Bacteria 18592
128 Ga0495634_0000034 3300046642 Bacteria 106338
129 Ga0495634_0004949 3300046642 Bacteria 10298
130 Ga0495635_0000034 3300046663 Bacteria 96408
131 Ga0495635_0424983 3300046663 Bacteria 880
132 Ga0495657_0364561 3300046675 Bacteria 853
133 Ga0495647_0000016 3300046681 Bacteria 86316
134 Ga0495669_0001980 3300046684 Bacteria 8406
135 Ga0495669_0024995 3300046684 Bacteria 2603
136 Ga0495613_0000083 3300046689 Bacteria 90138
137 Ga0495624_0000024 3300046690 Bacteria 98577
138 Ga0495649_0001460 3300046694 Bacteria 17795
139 Ga0495600_0000556 3300046809 Bacteria 19374
140 Ga0495674_0000019 3300047319 Bacteria 185107
141 Ga0495674_0510314 3300047319 Bacteria 961
142 Ga0495676_0014753 3300047321 Bacteria 6978
143 Ga0495680_0000266 3300047322 Bacteria 57995
144 Ga0495680_0000312 3300047322 Bacteria 54495
145 Ga0495680_0003422 3300047322 Bacteria 15659
146 Ga0495686_0016136 3300047472 Bacteria 5076
147 Ga0495593_0045570 3300047673 Bacteria 2340
148 Ga0495593_0084102 3300047673 Bacteria 1643
149 Ga0495614_0054709 3300048089 Bacteria 1712
150 Ga0496100_0000010 3300048903 Bacteria 205204
151 Ga0496101_0000025 3300048904 Bacteria 205204
152 Ga0496102_0000081 3300048905 Bacteria 139266
153 Ga0496103_0000031 3300048906 Bacteria 204016
154 Ga0496104_0000004 3300048907 Bacteria 641830
155 Ga0496104_0000009 3300048907 Bacteria 488055
156 Ga0496105_0000001 3300048908 Bacteria 1328178
157 Ga0496105_0000007 3300048908 Bacteria 339658
158 Ga0496105_0020047 3300048908 Bacteria 5397
159 Ga0496106_0000012 3300048909 Bacteria 205158
160 Ga0496107_0000010 3300048910 Bacteria 205188
161 Ga0496108_0000001 3300048911 Bacteria 919044
162 Ga0496108_0000055 3300048911 Bacteria 125202
163 Ga0496108_0236914 3300048911 Bacteria 1587
164 Ga0496109_0000004 3300048912 Bacteria 404818
165 Ga0496109_0000043 3300048912 Bacteria 134649
166 Ga0496110_0201402 3300048913 Bacteria 1809
167 Ga0496110_0404323 3300048913 Bacteria 1245
168 Ga0496111_0807131 3300048914 Bacteria 679
169 Ga0496113_0095300 3300048916 Bacteria 2300
170 Ga0496114_0000133 3300048917 Bacteria 53994
171 Ga0496114_0696361 3300048917 Bacteria 891
172 Ga0496115_0000860 3300048918 Bacteria 22048
173 Ga0496115_0430567 3300048918 Bacteria 1068
174 Ga0496117_0215705 3300048920 Bacteria 1072
175 Ga0496118_0366494 3300048921 Bacteria 762
176 Ga0496126_0009840 3300048929 Bacteria 10120
177 Ga0496126_0087346 3300048929 Bacteria 2747
178 Ga0501031_0002883 3300049568 Bacteria 10991
179 Ga0501039_0672452 3300049575 Bacteria 810
180 Ga0501042_0048010 3300049578 Bacteria 3044
181 Ga0501042_0401197 3300049578 Bacteria 993
182 Ga0501068_0050310 3300049584 Bacteria 2519
183 Ga0501070_0172392 3300049586 Bacteria 1782
184 Ga0501075_0002554 3300049591 Bacteria 12126
185 Ga0501075_0450409 3300049591 Bacteria 981
186 Ga0501076_0048189 3300049592 Bacteria 3369
187 Ga0501076_0387323 3300049592 Bacteria 1149
188 Ga0501081_0382187 3300049743 Bacteria 1041
189 nmdc:mga03n38_37004_c1 3300050490 Bacteria 2102
190 nmdc:mga00v17_297722_c1 3300050491 Bacteria 1048
191 nmdc:mga00v17_50260_c1 3300050491 Bacteria 2532
192 nmdc:mga0yw44_109989_c1 3300050492 Bacteria 1765
