F320989

General Info

Members Datasets Scaffolds Average Seq Length
210 145 420 348

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221619|2644110733
Length 390
Sequence DPIGDFAEAAAPTPDEERLGVDSDEERLGVDSDEERLGVDSDEERLSIDGIAMVRLLGPQDRLLTQVQREYPGVQVHVRGNEIAIRGDQEGRMHVRRLIEELLELVRSGQDPTPTEVRSSARMLEADPNAKPSELLGQVIVSSRGKTIRPKTEGQRRYVDAIDEHTIVFGIGPAGTGKTYLAMAKAVQALQRKEVSRIILTRPAVEAGERLGFLPGTLTDKIDPYLRPLYDALNEMMDPELVPKLLASGTVEVAPLAYMRGRTLNDSFVVLDEAQNTTPEQMKMFLTRLGFGSRMVVTGDITQIDLPGGASGLRLVTRILDHVEDIEFVRLTSDDVVRHTLVGRIVDAYTEFDQRQQAQRFERDQAREFANRAERRGAGPRDHLPRKGKA

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
70 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
111 2643221619 Agromyces sp. Root81 Isolate Unclassified
112 2501939600 Micromonospora sp. L5 Isolate Unclassified
113 2643221549 Agromyces sp. Root1464 Isolate Unclassified
114 2643221572 Leifsonia sp. Root60 Isolate Unclassified
115 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
116 2643221649 Leifsonia sp. Root4 Isolate Unclassified
117 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
118 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
119 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
120 2773857759 Microbacterium sp. 1294 Isolate Unclassified
121 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
122 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
123 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
124 2808606372 Agromyces sp. 23-23 Isolate Unclassified
125 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
126 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
127 2902582711 Micromonospora sp. AP08 Isolate Unclassified
128 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
129 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
130 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
131 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
132 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
133 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
134 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
135 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
136 2920879853 Kocuria salina CV6 Isolate Unclassified
137 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
138 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
139 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
140 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
141 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
142 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
143 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
144 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
145 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 3.33
Isolates 16.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 10.48
Rhizosphere 59.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004172 3300002067 Bacteria 4880
2 JGI25406J46586_10016227 3300003203 Bacteria 3111
3 Ga0006562J51391_1028904 3300003578 Bacteria 5220
4 Ga0058859_10095246 3300004798 Bacteria 1152
