F320975

General Info

Members Datasets Scaffolds Average Seq Length
210 149 201 285

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2512564014|2512643816
Length 315
Sequence AHLSDIHFGAHDRRIVDAATAWLEERRPDLIVISGDLTQRARVEQFKAAAAWIGRLHAAGMKTLVIPGNHDVPMFDVVRRFARPLGRYKHYISRDLCPFYEDDEVAILGLNTARSLTIKDGRINHDQMDRLRATFARVAPAKTRILVTHHPLFAMPIGRGGELSEAVGRHEDAVQAACEAGVHIALAGHFHRTYALAADQMVESAGAALVIQAGTATSTRLRNDEPQSFNWLHVQRNDSIELQVIVWDGSSFQRGSHVDYRRTGNQWYVRDVSDAPAPGQSRRQDRDAAPVAQGARLVTTTGQAIGRSGDRQIRG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
5 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
10 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.71
Nodule 0
Rhizoplane 2.86
Rhizosphere 83.81
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1540189 2162886007 Bacteria 2907
2 JGI24736J21556_1001103 3300001904 Bacteria 4943
3 JGI24741J21665_1000569 3300001915 Bacteria 11239
4 JGI24752J21851_1000244 3300001976 Bacteria 7520
5 JGI24740J21852_10001407 3300001979 Bacteria 11012
6 JGI24739J22299_10000429 3300001989 Bacteria 14581
7 JGI24735J21928_10001785 3300002067 Bacteria 7554
8 Ga0065704_10078512 3300005289 Bacteria 4401
9 Ga0065704_10103635 3300005289 Bacteria 2166
10 Ga0065707_10133188 3300005295 Bacteria 1886
11 Ga0070658_10006109 3300005327 Bacteria 9767
12 Ga0070658_10076855 3300005327 Bacteria 2738
13 Ga0070670_100000016 3300005331 Bacteria 226440
14 Ga0070670_100087544 3300005331 Bacteria 2677
15 Ga0070677_10066377 3300005333 Bacteria 1504
16 Ga0068868_100001644 3300005338 Bacteria 15254
17 Ga0070660_100000465 3300005339 Bacteria 26968
18 Ga0070660_100007773 3300005339 Bacteria 7477
19 Ga0070660_100210440 3300005339 Bacteria 1579
20 Ga0070669_100237332 3300005353 Bacteria 1447
21 Ga0070659_100000032 3300005366 Bacteria 120241
22 Ga0070659_100021232 3300005366 Bacteria 4940
23 Ga0070667_100000114 3300005367 Bacteria 103351
24 Ga0070667_100000670 3300005367 Bacteria 33199
25 Ga0070701_10122678 3300005438 Bacteria 1466
26 Ga0070694_100000014 3300005444 Bacteria 84368
27 Ga0070694_100129987 3300005444 Bacteria 1818
28 Ga0070694_100610392 3300005444 Unclassified 879
29 Ga0070663_100068027 3300005455 Bacteria 2585
30 Ga0068867_100102959 3300005459 Bacteria 2183
31 Ga0070706_100075428 3300005467 Bacteria 3120
32 Ga0070686_100000332 3300005544 Bacteria 30581
33 Ga0070665_100000477 3300005548 Bacteria 57691
34 Ga0070665_100028647 3300005548 Bacteria 5608
35 Ga0068855_100335060 3300005563 Bacteria 1669
36 Ga0070664_100265368 3300005564 Bacteria 1545
37 Ga0068857_100149946 3300005577 Bacteria 2112
38 Ga0068854_100018310 3300005578 Bacteria 4701
39 Ga0068856_100020313 3300005614 Bacteria 6452
40 Ga0068864_100000017 3300005618 Bacteria 285607
41 Ga0068864_100001956 3300005618 Bacteria 16939
42 Ga0068864_100118430 3300005618 Bacteria 2365
43 Ga0068863_100000133 3300005841 Bacteria 78557
44 Ga0068863_100008551 3300005841 Bacteria 10003
45 Ga0068863_100011894 3300005841 Bacteria 8411
46 Ga0068863_100033132 3300005841 Bacteria 4922
47 Ga0068860_100000172 3300005843 Bacteria 106249
48 Ga0068862_100000010 3300005844 Bacteria 285607