193 nmdc:mga0yw44_560720_c1 3300050492 Bacteria 776
194 nmdc:mga0yw44_643319_c1 3300050492 Bacteria 721
195 nmdc:mga0yw44_670209_c1 3300050492 Bacteria 705
196 nmdc:mga06z11_198780_c1 3300050494 Bacteria 1163
197 nmdc:mga05p37_597963_c1 3300050507 Bacteria 1246
198 nmdc:mga08y16_1325144_c1 3300050511 Bacteria 686
199 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
200 Ga0495601_0000440 3300053077 Bacteria 21764
201 Ga0495612_0000906 3300053078 Bacteria 12126
202 Ga0495655_0000006 3300053083 Bacteria 201200
203 Ga0495595_0000141 3300053084 Bacteria 29805
204 Ga0495619_0000010 3300053085 Bacteria 302390
205 Ga0495619_0126054 3300053085 Bacteria 1757
206 Ga0500566_0007328 3300053094 Bacteria 6534
207 Ga0500554_140198 3300053102 Bacteria 817
208 Ga0500614_001295 3300053123 Bacteria 6038
209 Ga0500628_000060 3300053129 Bacteria 32734
210 Ga0501084_0243539 3300054114 Bacteria 1518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046458 Ga0495591_030647 Ga0495591_030647_340_828 156
2 3300006051 Ga0075364_10077575 Ga0075364_100775752 157
3 3300053102 Ga0500554_140198 Ga0500554_140198_220_702 157
4 3300005329 Ga0070683_100050434 Ga0070683_1000504342 158
5 3300005337 Ga0070682_100626750 Ga0070682_1006267502 158
6 3300009101 Ga0105247_10001040 Ga0105247_100010409 158
7 3300009176 Ga0105242_10003430 Ga0105242_100034309 158
8 3300017792 Ga0163161_10000021 Ga0163161_1000002140 158
9 3300025900 Ga0207710_10001339 Ga0207710_100013395 158
10 3300025934 Ga0207686_10004139 Ga0207686_100041395 158
11 3300025944 Ga0207661_10035280 Ga0207661_100352803 158
12 3300025972 Ga0207668_10131036 Ga0207668_101310362 158
13 3300026089 Ga0207648_10000669 Ga0207648_1000066912 158
14 3300035172 Ga0373955_0099795 Ga0373955_0099795_1168_1653 158
15 3300036401 Ga0373937_0040415 Ga0373937_0040415_3530_4015 158
16 3300046454 Ga0495592_0000510 Ga0495592_0000510_16714_17196 158
17 3300046455 Ga0495603_0000389 Ga0495603_0000389_11801_12283 158
18 3300046514 Ga0495618_0000134 Ga0495618_0000134_17799_18281 158
19 3300046515 Ga0495620_0000227 Ga0495620_0000227_14254_14742 158
20 3300046516 Ga0495628_0056857 Ga0495628_0056857_1320_1802 158
21 3300046517 Ga0495630_0019550 Ga0495630_0019550_3292_3780 158
22 3300046533 Ga0495640_0272610 Ga0495640_0272610_549_1031 158
23 3300046663 Ga0495635_0000034 Ga0495635_0000034_681_1163 158
24 3300046675 Ga0495657_0364561 Ga0495657_0364561_63_545 158
25 3300046681 Ga0495647_0000016 Ga0495647_0000016_61149_61631 158
26 3300046690 Ga0495624_0000024 Ga0495624_0000024_45979_46461 158
27 3300046809 Ga0495600_0000556 Ga0495600_0000556_504_986 158
28 3300047322 Ga0495680_0000312 Ga0495680_0000312_1011_1502 158
29 3300048907 Ga0496104_0000004 Ga0496104_0000004_553945_554427 158
30 3300048908 Ga0496105_0000001 Ga0496105_0000001_87404_87886 158
31 3300048911 Ga0496108_0236914 Ga0496108_0236914_11_493 158
32 3300048913 Ga0496110_0201402 Ga0496110_0201402_310_792 158
33 3300048914 Ga0496111_0807131 Ga0496111_0807131_178_660 158
34 3300049584 Ga0501068_0050310 Ga0501068_0050310_2026_2508 158
35 3300049591 Ga0501075_0002554 Ga0501075_0002554_802_1284 158
