F320986

General Info

Members Datasets Scaffolds Average Seq Length
210 168 420 335

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2585428094|2587861702
Length 389
Sequence SDPPNGLRGKGALRAATPALATRRKLARKYPPFGGSFGYCCRDPGRESIETMTLTLGYKASAEQFSPRELVEIAVSAEKHGFDSVAASDHFQPWRHEGGHAPFSLAWIAAVGERTSTIKIGTSVMTPTFRYNPAVLAQAFATLGCLYPGRIMLGVGSGEALNEIATGFRGAGEQDWPEFKERFARLRESINLMRALWSDDRVNFEGEYYSTHDASIYDRPEGGVPVYIAAGGPMVAKYVGRAGDGFICTSGKGMELYTEKLLPALREGAEAAGKDYDAIDKMIEIKLSYEEDEQTALDNTRFWSPLSLTPEQKHSITDPIEMERAADALPIEQIAKRWIIGTDPDKTVAEIKQYTDAGFNHLVFHAPGHDQERFMQLFERDLAPRLRAL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
74 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
128 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
129 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
130 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
131 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
132 2582580736 Prauserella sp. Am3 Isolate Unclassified
133 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
134 2643221549 Agromyces sp. Root1464 Isolate Unclassified
135 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
136 2643221572 Leifsonia sp. Root60 Isolate Unclassified
137 2643221619 Agromyces sp. Root81 Isolate Unclassified
138 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
139 2643221630 Microbacterium sp. Root322 Isolate Unclassified
140 2643221649 Leifsonia sp. Root4 Isolate Unclassified
141 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
142 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
143 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
144 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
145 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
146 2739367898 Nocardioides sp. CF479 Isolate Unclassified
147 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
148 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
149 2808606372 Agromyces sp. 23-23 Isolate Unclassified
150 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
151 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
152 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
153 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
154 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
155 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
156 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
157 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
158 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
159 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
160 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
161 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
162 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
163 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
164 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
165 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
166 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
167 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
168 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.52
Metatranscriptomes 0.48
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 4.29
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008941 3300001979 Bacteria 3957
2 Ga0070658_10000245 3300005327 Bacteria 48267
3 Ga0068868_100138200 3300005338 Bacteria 1999
4 Ga0070660_100109077 3300005339 Bacteria 2201
5 Ga0070668_100002118 3300005347 Bacteria 14517
6 Ga0070668_100020411 3300005347 Bacteria 4999
7 Ga0070668_100393608 3300005347 Bacteria 1182
8 Ga0070675_100221178 3300005354 Bacteria 1649
9 Ga0070674_100164620 3300005356 Bacteria 1685
10 Ga0070659_100089308 3300005366 Bacteria 2468
11 Ga0070705_100053808 3300005440 Bacteria 2358
12 Ga0070700_100000108 3300005441 Bacteria 52617