49 Ga0070717_10000196 3300006028 Bacteria 42823
50 Ga0075368_10000134 3300006042 Bacteria 19630
51 Ga0075367_10000450 3300006178 Bacteria 15288
52 Ga0105251_10001854 3300009011 Bacteria 17370
53 Ga0105251_10008538 3300009011 Bacteria 6145
54 Ga0111539_10067509 3300009094 Bacteria 4223
55 Ga0111539_10084166 3300009094 Bacteria 3740
56 Ga0114129_10611386 3300009147 Bacteria 1411
57 Ga0114129_10797805 3300009147 Bacteria 1205
58 Ga0105241_10099887 3300009174 Bacteria 2305
59 Ga0105248_10659329 3300009177 Bacteria 1181
60 Ga0105237_10441960 3300009545 Bacteria 1306
61 Ga0105238_10265315 3300009551 Bacteria 1697
62 Ga0105249_10009224 3300009553 Bacteria 8631
63 Ga0105249_10046554 3300009553 Bacteria 3947
64 Ga0157373_10111735 3300013100 Bacteria 1921
65 Ga0157370_10186106 3300013104 Bacteria 1928
66 Ga0157369_10001166 3300013105 Bacteria 32796
67 Ga0157369_10374633 3300013105 Bacteria 1478
68 Ga0157380_10051388 3300014326 Bacteria 3260
69 Ga0157380_10088475 3300014326 Bacteria 2549
70 Ga0157380_10126033 3300014326 Bacteria 2177
71 Ga0157380_10175948 3300014326 Bacteria 1875
72 Ga0157380_10309015 3300014326 Bacteria 1460
73 Ga0157379_10020734 3300014968 Bacteria 5816
74 Ga0163161_10022845 3300017792 Bacteria 4406
75 Ga0209147_100446 3300025229 Bacteria 26057
76 Ga0207427_102616 3300025231 Bacteria 4609
77 Ga0209026_1003724 3300025250 Bacteria 4858
78 Ga0209759_1000546 3300025256 Bacteria 38996
79 Ga0209233_1000078 3300025261 Bacteria 348118
80 Ga0207656_10047095 3300025321 Bacteria 1852
81 Ga0207713_1002138 3300025735 Bacteria 14718
82 Ga0207713_1010700 3300025735 Bacteria 5053
83 Ga0207682_10163172 3300025893 Bacteria 1011
84 Ga0207654_10143136 3300025911 Bacteria 1527
85 Ga0207695_10420484 3300025913 Bacteria 1221
86 Ga0207671_10473745 3300025914 Bacteria 998
87 Ga0207657_10002112 3300025919 Bacteria 21483
88 Ga0207657_10028492 3300025919 Bacteria 5093
89 Ga0207657_10239507 3300025919 Bacteria 1449
90 Ga0207650_10000196 3300025925 Bacteria 69604
91 Ga0207650_10107524 3300025925 Bacteria 2155
92 Ga0207659_10113647 3300025926 Bacteria 2063
93 Ga0207687_10039586 3300025927 Bacteria 3228
94 Ga0207690_10000001 3300025932 Bacteria 807539
95 Ga0207690_10013591 3300025932 Bacteria 4894
96 Ga0207690_10118288 3300025932 Bacteria 1920
97 Ga0207669_10108923 3300025937 Bacteria 1851
98 Ga0207669_10118468 3300025937 Bacteria 1792
99 Ga0207669_10186357 3300025937 Bacteria 1493
100 Ga0207711_10000137 3300025941 Bacteria 77650
101 Ga0207667_10222830 3300025949 Bacteria 1932
102 Ga0207712_10000147 3300025961 Bacteria 72755
103 Ga0207712_10215937 3300025961 Bacteria 1530
104 Ga0207668_10096758 3300025972 Bacteria 2183
105 Ga0207640_10036207 3300025981 Bacteria 3096
106 Ga0207640_10082268 3300025981 Bacteria 2204
107 Ga0207658_10000018 3300025986 Bacteria 213853
108 Ga0207658_10000221 3300025986 Bacteria 59789
109 Ga0207677_10000344 3300026023 Bacteria 32997
110 Ga0207639_10001817 3300026041 Bacteria 14354
111 Ga0207678_10006731 3300026067 Bacteria 10191
112 Ga0207708_10053069 3300026075 Bacteria 3088