36 3300053085 Ga0495619_0126054 Ga0495619_0126054_762_1244 158
37 3300005329 Ga0070683_100013302 Ga0070683_1000133026 161
38 3300005333 Ga0070677_10000010 Ga0070677_1000001019 161
39 3300005347 Ga0070668_100357305 Ga0070668_1003573051 161
40 3300005535 Ga0070684_100039446 Ga0070684_1000394466 161
41 3300005548 Ga0070665_100000040 Ga0070665_100000040239 161
42 3300005578 Ga0068854_100007581 Ga0068854_1000075812 161
43 3300005614 Ga0068856_100026306 Ga0068856_1000263065 161
44 3300005842 Ga0068858_100001211 Ga0068858_1000012112 161
45 3300009098 Ga0105245_10000444 Ga0105245_100004446 161
46 3300009551 Ga0105238_10000009 Ga0105238_1000000983 161
47 3300025893 Ga0207682_10000013 Ga0207682_1000001347 161
48 3300025924 Ga0207694_10000004 Ga0207694_10000004212 161
49 3300025927 Ga0207687_10000013 Ga0207687_10000013282 161
50 3300025927 Ga0207687_10078749 Ga0207687_100787492 161
51 3300025944 Ga0207661_10008569 Ga0207661_100085695 161
52 3300026035 Ga0207703_10000078 Ga0207703_1000007859 161
53 3300026041 Ga0207639_10000615 Ga0207639_100006156 161
54 3300026041 Ga0207639_10249119 Ga0207639_102491192 161
55 3300026078 Ga0207702_10773896 Ga0207702_107738962 161
56 3300028379 Ga0268266_10000045 Ga0268266_10000045240 161
57 3300041512 Ga0451853_2169840 Ga0451853_2169840_2732_3232 161
58 3300046461 Ga0495641_0000050 Ga0495641_0000050_18382_18882 161
59 3300046463 Ga0495653_0053044 Ga0495653_0053044_28_528 161
60 3300046476 Ga0495662_0006289 Ga0495662_0006289_1667_2170 161
61 3300046516 Ga0495628_0125786 Ga0495628_0125786_1152_1652 161
62 3300046684 Ga0495669_0001980 Ga0495669_0001980_85_585 161
63 3300047322 Ga0495680_0000266 Ga0495680_0000266_10963_11463 161
64 3300047673 Ga0495593_0084102 Ga0495593_0084102_895_1395 161
65 3300048903 Ga0496100_0000010 Ga0496100_0000010_68583_69083 161
66 3300048904 Ga0496101_0000025 Ga0496101_0000025_68583_69083 161
67 3300048907 Ga0496104_0000009 Ga0496104_0000009_462729_463229 161
68 3300048908 Ga0496105_0000007 Ga0496105_0000007_24827_25327 161
69 3300048909 Ga0496106_0000012 Ga0496106_0000012_136094_136594 161
70 3300048910 Ga0496107_0000010 Ga0496107_0000010_136106_136606 161
71 3300048911 Ga0496108_0000001 Ga0496108_0000001_900846_901346 161
72 3300048912 Ga0496109_0000004 Ga0496109_0000004_154657_155157 161
73 3300048917 Ga0496114_0696361 Ga0496114_0696361_354_854 161
74 3300049578 Ga0501042_0401197 Ga0501042_0401197_142_705 161
75 3300049586 Ga0501070_0172392 Ga0501070_0172392_24_524 161
76 3300053077 Ga0495601_0000440 Ga0495601_0000440_10483_10983 161
77 3300053123 Ga0500614_001295 Ga0500614_001295_2260_2760 161
78 3300047319 Ga0495674_0510314 Ga0495674_0510314_200_724 166
79 3300001979 JGI24740J21852_10001258 JGI24740J21852_100012589 168
80 3300046559 Ga0495667_0000047 Ga0495667_0000047_15854_16366 168
81 3300047322 Ga0495680_0003422 Ga0495680_0003422_11839_12351 168
82 3300046689 Ga0495613_0000083 Ga0495613_0000083_35980_36495 169
83 3300046694 Ga0495649_0001460 Ga0495649_0001460_3973_4506 172
84 3300048916 Ga0496113_0095300 Ga0496113_0095300_498_1031 172
85 3300025942 Ga0207689_10133897 Ga0207689_101338972 174
86 3300046642 Ga0495634_0000034 Ga0495634_0000034_15922_16488 174