5 Ga0058863_11740987 3300004799 Bacteria 1271
6 Ga0058861_11903183 3300004800 Bacteria 1772
7 Ga0058860_12163698 3300004801 Bacteria 1201
8 Ga0065714_10014224 3300005288 Bacteria 1757
9 Ga0070658_10000833 3300005327 Bacteria 26391
10 Ga0070658_10109182 3300005327 Bacteria 2290
11 Ga0070659_100024279 3300005366 Bacteria 4645
12 Ga0070667_100000033 3300005367 Bacteria 175463
13 Ga0070714_100000050 3300005435 Bacteria 110823
14 Ga0070713_100305406 3300005436 Bacteria 1466
15 Ga0070700_100000026 3300005441 Bacteria 125610
16 Ga0070665_100004911 3300005548 Bacteria 13869
17 Ga0068859_100001517 3300005617 Bacteria 23701
18 Ga0068864_100023965 3300005618 Bacteria 5130
19 Ga0068863_100005183 3300005841 Bacteria 12853
20 Ga0068863_100032678 3300005841 Bacteria 4958
21 Ga0068858_100057217 3300005842 Bacteria 3604
22 Ga0068860_100000010 3300005843 Bacteria 359114
23 Ga0068862_100000008 3300005844 Bacteria 305510
24 Ga0081539_10000682 3300005985 Bacteria 67986
25 Ga0097620_100001516 3300006931 Bacteria 23701
26 Ga0105247_10000019 3300009101 Bacteria 245170
27 Ga0105247_10036816 3300009101 Bacteria 2983
28 Ga0105248_10023398 3300009177 Bacteria 6863
29 Ga0105249_10000019 3300009553 Bacteria 273807
30 Ga0157370_10023935 3300013104 Bacteria 6056
31 Ga0157370_10117850 3300013104 Bacteria 2480
32 Ga0157369_10456864 3300013105 Bacteria 1322
33 Ga0163162_10255666 3300013306 Bacteria 1884
34 Ga0163162_10292859 3300013306 Bacteria 1759
35 Ga0157375_10144053 3300013308 Bacteria 2512
36 Ga0157379_10134732 3300014968 Bacteria 2225
37 Ga0206354_10673422 3300020081 Bacteria 1257
38 Ga0224712_10061233 3300022467 Bacteria 1500
39 Ga0209672_100006 3300025228 Bacteria 1004497
40 Ga0209147_101211 3300025229 Bacteria 10340
41 Ga0209148_1000015 3300025254 Bacteria 850103
42 Ga0209455_1000013 3300025272 Bacteria 850103
43 Ga0207710_10000036 3300025900 Bacteria 245176
44 Ga0207647_10045489 3300025904 Bacteria 2738
45 Ga0207705_10000006 3300025909 Bacteria 657147
46 Ga0207681_10001794 3300025923 Bacteria 13787
47 Ga0207664_10000003 3300025929 Bacteria 510966
48 Ga0207711_10001201 3300025941 Bacteria 24507
49 Ga0207711_10141765 3300025941 Bacteria 2163
50 Ga0207712_10000025 3300025961 Bacteria 274015
51 Ga0207712_10136761 3300025961 Bacteria 1875
52 Ga0207658_10000125 3300025986 Bacteria 83488
53 Ga0207708_10000014 3300026075 Bacteria 203569
54 Ga0207641_10004618 3300026088 Bacteria 11892
55 Ga0207641_10058458 3300026088 Bacteria 3281
56 Ga0207676_10039576 3300026095 Bacteria 3607
57 Ga0268266_10004645 3300028379 Bacteria 13095
58 Ga0268265_10000007 3300028380 Bacteria 431817
59 Ga0268264_10000007 3300028381 Bacteria 815790
60 Ga0307518_10049469 3300031838 Bacteria 3056
61 Ga0307410_10045798 3300031852 Bacteria 2915
62 Ga0307410_10132517 3300031852 Bacteria 1833
63 Ga0307406_10052506 3300031901 Bacteria 2593
64 Ga0307409_100020357 3300031995 Bacteria 4519
65 Ga0395899_0000786 3300037312 Bacteria 31058
66 Ga0395900_0061011 3300037418 Bacteria 3878
67 Ga0466965_0000002 3300044683 Bacteria 297957
68 Ga0466970_0113818 3300044765 Bacteria 1478