113 Ga0207702_10002245 3300026078 Bacteria 18533
114 Ga0207641_10000002 3300026088 Bacteria 981004
115 Ga0207641_10000857 3300026088 Bacteria 32190
116 Ga0207641_10006366 3300026088 Bacteria 9967
117 Ga0207641_10027614 3300026088 Bacteria 4688
118 Ga0207676_10000005 3300026095 Bacteria 698744
119 Ga0207676_10001821 3300026095 Bacteria 15610
120 Ga0207676_10121349 3300026095 Bacteria 2205
121 Ga0207674_10052826 3300026116 Bacteria 4143
122 Ga0207674_10387522 3300026116 Bacteria 1351
123 Ga0207698_10154066 3300026142 Bacteria 1999
124 Ga0209813_10000026 3300027866 Bacteria 71626
125 Ga0207428_10027085 3300027907 Bacteria 4774
126 Ga0207428_10117796 3300027907 Bacteria 2038
127 Ga0268266_10000083 3300028379 Bacteria 202393
128 Ga0268266_10091757 3300028379 Bacteria 2664
129 Ga0268265_10000003 3300028380 Bacteria 949201
130 Ga0268264_10000111 3300028381 Bacteria 204718
131 Ga0307408_100047777 3300031548 Bacteria 3066
132 Ga0307405_10038971 3300031731 Bacteria 2868
133 Ga0307413_10248686 3300031824 Bacteria 1318
134 Ga0307410_10049655 3300031852 Bacteria 2817
135 Ga0307406_10125987 3300031901 Bacteria 1789
136 Ga0307412_10000362 3300031911 Bacteria 28168
137 Ga0307412_10049036 3300031911 Bacteria 2780
138 Ga0307416_100058622 3300032002 Bacteria 3123
139 Ga0395899_0001926 3300037312 Bacteria 17111
140 Ga0395900_0073486 3300037418 Bacteria 3516
141 Ga0436365_0010969 3300039437 Bacteria 175809
142 Ga0436360_0160438 3300039438 Unclassified 1081
143 Ga0436360_0176180 3300039438 Bacteria 1518
144 Ga0436361_0064067 3300039447 Bacteria 2004
145 Ga0495617_003420 3300046452 Bacteria 5974
146 Ga0495627_000459 3300046453 Bacteria 35376
147 Ga0495627_000503 3300046453 Bacteria 32725
148 Ga0495638_0000051 3300046460 Bacteria 206003
149 Ga0495638_0011499 3300046460 Bacteria 6096
150 Ga0495583_0000498 3300046506 Bacteria 56923
151 Ga0495610_0000043 3300046512 Bacteria 158045
152 Ga0495632_0000048 3300046519 Bacteria 137883
153 Ga0495632_0002706 3300046519 Bacteria 13200
154 Ga0495637_0002220 3300046520 Bacteria 10839
155 Ga0495637_0002774 3300046520 Bacteria 9507
156 Ga0495643_0000030 3300046522 Bacteria 260229
157 Ga0495648_0000032 3300046524 Bacteria 205970
158 Ga0495648_0071336 3300046524 Bacteria 2014
159 Ga0495663_0000003 3300046525 Bacteria 362694
160 Ga0495633_0000215 3300046558 Bacteria 72445
161 Ga0495633_0000435 3300046558 Bacteria 43214
162 Ga0495633_0071334 3300046558 Bacteria 1620
163 Ga0495661_0057139 3300046665 Bacteria 2331
164 Ga0495671_0000020 3300046692 Bacteria 268306
165 Ga0495671_0000043 3300046692 Bacteria 163036
166 Ga0495673_0000076 3300047469 Bacteria 205985
167 Ga0495673_0105086 3300047469 Bacteria 1136
168 Ga0495681_0000025 3300047470 Bacteria 148216
169 Ga0495686_0019421 3300047472 Bacteria 4540
170 Ga0496103_0009384 3300048906 Bacteria 5796
171 Ga0496108_0000728 3300048911 Bacteria 25565
172 Ga0496108_0094173 3300048911 Bacteria 2549
173 Ga0496109_0040159 3300048912 Bacteria 4237
174 Ga0496113_0023886 3300048916 Bacteria 4340
175 Ga0496116_0052597 3300048919 Bacteria 2697
176 Ga0496117_0003948 3300048920 Bacteria 16776