13 Ga0070663_100045938 3300005455 Bacteria 3087
14 Ga0070663_100124870 3300005455 Bacteria 1949
15 Ga0070678_100265052 3300005456 Bacteria 1446
16 Ga0070678_100400672 3300005456 Bacteria 1192
17 Ga0068867_100086660 3300005459 Bacteria 2370
18 Ga0068853_100429826 3300005539 Bacteria 1239
19 Ga0068855_100105876 3300005563 Bacteria 3233
20 Ga0070664_100033142 3300005564 Bacteria 4324
21 Ga0068854_100010715 3300005578 Bacteria 5949
22 Ga0068856_100130112 3300005614 Bacteria 2521
23 Ga0070702_100017918 3300005615 Bacteria 3662
24 Ga0068861_100016385 3300005719 Bacteria 5243
25 Ga0068851_10042388 3300005834 Bacteria 2291
26 Ga0068870_10028915 3300005840 Bacteria 2787
27 Ga0068862_100088215 3300005844 Bacteria 2699
28 Ga0081455_10000420 3300005937 Bacteria 55691
29 Ga0075363_100015490 3300006048 Bacteria 3750
30 Ga0075364_10016116 3300006051 Bacteria 4645
31 Ga0075430_100007292 3300006846 Bacteria 9336
32 Ga0068865_100051726 3300006881 Bacteria 2845
33 Ga0111539_10510851 3300009094 Bacteria 1400
34 Ga0105245_10036050 3300009098 Bacteria 4392
35 Ga0105245_10365668 3300009098 Bacteria 1433
36 Ga0105243_10122778 3300009148 Bacteria 2193
37 Ga0105243_10186709 3300009148 Bacteria 1807
38 Ga0105242_10014330 3300009176 Bacteria 6140
39 Ga0105242_10127252 3300009176 Bacteria 2194
40 Ga0105238_10456112 3300009551 Bacteria 1276
41 Ga0105249_10070301 3300009553 Bacteria 3231
42 Ga0105246_10070345 3300011119 Bacteria 2461
43 Ga0105246_10081910 3300011119 Bacteria 2302
44 Ga0157371_10059068 3300013102 Bacteria 2720
45 Ga0157370_10006075 3300013104 Bacteria 13405
46 Ga0157369_10291854 3300013105 Bacteria 1698
47 Ga0157369_10367895 3300013105 Bacteria 1493
48 Ga0157378_10158325 3300013297 Bacteria 2116
49 Ga0157378_10174407 3300013297 Bacteria 2019
50 Ga0163162_10033388 3300013306 Bacteria 5114
51 Ga0157372_10647590 3300013307 Bacteria 1230
52 Ga0157375_10044012 3300013308 Bacteria 4333
53 Ga0157375_10044810 3300013308 Bacteria 4301
54 Ga0157375_10066912 3300013308 Bacteria 3589
55 Ga0157375_10353972 3300013308 Bacteria 1634
56 Ga0157375_10672462 3300013308 Bacteria 1190
57 Ga0163163_10118345 3300014325 Bacteria 2682
58 Ga0157377_10045846 3300014745 Bacteria 2444
59 Ga0163161_10056897 3300017792 Bacteria 2841
60 Ga0163161_10113579 3300017792 Bacteria 2027
61 Ga0206353_11521556 3300020082 Bacteria 1603
62 Ga0207656_10078495 3300025321 Bacteria 1480
63 Ga0207642_10056061 3300025899 Bacteria 1806
64 Ga0207688_10016053 3300025901 Bacteria 4060
65 Ga0207647_10056822 3300025904 Bacteria 2400
66 Ga0207643_10009487 3300025908 Bacteria 5227
67 Ga0207643_10185840 3300025908 Bacteria 1260
68 Ga0207705_10000001 3300025909 Bacteria 2061880
69 Ga0207705_10229213 3300025909 Bacteria 1412
70 Ga0207693_10273744 3300025915 Bacteria 1323
71 Ga0207657_10050061 3300025919 Bacteria 3637
72 Ga0207657_10092181 3300025919 Bacteria 2525
73 Ga0207681_10002196 3300025923 Bacteria 12443
74 Ga0207687_10010505 3300025927 Bacteria 6048
75 Ga0207687_10186576 3300025927 Bacteria 1610
76 Ga0207690_10055440 3300025932 Bacteria 2669
77 Ga0207709_10074828 3300025935 Bacteria 2163
78 Ga0207712_10084240 3300025961 Bacteria 2323
79 Ga0207640_10094528 3300025981 Bacteria 2079
80 Ga0207677_10076904 3300026023 Bacteria 2378
81 Ga0207678_10046274 3300026067 Bacteria 3762
82 Ga0207678_10132755 3300026067 Bacteria 2124
83 Ga0207708_10000161 3300026075 Bacteria 52717
84 Ga0207708_10008161 3300026075 Bacteria 7754
85 Ga0207676_10271100 3300026095 Bacteria 1537
86 Ga0207675_100006886 3300026118 Bacteria 10767
87 Ga0207683_10122719 3300026121 Bacteria 2333
88 Ga0207683_10156355 3300026121 Bacteria 2060
89 Ga0207683_10156840 3300026121 Bacteria 2056
90 Ga0207683_10262166 3300026121 Bacteria 1578
91 Ga0268266_10084333 3300028379 Bacteria 2774