87 3300005617 Ga0068859_100770324 Ga0068859_1007703242 175
88 3300006931 Ga0097620_100770404 Ga0097620_1007704041 175
89 3300028381 Ga0268264_10127432 Ga0268264_101274323 175
90 3300048908 Ga0496105_0020047 Ga0496105_0020047_3024_3776 175
91 3300048920 Ga0496117_0215705 Ga0496117_0215705_84_656 175
92 3300002239 JGI24034J26672_10004974 JGI24034J26672_100049742 176
93 3300002244 JGI24742J22300_10003165 JGI24742J22300_100031654 176
94 3300005341 Ga0070691_10000007 Ga0070691_100000078 176
95 3300005719 Ga0068861_100164547 Ga0068861_1001645472 176
96 3300006038 Ga0075365_10214679 Ga0075365_102146792 176
97 3300006038 Ga0075365_10386325 Ga0075365_103863252 176
98 3300006038 Ga0075365_10468673 Ga0075365_104686732 176
99 3300006051 Ga0075364_10180971 Ga0075364_101809712 176
100 3300006051 Ga0075364_10611761 Ga0075364_106117611 176
101 3300009094 Ga0111539_10948597 Ga0111539_109485972 176
102 3300009147 Ga0114129_10115148 Ga0114129_101151486 176
103 3300026118 Ga0207675_100238712 Ga0207675_1002387122 176
104 3300046459 Ga0495629_0005767 Ga0495629_0005767_3664_4233 176
105 3300046533 Ga0495640_0057734 Ga0495640_0057734_496_1071 176
106 3300046537 Ga0495598_0095508 Ga0495598_0095508_125_688 176
107 3300047319 Ga0495674_0000019 Ga0495674_0000019_57662_58237 176
108 3300047472 Ga0495686_0016136 Ga0495686_0016136_371_943 176
109 3300048917 Ga0496114_0000133 Ga0496114_0000133_35590_36159 176
110 3300048918 Ga0496115_0000860 Ga0496115_0000860_3685_4254 176
111 3300049578 Ga0501042_0048010 Ga0501042_0048010_1184_1759 176
112 3300050490 nmdc:mga03n38_37004_c1 nmdc:mga03n38_37004_c1_833_1444 176
113 3300050491 nmdc:mga00v17_297722_c1 nmdc:mga00v17_297722_c1_301_867 176
114 3300050491 nmdc:mga00v17_50260_c1 nmdc:mga00v17_50260_c1_1476_2030 176
115 3300050492 nmdc:mga0yw44_109989_c1 nmdc:mga0yw44_109989_c1_699_1310 176
116 3300050492 nmdc:mga0yw44_560720_c1 nmdc:mga0yw44_560720_c1_31_642 176
117 3300050492 nmdc:mga0yw44_643319_c1 nmdc:mga0yw44_643319_c1_61_672 176
118 3300050492 nmdc:mga0yw44_670209_c1 nmdc:mga0yw44_670209_c1_48_614 176
119 3300050494 nmdc:mga06z11_198780_c1 nmdc:mga06z11_198780_c1_453_1064 176
120 3300050507 nmdc:mga05p37_597963_c1 nmdc:mga05p37_597963_c1_115_726 176
121 3300053094 Ga0500566_0007328 Ga0500566_0007328_736_1305 176
122 3300005341 Ga0070691_10004548 Ga0070691_100045486 177
123 3300005356 Ga0070674_100000005 Ga0070674_100000005121 177
124 3300005535 Ga0070684_100170832 Ga0070684_1001708322 177
125 3300005564 Ga0070664_100133670 Ga0070664_1001336702 177
126 3300005718 Ga0068866_10000123 Ga0068866_1000012316 177
127 3300009148 Ga0105243_10431282 Ga0105243_104312822 177
128 3300009176 Ga0105242_10031828 Ga0105242_100318286 177
129 3300013308 Ga0157375_10000286 Ga0157375_1000028639 177
130 3300014325 Ga0163163_10454449 Ga0163163_104544491 177
131 3300014326 Ga0157380_10001651 Ga0157380_100016519 177
132 3300025899 Ga0207642_10000154 Ga0207642_100001549 177
133 3300025934 Ga0207686_10091132 Ga0207686_100911323 177
134 3300025934 Ga0207686_10189505 Ga0207686_101895051 177
135 3300025937 Ga0207669_10000006 Ga0207669_1000000672 177