177 Ga0496118_0001361 3300048921 Bacteria 36837
178 Ga0496121_0000610 3300048924 Bacteria 66844
179 Ga0496121_0071097 3300048924 Bacteria 2800
180 Ga0496123_0020843 3300048926 Bacteria 5113
181 Ga0496123_0183493 3300048926 Bacteria 1090
182 Ga0496124_0006701 3300048927 Bacteria 12463
183 Ga0496124_0061933 3300048927 Bacteria 3134
184 Ga0496125_0003777 3300048928 Bacteria 18008
185 Ga0496125_0030818 3300048928 Bacteria 4790
186 Ga0495678_035957 3300049459 Bacteria 2026
187 Ga0501034_0004510 3300049571 Bacteria 15480
188 Ga0501034_0035396 3300049571 Bacteria 5062
189 Ga0501223_000002 3300049663 Bacteria 154573
190 Ga0501225_0000006 3300049705 Bacteria 119739
191 Ga0501080_0202284 3300049742 Bacteria 1823
192 Ga0501083_0121402 3300049744 Unclassified 1714
193 Ga0501044_0013876 3300049823 Bacteria 8706
194 nmdc:mga06z11_19_c1 3300050494 Bacteria 76090
195 nmdc:mga04h51_14_c1 3300050495 Bacteria 77981
196 nmdc:mga08y16_23148_c1 3300050511 Bacteria 6559
197 nmdc:mga08y16_237254_c1 3300050511 Bacteria 1885
198 Ga0500555_016816 3300053103 Bacteria 2108
199 Ga0500559_0018569 3300053136 Bacteria 2938
200 Ga0500568_0001427 3300053139 Bacteria 15505
201 Ga0500624_000024 3300053157 Bacteria 114404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10163172 Ga0207682_101631722 210
2 3300049744 Ga0501083_0121402 Ga0501083_0121402_898_1695 258
3 iso_pu_bacteria 2786546940 2788437256 264
4 3300006028 Ga0070717_10000196 Ga0070717_1000019633 266
5 3300014326 Ga0157380_10309015 Ga0157380_103090152 266
6 3300039438 Ga0436360_0160438 Ga0436360_0160438_11_814 266
7 3300039438 Ga0436360_0176180 Ga0436360_0176180_362_1165 266
8 3300039447 Ga0436361_0064067 Ga0436361_0064067_178_981 266
9 3300005327 Ga0070658_10006109 Ga0070658_100061094 267
10 3300005339 Ga0070660_100007773 Ga0070660_1000077735 267
11 3300005366 Ga0070659_100021232 Ga0070659_1000212322 267
12 3300025256 Ga0209759_1000546 Ga0209759_100054624 267
13 3300025919 Ga0207657_10028492 Ga0207657_100284922 267
14 3300025932 Ga0207690_10013591 Ga0207690_100135914 267
15 3300025937 Ga0207669_10186357 Ga0207669_101863571 267
16 3300025949 Ga0207667_10222830 Ga0207667_102228303 267
17 3300026116 Ga0207674_10387522 Ga0207674_103875222 267
18 3300049571 Ga0501034_0004510 Ga0501034_0004510_9067_9891 267
19 3300049571 Ga0501034_0035396 Ga0501034_0035396_1307_2116 267
20 3300049742 Ga0501080_0202284 Ga0501080_0202284_624_1448 267
21 3300049823 Ga0501044_0013876 Ga0501044_0013876_3870_4694 267
22 3300053103 Ga0500555_016816 Ga0500555_016816_891_1709 267
23 3300009094 Ga0111539_10067509 Ga0111539_100675094 268
24 3300014326 Ga0157380_10126033 Ga0157380_101260332 268
25 3300027907 Ga0207428_10117796 Ga0207428_101177962 268
26 3300005438 Ga0070701_10122678 Ga0070701_101226782 269
27 3300005444 Ga0070694_100129987 Ga0070694_1001299872 269
28 3300005467 Ga0070706_100075428 Ga0070706_1000754283 269
29 3300009094 Ga0111539_10084166 Ga0111539_100841663 269
30 3300014326 Ga0157380_10175948 Ga0157380_101759482 269
31 3300026075 Ga0207708_10053069 Ga0207708_100530692 269