92 Ga0268266_10094536 3300028379 Bacteria 2624
93 Ga0307512_10074249 3300030522 Bacteria 2499
94 Ga0265327_10000004 3300031251 Bacteria 803973
95 Ga0307513_10015047 3300031456 Bacteria 9390
96 Ga0307408_100095734 3300031548 Bacteria 2251
97 Ga0307408_100189307 3300031548 Bacteria 1657
98 Ga0307508_10213281 3300031616 Bacteria 1531
99 Ga0307518_10002510 3300031838 Bacteria 13387
100 Ga0326468_10002482 3300031889 Bacteria 1540
101 Ga0307409_100550789 3300031995 Bacteria 1132
102 Ga0436364_0080553 3300037853 Bacteria 3174
103 Ga0395901_0042738 3300038443 Bacteria 4700
104 Ga0436365_1536967 3300039437 Bacteria 4429
105 Ga0436363_0560031 3300039450 Bacteria 1184
106 Ga0436363_1426364 3300039450 Bacteria 1271
107 Ga0451791_1091264 3300041451 Bacteria 1872
108 Ga0466972_0031154 3300044658 Bacteria 2624
109 Ga0466965_0023238 3300044683 Bacteria 2993
110 Ga0466966_0142225 3300044684 Bacteria 1466
111 Ga0466961_0082526 3300044693 Bacteria 2033
112 Ga0466963_0033403 3300044694 Bacteria 3340
113 Ga0466970_0017633 3300044765 Bacteria 3690
114 Ga0466970_0183832 3300044765 Bacteria 1160
115 Ga0466970_0188197 3300044765 Bacteria 1146
116 Ga0466960_0140862 3300044901 Bacteria 1281
117 Ga0466967_0002209 3300045976 Bacteria 11966
118 Ga0466967_0023212 3300045976 Bacteria 5080
119 Ga0466967_0174600 3300045976 Bacteria 2024
120 Ga0466967_0175777 3300045976 Bacteria 2017
121 Ga0466967_0358132 3300045976 Bacteria 1413
122 Ga0495592_0071331 3300046454 Bacteria 2529
123 Ga0495651_0000740 3300046462 Bacteria 25246
124 Ga0495650_0000275 3300046471 Bacteria 98060
125 Ga0495650_0028477 3300046471 Bacteria 2564
126 Ga0495664_0057178 3300046477 Bacteria 2320
127 Ga0495585_0044995 3300046492 Bacteria 2465
128 Ga0495628_0009448 3300046516 Bacteria 8324
129 Ga0495652_0000478 3300046529 Bacteria 46945
130 Ga0495635_0007522 3300046663 Bacteria 7602
131 Ga0495623_0044086 3300046679 Bacteria 2835
132 Ga0495646_0056072 3300046680 Bacteria 2363
133 Ga0495686_0121295 3300047472 Bacteria 1558
134 Ga0496100_0038424 3300048903 Bacteria 3033
135 Ga0496101_0061373 3300048904 Bacteria 2730
136 Ga0496102_0000908 3300048905 Bacteria 28014
137 Ga0496102_0284498 3300048905 Bacteria 1558
138 Ga0496102_0403037 3300048905 Bacteria 1286
139 Ga0496103_0003639 3300048906 Bacteria 9384
140 Ga0496114_0010437 3300048917 Bacteria 7390
141 Ga0496114_0020239 3300048917 Bacteria 5400
142 Ga0496122_0000377 3300048925 Bacteria 95371
143 Ga0496123_0000169 3300048926 Bacteria 130983
144 Ga0496124_0001749 3300048927 Bacteria 30385
145 Ga0496124_0238339 3300048927 Bacteria 1355
146 Ga0496125_0050400 3300048928 Bacteria 3447
147 Ga0496126_0091449 3300048929 Bacteria 2675
148 Ga0501033_0130533 3300049570 Bacteria 1820
149 Ga0501033_0241847 3300049570 Bacteria 1280
150 Ga0501039_0314728 3300049575 Bacteria 1231
151 Ga0501043_0059501 3300049579 Bacteria 2999
152 Ga0501047_0151687 3300049581 Bacteria 2193
153 Ga0501081_0195807 3300049743 Bacteria 1465
154 Ga0501083_0000004 3300049744 Bacteria 207886
155 Ga0501035_0158999 3300049822 Bacteria 1957
156 Ga0501044_0183951 3300049823 Bacteria 2055
157 nmdc:mga03n38_54001_c1 3300050490 Bacteria 1804
158 nmdc:mga00v17_13915_c1 3300050491 Bacteria 4477
159 nmdc:mga08y16_469189_c1 3300050511 Bacteria 1282
160 Ga0495612_0000680 3300053078 Bacteria 13703
161 Ga0495619_0034077 3300053085 Bacteria 3309
162 Ga0500641_0001004 3300053096 Bacteria 10049
163 Ga0500650_0014703 3300053098 Bacteria 3317
164 Ga0500556_0000001 3300053104 Bacteria 1135060
165 Ga0500568_0000003 3300053139 Bacteria 863587
166 Ga0500573_0000001 3300053140 Bacteria 436394
167 Ga0500573_0023494 3300053140 Bacteria 3541
168 Ga0500577_0000903 3300053142 Bacteria 7682
169 2587861702 2585428094 Bacteria 3604039