69 Ga0466958_0198654 3300045836 Bacteria 1276
70 Ga0495590_0001219 3300046457 Bacteria 11238
71 Ga0495629_0126414 3300046459 Bacteria 1781
72 Ga0495629_0263212 3300046459 Bacteria 1185
73 Ga0495672_0033679 3300047320 Bacteria 3173
74 Ga0495672_0039725 3300047320 Bacteria 2859
75 Ga0496100_0049554 3300048903 Bacteria 2717
76 Ga0496101_0004689 3300048904 Bacteria 8656
77 Ga0496101_0023885 3300048904 Bacteria 4227
78 Ga0496102_0000789 3300048905 Bacteria 30791
79 Ga0496102_0048205 3300048905 Bacteria 3873
80 Ga0496103_0002100 3300048906 Bacteria 12704
81 Ga0496104_0031468 3300048907 Bacteria 4935
82 Ga0496104_0214572 3300048907 Bacteria 1836
83 Ga0496105_0005304 3300048908 Bacteria 9771
84 Ga0496105_0020315 3300048908 Bacteria 5366
85 Ga0496107_0008744 3300048910 Bacteria 7015
86 Ga0496108_0042142 3300048911 Bacteria 3811
87 Ga0496108_0129265 3300048911 Bacteria 2171
88 Ga0496109_0010022 3300048912 Bacteria 8090
89 Ga0496110_0012890 3300048913 Bacteria 6892
90 Ga0496110_0168889 3300048913 Bacteria 1984
91 Ga0496111_0031229 3300048914 Bacteria 3794
92 Ga0496112_0036802 3300048915 Bacteria 4775
93 Ga0496112_0262739 3300048915 Bacteria 1675
94 Ga0496114_0027821 3300048917 Bacteria 4634
95 Ga0496114_0154393 3300048917 Bacteria 1992
96 Ga0496115_0004597 3300048918 Bacteria 9992
97 Ga0496116_0014171 3300048919 Bacteria 6381
98 Ga0496116_0015879 3300048919 Bacteria 5926
99 Ga0496117_0000564 3300048920 Bacteria 60818
100 Ga0496117_0001925 3300048920 Bacteria 27694
101 Ga0496117_0011044 3300048920 Bacteria 8131
102 Ga0496117_0106159 3300048920 Bacteria 1763
103 Ga0496118_0001102 3300048921 Bacteria 41962
104 Ga0496118_0002101 3300048921 Bacteria 27975
105 Ga0496118_0006827 3300048921 Bacteria 12384
106 Ga0496118_0058388 3300048921 Bacteria 2883
107 Ga0496119_0010729 3300048922 Bacteria 7679
108 Ga0496119_0014510 3300048922 Bacteria 6158
109 Ga0496119_0019101 3300048922 Bacteria 5065
110 Ga0496119_0083478 3300048922 Bacteria 1834
111 Ga0496120_0001014 3300048923 Bacteria 37596
112 Ga0496120_0026888 3300048923 Bacteria 3547
113 Ga0496120_0039442 3300048923 Bacteria 2786
114 Ga0496121_0035682 3300048924 Bacteria 4449
115 Ga0496122_0000030 3300048925 Bacteria 331586
116 Ga0496122_0029507 3300048925 Bacteria 4625
117 Ga0496123_0000024 3300048926 Bacteria 331587
118 Ga0496123_0028721 3300048926 Bacteria 4111
119 Ga0496124_0000439 3300048927 Bacteria 73567
120 Ga0496124_0020994 3300048927 Bacteria 6023
121 Ga0496124_0087399 3300048927 Bacteria 2549
122 Ga0496124_0099277 3300048927 Bacteria 2361
123 Ga0496125_0000061 3300048928 Bacteria 262739
124 Ga0496125_0022774 3300048928 Bacteria 5807
125 Ga0496125_0104060 3300048928 Bacteria 2080
126 Ga0496126_0000013 3300048929 Bacteria 690046
127 Ga0496126_0088821 3300048929 Bacteria 2721
128 Ga0496126_0120073 3300048929 Bacteria 2281
129 Ga0501032_0010988 3300049569 Bacteria 6509
130 Ga0501032_0035064 3300049569 Bacteria 3431
131 Ga0501032_0139052 3300049569 Bacteria 1599
132 Ga0501033_0010127 3300049570 Bacteria 7235
133 Ga0501033_0121626 3300049570 Bacteria 1894