136 3300041505 Ga0451849_0414404 Ga0451849_0414404_104_673 177
137 3300046454 Ga0495592_0050344 Ga0495592_0050344_1956_2567 177
138 3300046459 Ga0495629_0135159 Ga0495629_0135159_855_1418 177
139 3300046463 Ga0495653_0363502 Ga0495653_0363502_345_896 177
140 3300046511 Ga0495608_0023747 Ga0495608_0023747_1617_2168 177
141 3300046511 Ga0495608_0030751 Ga0495608_0030751_1240_1791 177
142 3300046516 Ga0495628_0006112 Ga0495628_0006112_4344_4895 177
143 3300046516 Ga0495628_0035320 Ga0495628_0035320_2430_2981 177
144 3300046523 Ga0495644_0000663 Ga0495644_0000663_8282_8845 177
145 3300046559 Ga0495667_0112944 Ga0495667_0112944_1069_1620 177
146 3300046615 Ga0495656_0000261 Ga0495656_0000261_15427_15990 177
147 3300046642 Ga0495634_0004949 Ga0495634_0004949_8745_9299 177
148 3300046663 Ga0495635_0424983 Ga0495635_0424983_193_756 177
149 3300046684 Ga0495669_0024995 Ga0495669_0024995_1201_1761 177
150 3300047673 Ga0495593_0045570 Ga0495593_0045570_14_568 177
151 3300048089 Ga0495614_0054709 Ga0495614_0054709_1142_1693 177
152 3300048911 Ga0496108_0000055 Ga0496108_0000055_7071_7634 177
153 3300048912 Ga0496109_0000043 Ga0496109_0000043_12446_13009 177
154 3300048913 Ga0496110_0404323 Ga0496110_0404323_355_915 177
155 3300049568 Ga0501031_0002883 Ga0501031_0002883_7506_8165 177
156 3300049575 Ga0501039_0672452 Ga0501039_0672452_143_733 177
157 3300049591 Ga0501075_0450409 Ga0501075_0450409_129_719 177
158 3300049592 Ga0501076_0387323 Ga0501076_0387323_28_618 177
159 3300049743 Ga0501081_0382187 Ga0501081_0382187_91_642 177
160 3300053084 Ga0495595_0000141 Ga0495595_0000141_3185_3736 177
161 3300053085 Ga0495619_0000010 Ga0495619_0000010_136051_136602 177
162 3300054114 Ga0501084_0243539 Ga0501084_0243539_67_657 177
163 3300005578 Ga0068854_100953625 Ga0068854_1009536252 178
164 3300005841 Ga0068863_100146588 Ga0068863_1001465882 178
165 3300005843 Ga0068860_100152231 Ga0068860_1001522312 178
166 3300006852 Ga0075433_10000370 Ga0075433_1000037020 178
167 3300009094 Ga0111539_10404647 Ga0111539_104046472 178
168 3300009553 Ga0105249_10000050 Ga0105249_1000005094 178
169 3300014968 Ga0157379_10134869 Ga0157379_101348692 178
170 3300025961 Ga0207712_10000019 Ga0207712_1000001973 178
171 3300048918 Ga0496115_0430567 Ga0496115_0430567_248_886 178
172 3300048929 Ga0496126_0087346 Ga0496126_0087346_361_999 178
173 3300050511 nmdc:mga08y16_1325144_c1 nmdc:mga08y16_1325144_c1_31_600 178
174 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_58001_58636 178
175 3300009093 Ga0105240_10090918 Ga0105240_100909184 179
176 3300009176 Ga0105242_10000427 Ga0105242_1000042728 179
177 3300028563 Ga0265319_1000073 Ga0265319_100007370 179
178 3300028800 Ga0265338_10000464 Ga0265338_1000046448 179
179 3300031241 Ga0265325_10020702 Ga0265325_100207024 179
180 3300031250 Ga0265331_10017974 Ga0265331_100179744 179
181 3300047321 Ga0495676_0014753 Ga0495676_0014753_2763_3350 179
182 3300048905 Ga0496102_0000081 Ga0496102_0000081_3585_4172 179
183 3300048906 Ga0496103_0000031 Ga0496103_0000031_134172_134759 179
184 3300048921 Ga0496118_0366494 Ga0496118_0366494_133_720 179
185 3300049592 Ga0501076_0048189 Ga0501076_0048189_599_1189 179