170 2523382773 2523231044 Bacteria 6434991
171 2552111304 2551306166 Bacteria 9731570
172 2583149375 2582580736 Bacteria 5325865
173 2586062077 2585427649 Bacteria 9053857
174 2643769208 2643221549 Bacteria 4042819
175 2643853174 2643221567 Bacteria 4163945
176 2643876973 2643221572 Bacteria 3614809
177 2644112660 2643221619 Bacteria 4158469
178 2644137157 2643221624 Bacteria 4384879
179 2644172019 2643221630 Bacteria 3601215
180 2644278282 2643221649 Bacteria 3867359
181 2644384028 2643221669 Bacteria 3611286
182 2645722473 2643221961 Bacteria 3919167
183 2645725444 2643221962 Bacteria 3874254
184 2723643799 2721755702 Bacteria 4373124
185 2739235689 2738543011 Bacteria 5731169
186 2739235711 2738543011 Bacteria 5731169
187 2740165463 2739367898 Bacteria 4367674
188 2744957824 2744054611 Bacteria 5611514
189 2753037321 2751185725 Bacteria 5740550
190 2808900317 2808606372 Bacteria 4649509
191 2809588770 2808606522 Bacteria 9488490
192 2816422567 2816332119 Bacteria 8120218
193 2857725234 2857723135 Bacteria 4217853
194 2870623189 2870622029 Bacteria 3643329
195 2887443855 2887443736 Bacteria 4426037
196 2887445146 2887443736 Bacteria 4426037
197 2889305307 2889300758 Bacteria 5690814
198 2895662247 2895660088 Bacteria 3782833
199 2915775358 2915768154 Bacteria 8424322
200 2919035330 2919034639 Bacteria 4763403
201 2919444906 2919443155 Bacteria 4072969
202 2935413455 2935409751 Bacteria 4179611
203 2939657597 2939657138 Bacteria 3740283
204 2939746833 2939743619 Bacteria 5762299
205 2956942243 2956939328 Bacteria 3474458
206 2966921984 2966921586 Bacteria 3092803
207 3001121991 3001119090 Bacteria 3449530
208 8004028523 8004025490 Bacteria 4327753
209 8004213955 8004212874 Bacteria 2861420
210 8046354361 8046352972 Bacteria 3613806
211 JGI24740J21852_10008941
212 Ga0070658_10000245
213 Ga0068868_100138200
214 Ga0070660_100109077
215 Ga0070668_100002118
216 Ga0070668_100020411
217 Ga0070668_100393608
218 Ga0070675_100221178
219 Ga0070674_100164620
220 Ga0070659_100089308
221 Ga0070705_100053808
222 Ga0070700_100000108
223 Ga0070663_100045938
224 Ga0070663_100124870
225 Ga0070678_100265052
226 Ga0070678_100400672
227 Ga0068867_100086660
228 Ga0068853_100429826
229 Ga0068855_100105876
230 Ga0070664_100033142
231 Ga0068854_100010715
232 Ga0068856_100130112
233 Ga0070702_100017918
234 Ga0068861_100016385
235 Ga0068851_10042388
236 Ga0068870_10028915
237 Ga0068862_100088215
238 Ga0081455_10000420
239 Ga0075363_100015490
240 Ga0075364_10016116
241 Ga0075430_100007292
242 Ga0068865_100051726
243 Ga0111539_10510851
244 Ga0105245_10036050
245 Ga0105245_10365668
246 Ga0105243_10122778
247 Ga0105243_10186709
248 Ga0105242_10014330
249 Ga0105242_10127252
250 Ga0105238_10456112
251 Ga0105249_10070301
252 Ga0105246_10070345
253 Ga0105246_10081910
254 Ga0157371_10059068
255 Ga0157370_10006075
256 Ga0157369_10291854
257 Ga0157369_10367895
258 Ga0157378_10158325
259 Ga0157378_10174407
260 Ga0163162_10033388
261 Ga0157372_10647590
262 Ga0157375_10044012
263 Ga0157375_10044810
264 Ga0157375_10066912
265 Ga0157375_10353972
266 Ga0157375_10672462
267 Ga0163163_10118345
268 Ga0157377_10045846
269 Ga0163161_10056897
270 Ga0163161_10113579
271 Ga0206353_11521556
272 Ga0207656_10078495
273 Ga0207642_10056061
274 Ga0207688_10016053
275 Ga0207647_10056822
276 Ga0207643_10009487
277 Ga0207643_10185840
278 Ga0207705_10000001
279 Ga0207705_10229213
280 Ga0207693_10273744
281 Ga0207657_10050061
282 Ga0207657_10092181
283 Ga0207681_10002196
284 Ga0207687_10010505
285 Ga0207687_10186576
286 Ga0207690_10055440
287 Ga0207709_10074828
288 Ga0207712_10084240
289 Ga0207640_10094528
290 Ga0207677_10076904
291 Ga0207678_10046274
292 Ga0207678_10132755
293 Ga0207708_10000161
294 Ga0207708_10008161
295 Ga0207676_10271100