134 Ga0501033_0160319 3300049570 Bacteria 1619
135 Ga0501034_0015746 3300049571 Bacteria 7764
136 Ga0501034_0072690 3300049571 Bacteria 3448
137 Ga0501034_0078862 3300049571 Bacteria 3296
138 Ga0501034_0101240 3300049571 Bacteria 2874
139 Ga0501034_0118574 3300049571 Bacteria 2633
140 Ga0501034_0206720 3300049571 Bacteria 1919
141 Ga0501036_0244224 3300049572 Bacteria 1505
142 Ga0501037_0022947 3300049573 Bacteria 4615
143 Ga0501037_0066543 3300049573 Bacteria 2624
144 Ga0501038_0065789 3300049574 Bacteria 3088
145 Ga0501038_0094995 3300049574 Bacteria 2491
146 Ga0501039_0140715 3300049575 Bacteria 1895
147 Ga0501042_0003175 3300049578 Bacteria 10247
148 Ga0501043_0033886 3300049579 Bacteria 4018
149 Ga0501043_0051250 3300049579 Bacteria 3243
150 Ga0501043_0209445 3300049579 Bacteria 1511
151 Ga0501043_0292905 3300049579 Bacteria 1245
152 Ga0501046_0014152 3300049580 Bacteria 6738
153 Ga0501046_0014818 3300049580 Bacteria 6562
154 Ga0501047_0003067 3300049581 Bacteria 15842
155 Ga0501047_0010294 3300049581 Bacteria 8844
156 Ga0501047_0043053 3300049581 Bacteria 4362
157 Ga0501067_0021659 3300049583 Bacteria 3557
158 Ga0501070_0000088 3300049586 Bacteria 77423
159 Ga0501070_0041776 3300049586 Bacteria 3819
160 Ga0501070_0071291 3300049586 Bacteria 2877
161 Ga0501070_0095654 3300049586 Bacteria 2457
162 Ga0501072_0055684 3300049588 Bacteria 3116
163 Ga0501074_0068040 3300049590 Bacteria 2560
164 Ga0501083_0000052 3300049744 Bacteria 84349
165 Ga0501083_0008309 3300049744 Bacteria 7341
166 Ga0501035_0014725 3300049822 Bacteria 7219
167 Ga0501035_0099565 3300049822 Bacteria 2551
168 Ga0501044_0003513 3300049823 Bacteria 17638
169 Ga0501044_0011377 3300049823 Bacteria 9636
170 Ga0501044_0066729 3300049823 Bacteria 3667
171 Ga0501044_0365407 3300049823 Bacteria 1360
172 Ga0500635_0000013 3300053080 Bacteria 133088
173 Ga0500559_0000372 3300053136 Bacteria 33038
174 Ga0500568_0002975 3300053139 Bacteria 9697
175 Ga0500590_035525 3300053148 Bacteria 2579
176 2644110733 2643221619 Bacteria 4158469
177 2501939832 2501939600 Bacteria 6907073
178 2643767472 2643221549 Bacteria 4042819
179 2643875439 2643221572 Bacteria 3614809
180 2644199100 2643221635 Bacteria 2632343
181 2644279312 2643221649 Bacteria 3867359
182 2644382494 2643221669 Bacteria 3611286
183 2723642351 2721755702 Bacteria 4373124
184 2753301717 2751185788 Bacteria 4541048
185 2774384553 2773857759 Bacteria 2963774
186 2795797867 2795385472 Bacteria 6627535
187 2808631158 2808606306 Bacteria 3608896
188 2808885673 2808606368 Bacteria 3174172
189 2808902326 2808606372 Bacteria 4649509
190 2893684458 2893684298 Bacteria 2897960
191 2895661529 2895660088 Bacteria 3782833
192 2902584855 2902582711 Bacteria 6187705
193 2904433136 2904430863 Bacteria 3486923
194 2904502743 2904501621 Bacteria 3401437
195 2906800697 2906799679 Bacteria 4031749
196 2908677574 2908674828 Bacteria 3382763
197 2909075142 2909074476 Bacteria 3436050
198 2919040556 2919039151 Bacteria 3391018
199 2919043656 2919042368 Bacteria 3905917