186 3300053083 Ga0495655_0000006 Ga0495655_0000006_46340_46927 179
187 3300053129 Ga0500628_000060 Ga0500628_000060_3419_4006 179
188 3300005329 Ga0070683_100070232 Ga0070683_1000702324 180
189 3300005336 Ga0070680_100066128 Ga0070680_1000661283 180
190 3300005439 Ga0070711_100076149 Ga0070711_1000761492 180
191 3300005455 Ga0070663_100003274 Ga0070663_1000032748 180
192 3300005458 Ga0070681_10050311 Ga0070681_100503116 180
193 3300005530 Ga0070679_100000244 Ga0070679_1000002447 180
194 3300005530 Ga0070679_100005041 Ga0070679_1000050416 180
195 3300005841 Ga0068863_100051936 Ga0068863_1000519363 180
196 3300025912 Ga0207707_10038898 Ga0207707_100388986 180
197 3300025913 Ga0207695_10101671 Ga0207695_101016714 180
198 3300025916 Ga0207663_10006932 Ga0207663_100069325 180
199 3300025921 Ga0207652_10000395 Ga0207652_1000039539 180
200 3300025921 Ga0207652_10004379 Ga0207652_100043798 180
201 3300025934 Ga0207686_10000061 Ga0207686_1000006113 180
202 3300025944 Ga0207661_10132018 Ga0207661_101320183 180
203 3300026067 Ga0207678_10004900 Ga0207678_100049008 180
204 3300026088 Ga0207641_10121074 Ga0207641_101210742 180
205 3300044694 Ga0466963_0000157 Ga0466963_0000157_10948_11523 180
206 3300046463 Ga0495653_0180685 Ga0495653_0180685_516_1154 180
207 3300046535 Ga0495586_0001646 Ga0495586_0001646_7879_8436 180
208 3300048929 Ga0496126_0009840 Ga0496126_0009840_6911_7549 180
209 3300053078 Ga0495612_0000906 Ga0495612_0000906_3936_4505 180
210 3300001977 JGI24746J21847_1001646 JGI24746J21847_10016463 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

32

206

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7191 9 171
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7184 10 171
4wvj-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with an inhibitor peptide (pep3). 0.7117 10 174
4wvi-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with a substrate peptide (pep2). 0.7112 10 174
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6704 10 171
ID Description Score Start End Superfamily
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.798 9 168 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7942 5 170 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7876 9 168 2.10.109.10
af_I1M2T2_35_162_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.759 9 177 2.10.109.10
af_A0A1D6L5X4_1_100_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7448 20 170 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A6J4TWN1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8654 10 172 GO:0004252
GO:0006465
GO:0016020
AF-A0A7V4J4Z9-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8633 2 176 GO:0004252
GO:0006465
GO:0016020
AF-A0A3E0R289-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8531 2 170 GO:0004252
GO:0006465
GO:0016020
AF-A0A7C3FA48-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.853 2 174 GO:0004252
GO:0006465
GO:0016020
AF-A0A7W1MZI9-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8521 2 180 GO:0004252
GO:0006465
GO:0016020

Feature Viewer

pLDDT pTM Quality
67.27 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map