296 Ga0207675_100006886
297 Ga0207683_10122719
298 Ga0207683_10156355
299 Ga0207683_10156840
300 Ga0207683_10262166
301 Ga0268266_10084333
302 Ga0268266_10094536
303 Ga0307512_10074249
304 Ga0265327_10000004
305 Ga0307513_10015047
306 Ga0307408_100095734
307 Ga0307408_100189307
308 Ga0307508_10213281
309 Ga0307518_10002510
310 Ga0326468_10002482
311 Ga0307409_100550789
312 Ga0436364_0080553
313 Ga0395901_0042738
314 Ga0436365_1536967
315 Ga0436363_0560031
316 Ga0436363_1426364
317 Ga0451791_1091264
318 Ga0466972_0031154
319 Ga0466965_0023238
320 Ga0466966_0142225
321 Ga0466961_0082526
322 Ga0466963_0033403
323 Ga0466970_0017633
324 Ga0466970_0183832
325 Ga0466970_0188197
326 Ga0466960_0140862
327 Ga0466967_0002209
328 Ga0466967_0023212
329 Ga0466967_0174600
330 Ga0466967_0175777
331 Ga0466967_0358132
332 Ga0495592_0071331
333 Ga0495651_0000740
334 Ga0495650_0000275
335 Ga0495650_0028477
336 Ga0495664_0057178
337 Ga0495585_0044995
338 Ga0495628_0009448
339 Ga0495652_0000478
340 Ga0495635_0007522
341 Ga0495623_0044086
342 Ga0495646_0056072
343 Ga0495686_0121295
344 Ga0496100_0038424
345 Ga0496101_0061373
346 Ga0496102_0000908
347 Ga0496102_0284498
348 Ga0496102_0403037
349 Ga0496103_0003639
350 Ga0496114_0010437
351 Ga0496114_0020239
352 Ga0496122_0000377
353 Ga0496123_0000169
354 Ga0496124_0001749
355 Ga0496124_0238339
356 Ga0496125_0050400
357 Ga0496126_0091449
358 Ga0501033_0130533
359 Ga0501033_0241847
360 Ga0501039_0314728
361 Ga0501043_0059501
362 Ga0501047_0151687
363 Ga0501081_0195807
364 Ga0501083_0000004
365 Ga0501035_0158999
366 Ga0501044_0183951
367 nmdc:mga03n38_54001_c1
368 nmdc:mga00v17_13915_c1
369 nmdc:mga08y16_469189_c1
370 Ga0495612_0000680
371 Ga0495619_0034077
372 Ga0500641_0001004
373 Ga0500650_0014703
374 Ga0500556_0000001
375 Ga0500568_0000003
376 Ga0500573_0000001
377 Ga0500573_0023494
378 Ga0500577_0000903
379 2587861702
380 2523382773
381 2552111304
382 2583149375
383 2586062077
384 2643769208
385 2643853174
386 2643876973
387 2644112660
388 2644137157
389 2644172019
390 2644278282
391 2644384028
392 2645722473
393 2645725444
394 2723643799
395 2739235689
396 2739235711
397 2740165463
398 2744957824
399 2753037321
400 2808900317
401 2809588770
402 2816422567
403 2857725234
404 2870623189
405 2887443855
406 2887445146
407 2889305307
408 2895662247
409 2915775358
410 2919035330
411 2919444906
412 2935413455
413 2939657597
414 2939746833
415 2956942243
416 2966921984
417 3001121991
418 8004028523
419 8004213955
420 8046354361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

38

361

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9767 1 332
5lxe-assembly1.cif.gz_A f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9753 1 332
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9703 1 332
5lxe-assembly1.cif.gz_A f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9694 1 332
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9635 3 331
ID Description Score Start End Superfamily
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.963 3 331 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9542 3 331 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9323 2 330 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9242 1 330 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9162 1 330 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A536PTP4-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9916 3 183 GO:0016705
AF-A0A4Q3N6E3-F1-model_v4 deleted 0.9884 1 197
AF-A0A511MS65-F1-model_v4 F420-dependent glucose-6-phosphate dehydrogenase (FGD) (G6PD) (EC 1.1.98.2) 0.9841 2 334 GO:0005975
GO:0016705
GO:0052749
GO:0070967
AF-A0A4Q3N6E3-F1-model_v4 deleted 0.9834 1 197
AF-A0A655HR29-F1-model_v4 deleted 0.983 1 176

Map