32 3300027907 Ga0207428_10027085 Ga0207428_100270853 269
33 3300050511 nmdc:mga08y16_23148_c1 nmdc:mga08y16_23148_c1_1096_1926 269
34 3300005333 Ga0070677_10066377 Ga0070677_100663772 270
35 3300005353 Ga0070669_100237332 Ga0070669_1002373322 270
36 3300005459 Ga0068867_100102959 Ga0068867_1001029591 270
37 3300014326 Ga0157380_10051388 Ga0157380_100513882 270
38 3300025937 Ga0207669_10108923 Ga0207669_101089232 270
39 3300005367 Ga0070667_100000114 Ga0070667_10000011435 271
40 3300005841 Ga0068863_100011894 Ga0068863_1000118941 271
41 3300005843 Ga0068860_100000172 Ga0068860_10000017237 271
42 3300025250 Ga0209026_1003724 Ga0209026_10037242 271
43 3300025986 Ga0207658_10000018 Ga0207658_10000018163 271
44 3300026088 Ga0207641_10006366 Ga0207641_1000636612 271
45 3300028381 Ga0268264_10000111 Ga0268264_10000111165 271
46 3300005444 Ga0070694_100610392 Ga0070694_1006103921 273
47 iso_pu_bacteria 2599185359 2600224736 273
48 3300005444 Ga0070694_100000014 Ga0070694_10000001456 274
49 3300009147 Ga0114129_10797805 Ga0114129_107978052 274
50 3300031824 Ga0307413_10248686 Ga0307413_102486862 275
51 3300005577 Ga0068857_100149946 Ga0068857_1001499462 276
52 3300005331 Ga0070670_100087544 Ga0070670_1000875442 277
53 3300005578 Ga0068854_100018310 Ga0068854_1000183104 277
54 3300005618 Ga0068864_100001956 Ga0068864_10000195615 277
55 3300005841 Ga0068863_100008551 Ga0068863_10000855110 277
56 3300025981 Ga0207640_10036207 Ga0207640_100362074 277
57 3300026088 Ga0207641_10000857 Ga0207641_100008578 277
58 3300026095 Ga0207676_10001821 Ga0207676_1000182110 277
59 3300005544 Ga0070686_100000332 Ga0070686_10000033213 278
60 3300005548 Ga0070665_100000477 Ga0070665_10000047737 278
61 3300028379 Ga0268266_10000083 Ga0268266_10000083191 278
62 3300031911 Ga0307412_10000362 Ga0307412_100003629 278
63 3300046460 Ga0495638_0011499 Ga0495638_0011499_4375_5217 278
64 3300053139 Ga0500568_0001427 Ga0500568_0001427_1358_2215 278
65 3300001904 JGI24736J21556_1001103 JGI24736J21556_10011037 279
66 3300001915 JGI24741J21665_1000569 JGI24741J21665_100056910 279
67 3300001989 JGI24739J22299_10000429 JGI24739J22299_100004299 279
68 3300002067 JGI24735J21928_10001785 JGI24735J21928_100017859 279
69 3300005327 Ga0070658_10076855 Ga0070658_100768553 279
70 3300005339 Ga0070660_100210440 Ga0070660_1002104402 279
71 3300005455 Ga0070663_100068027 Ga0070663_1000680272 279
72 3300005563 Ga0068855_100335060 Ga0068855_1003350603 279
73 3300005564 Ga0070664_100265368 Ga0070664_1002653682 279
74 3300005614 Ga0068856_100020313 Ga0068856_1000203132 279
75 3300009174 Ga0105241_10099887 Ga0105241_100998872 279
76 3300009545 Ga0105237_10441960 Ga0105237_104419601 279
77 3300009551 Ga0105238_10265315 Ga0105238_102653151 279
78 3300013100 Ga0157373_10111735 Ga0157373_101117352 279
79 3300013104 Ga0157370_10186106 Ga0157370_101861062 279
80 3300014326 Ga0157380_10088475 Ga0157380_100884753 279
81 3300025321 Ga0207656_10047095 Ga0207656_100470952 279
82 3300025913 Ga0207695_10420484 Ga0207695_104204842 279
83 3300025914 Ga0207671_10473745 Ga0207671_104737451 279
84 3300025919 Ga0207657_10239507 Ga0207657_102395071 279
85 3300025926 Ga0207659_10113647 Ga0207659_101136473 279
86 3300025932 Ga0207690_10118288 Ga0207690_101182882 279
87 3300025937 Ga0207669_10118468 Ga0207669_101184682 279
88 3300025981 Ga0207640_10082268 Ga0207640_100822682 279
89 3300026067 Ga0207678_10006731 Ga0207678_100067312 279
90 3300026078 Ga0207702_10002245 Ga0207702_1000224511 279
91 3300026116 Ga0207674_10052826 Ga0207674_100528264 279
92 3300026142 Ga0207698_10154066 Ga0207698_101540662 279
93 3300031548 Ga0307408_100047777 Ga0307408_1000477771 279
94 3300031731 Ga0307405_10038971 Ga0307405_100389712 279
95 3300031852 Ga0307410_10049655 Ga0307410_100496553 279
96 3300031901 Ga0307406_10125987 Ga0307406_101259872 279
97 3300031911 Ga0307412_10049036 Ga0307412_100490362 279
98 3300032002 Ga0307416_100058622 Ga0307416_1000586222 279
99 3300050511 nmdc:mga08y16_237254_c1 nmdc:mga08y16_237254_c1_376_1218 279
100 3300009147 Ga0114129_10611386 Ga0114129_106113861 281
101 3300053136 Ga0500559_0018569 Ga0500559_0018569_817_1686 281
102 iso_pu_bacteria 2919709256 2919712158 281
103 iso_pu_bacteria 2808606401 2809064243 282
104 iso_pu_bacteria 2808606404 2809080211 282
105 iso_pu_bacteria 2808606405 2809084575 282
106 iso_pu_bacteria 2880518877 2880522190 282
107 3300046460 Ga0495638_0000051 Ga0495638_0000051_15737_16609 283
108 3300046506 Ga0495583_0000498 Ga0495583_0000498_15476_16348 283
109 3300046519 Ga0495632_0002706 Ga0495632_0002706_3850_4722 283
110 3300046524 Ga0495648_0000032 Ga0495648_0000032_189375_190247 283
111 3300046558 Ga0495633_0071334 Ga0495633_0071334_502_1374 283
112 3300046692 Ga0495671_0000020 Ga0495671_0000020_15589_16461 283
113 3300047469 Ga0495673_0000076 Ga0495673_0000076_189012_189884 283
114 3300053157 Ga0500624_000024 Ga0500624_000024_56723_57577 283
115 3300001976 JGI24752J21851_1000244 JGI24752J21851_10002449 284
116 3300005289 Ga0065704_10103635 Ga0065704_101036353 284
117 3300005295 Ga0065707_10133188 Ga0065707_101331882 284
118 3300005331 Ga0070670_100000016 Ga0070670_100000016204 284
119 3300005367 Ga0070667_100000670 Ga0070667_10000067041 284
120 3300005618 Ga0068864_100000017 Ga0068864_10000001783 284
121 3300005841 Ga0068863_100000133 Ga0068863_10000013383 284
122 3300005844 Ga0068862_100000010 Ga0068862_100000010227 284
123 3300009011 Ga0105251_10001854 Ga0105251_100018549 284
124 3300009553 Ga0105249_10009224 Ga0105249_100092247 284
125 3300014968 Ga0157379_10020734 Ga0157379_1002073410 284
126 3300025735 Ga0207713_1002138 Ga0207713_10021389 284
127 3300025925 Ga0207650_10000196 Ga0207650_1000019640 284
128 3300025941 Ga0207711_10000137 Ga0207711_100001372 284
129 3300025961 Ga0207712_10000147 Ga0207712_100001474 284
130 3300025986 Ga0207658_10000221 Ga0207658_1000022127 284
131 3300026088 Ga0207641_10000002 Ga0207641_10000002258 284
132 3300026095 Ga0207676_10000005 Ga0207676_10000005549 284
133 3300028380 Ga0268265_10000003 Ga0268265_10000003731 284
134 3300048906 Ga0496103_0009384 Ga0496103_0009384_3624_4511 284
135 3300048920 Ga0496117_0003948 Ga0496117_0003948_8328_9215 284
136 3300048921 Ga0496118_0001361 Ga0496118_0001361_33544_34431 284
137 3300005338 Ga0068868_100001644 Ga0068868_10000164415 285
138 3300005339 Ga0070660_100000465 Ga0070660_10000046515 285
139 3300005366 Ga0070659_100000032 Ga0070659_10000003215 285
140 3300005841 Ga0068863_100033132 Ga0068863_1000331321 285
141 3300026088 Ga0207641_10027614 Ga0207641_100276146 285
142 3300046453 Ga0495627_000459 Ga0495627_000459_1713_2579 285
143 3300046524 Ga0495648_0071336 Ga0495648_0071336_981_1847 285
144 3300047469 Ga0495673_0105086 Ga0495673_0105086_252_1118 285
145 3300001979 JGI24740J21852_10001407 JGI24740J21852_100014075 286
146 3300025911 Ga0207654_10143136 Ga0207654_101431362 286
147 3300026041 Ga0207639_10001817 Ga0207639_1000181711 286
148 3300046452 Ga0495617_003420 Ga0495617_003420_4112_4975 286
149 3300046453 Ga0495627_000503 Ga0495627_000503_17698_18561 286
150 3300046512 Ga0495610_0000043 Ga0495610_0000043_67969_68832 286
151 3300046665 Ga0495661_0057139 Ga0495661_0057139_412_1275 286
152 3300047472 Ga0495686_0019421 Ga0495686_0019421_2968_3831 286
153 3300006042 Ga0075368_10000134 Ga0075368_1000013416 287
154 3300006178 Ga0075367_10000450 Ga0075367_100004506 287
155 3300013105 Ga0157369_10374633 Ga0157369_103746332 287
156 3300025229 Ga0209147_100446 Ga0209147_1004463 287
157 3300027866 Ga0209813_10000026 Ga0209813_1000002657 287
158 3300046519 Ga0495632_0000048 Ga0495632_0000048_43237_44118 287
159 3300046520 Ga0495637_0002220 Ga0495637_0002220_2208_3080 287
160 3300046520 Ga0495637_0002774 Ga0495637_0002774_4810_5682 287
161 3300046522 Ga0495643_0000030 Ga0495643_0000030_52701_53573 287
162 3300046525 Ga0495663_0000003 Ga0495663_0000003_225689_226570 287
163 3300046558 Ga0495633_0000215 Ga0495633_0000215_23944_24825 287
164 3300046558 Ga0495633_0000435 Ga0495633_0000435_34456_35337 287
165 3300046692 Ga0495671_0000043 Ga0495671_0000043_52701_53573 287
166 3300047470 Ga0495681_0000025 Ga0495681_0000025_78740_79606 287
167 3300048926 Ga0496123_0183493 Ga0496123_0183493_76_951 287
168 3300049459 Ga0495678_035957 Ga0495678_035957_298_1164 287
169 3300050494 nmdc:mga06z11_19_c1 nmdc:mga06z11_19_c1_50893_51771 287
170 3300050495 nmdc:mga04h51_14_c1 nmdc:mga04h51_14_c1_13100_13978 287
171 iso_pu_bacteria 2512564014 2512643816 287
172 iso_pu_bacteria 2775507255 2778124950 289
173 3300013105 Ga0157369_10001166 Ga0157369_100011667 290
174 3300037312 Ga0395899_0001926 Ga0395899_0001926_15218_16099 290
175 3300037418 Ga0395900_0073486 Ga0395900_0073486_989_1870 290
176 3300025919 Ga0207657_10002112 Ga0207657_100021125 291
177 3300025927 Ga0207687_10039586 Ga0207687_100395862 291
178 3300025932 Ga0207690_10000001 Ga0207690_10000001815 291
179 3300026023 Ga0207677_10000344 Ga0207677_1000034415 291
180 3300025231 Ga0207427_102616 Ga0207427_1026164 292
181 3300025261 Ga0209233_1000078 Ga0209233_1000078312 292
182 2162886007 SwRhRL2b_contig_1540189 SwRhRL2b_0294.00006080 293
183 3300005289 Ga0065704_10078512 Ga0065704_100785124 293
184 3300005548 Ga0070665_100028647 Ga0070665_1000286474 293
185 3300005618 Ga0068864_100118430 Ga0068864_1001184302 293
186 3300009011 Ga0105251_10008538 Ga0105251_100085384 293
187 3300009177 Ga0105248_10659329 Ga0105248_106593291 293
188 3300009553 Ga0105249_10046554 Ga0105249_100465541 293
189 3300017792 Ga0163161_10022845 Ga0163161_100228451 293
190 3300025735 Ga0207713_1010700 Ga0207713_10107002 293
191 3300025925 Ga0207650_10107524 Ga0207650_101075242 293
192 3300025961 Ga0207712_10215937 Ga0207712_102159372 293
193 3300025972 Ga0207668_10096758 Ga0207668_100967582 293
194 3300026095 Ga0207676_10121349 Ga0207676_101213493 293
195 3300028379 Ga0268266_10091757 Ga0268266_100917571 293
196 3300039437 Ga0436365_0010969 Ga0436365_0010969_55114_56238 293
197 3300048911 Ga0496108_0000728 Ga0496108_0000728_5946_6827 293
198 3300048911 Ga0496108_0094173 Ga0496108_0094173_371_1252 293
199 3300048912 Ga0496109_0040159 Ga0496109_0040159_1636_2517 293
200 3300048916 Ga0496113_0023886 Ga0496113_0023886_2393_3274 293
201 3300048919 Ga0496116_0052597 Ga0496116_0052597_1470_2351 293
202 3300048924 Ga0496121_0000610 Ga0496121_0000610_13173_14054 293
203 3300048924 Ga0496121_0071097 Ga0496121_0071097_1371_2252 293
204 3300048926 Ga0496123_0020843 Ga0496123_0020843_3465_4346 293
205 3300048927 Ga0496124_0006701 Ga0496124_0006701_3455_4336 293
206 3300048927 Ga0496124_0061933 Ga0496124_0061933_2121_3002 293
207 3300048928 Ga0496125_0003777 Ga0496125_0003777_13077_13958 293
208 3300048928 Ga0496125_0030818 Ga0496125_0030818_1635_2516 293
209 3300049663 Ga0501223_000002 Ga0501223_000002_110601_111488 293
210 3300049705 Ga0501225_0000006 Ga0501225_0000006_110419_111306 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

237

0.85

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

193

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.8411 2 249
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.8222 2 249
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.8199 2 249
3age-assembly1.cif.gz_A crystal structure of mglu in its l-glutamate binding form in the presence of 4.3m nacl 0.8092 32 71
3ihb-assembly1.cif.gz_A crystal structure analysis of mglu in its tris and glutamate form 0.8058 32 71
ID Description Score Start End Superfamily
af_Q8IM55_21_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7787 1 248 3.60.21.10
2dxlA02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;GpdQ, beta-strand dimerisation domain 0.769 102 216 3.30.750.180
af_A0A0P0XPV5_320_563_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7579 1 201 3.60.21.10
af_I4DHV7_286_601_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7524 2 268 3.60.21.10
2xmoA01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7464 2 252 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A5C7TZX8-F1-model_v4 deleted 0.977 1 117
AF-A0A537M8K5-F1-model_v4 Metallophosphoesterase 0.972 2 283 GO:0016787
AF-J2WJY4-F1-model_v4 deleted 0.97 1 284
AF-A0A5C7TZX8-F1-model_v4 deleted 0.9605 1 117
AF-A0A7V8HJH0-F1-model_v4 deleted 0.9593 1 210

Feature Viewer

pLDDT pTM Quality
82.17 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map