200 2919445959 2919443155 Bacteria 4072969
201 2920883758 2920879853 Bacteria 4216831
202 2928106566 2928104781 Bacteria 3877447
203 2928501616 2928500415 Bacteria 3384541
204 2935412732 2935409751 Bacteria 4179611
205 2939658281 2939657138 Bacteria 3740283
206 2939664003 2939660829 Bacteria 3784848
207 2977253857 2977251589 Bacteria 2952848
208 2984553875 2984551494 Bacteria 3877562
209 8002811854 8002811521 Bacteria 2942897
210 8047711576 8047710418 Bacteria 11023148
211 JGI24735J21928_10004172
212 JGI25406J46586_10016227
213 Ga0006562J51391_1028904
214 Ga0058859_10095246
215 Ga0058863_11740987
216 Ga0058861_11903183
217 Ga0058860_12163698
218 Ga0065714_10014224
219 Ga0070658_10000833
220 Ga0070658_10109182
221 Ga0070659_100024279
222 Ga0070667_100000033
223 Ga0070714_100000050
224 Ga0070713_100305406
225 Ga0070700_100000026
226 Ga0070665_100004911
227 Ga0068859_100001517
228 Ga0068864_100023965
229 Ga0068863_100005183
230 Ga0068863_100032678
231 Ga0068858_100057217
232 Ga0068860_100000010
233 Ga0068862_100000008
234 Ga0081539_10000682
235 Ga0097620_100001516
236 Ga0105247_10000019
237 Ga0105247_10036816
238 Ga0105248_10023398
239 Ga0105249_10000019
240 Ga0157370_10023935
241 Ga0157370_10117850
242 Ga0157369_10456864
243 Ga0163162_10255666
244 Ga0163162_10292859
245 Ga0157375_10144053
246 Ga0157379_10134732
247 Ga0206354_10673422
248 Ga0224712_10061233
249 Ga0209672_100006
250 Ga0209147_101211
251 Ga0209148_1000015
252 Ga0209455_1000013
253 Ga0207710_10000036
254 Ga0207647_10045489
255 Ga0207705_10000006
256 Ga0207681_10001794
257 Ga0207664_10000003
258 Ga0207711_10001201
259 Ga0207711_10141765
260 Ga0207712_10000025
261 Ga0207712_10136761
262 Ga0207658_10000125
263 Ga0207708_10000014
264 Ga0207641_10004618
265 Ga0207641_10058458
266 Ga0207676_10039576
267 Ga0268266_10004645
268 Ga0268265_10000007
269 Ga0268264_10000007
270 Ga0307518_10049469
271 Ga0307410_10045798
272 Ga0307410_10132517
273 Ga0307406_10052506
274 Ga0307409_100020357
275 Ga0395899_0000786
276 Ga0395900_0061011
277 Ga0466965_0000002
278 Ga0466970_0113818
279 Ga0466958_0198654
280 Ga0495590_0001219
281 Ga0495629_0126414
282 Ga0495629_0263212
283 Ga0495672_0033679
284 Ga0495672_0039725
285 Ga0496100_0049554
286 Ga0496101_0004689
287 Ga0496101_0023885
288 Ga0496102_0000789
289 Ga0496102_0048205
290 Ga0496103_0002100
291 Ga0496104_0031468
292 Ga0496104_0214572
293 Ga0496105_0005304
294 Ga0496105_0020315
295 Ga0496107_0008744
296 Ga0496108_0042142
297 Ga0496108_0129265
298 Ga0496109_0010022
299 Ga0496110_0012890
300 Ga0496110_0168889
301 Ga0496111_0031229
302 Ga0496112_0036802
303 Ga0496112_0262739
304 Ga0496114_0027821
305 Ga0496114_0154393
306 Ga0496115_0004597
307 Ga0496116_0014171
308 Ga0496116_0015879
309 Ga0496117_0000564
310 Ga0496117_0001925
311 Ga0496117_0011044
312 Ga0496117_0106159
313 Ga0496118_0001102
314 Ga0496118_0002101
315 Ga0496118_0006827
316 Ga0496118_0058388
317 Ga0496119_0010729
318 Ga0496119_0014510
319 Ga0496119_0019101
320 Ga0496119_0083478
321 Ga0496120_0001014
322 Ga0496120_0026888
323 Ga0496120_0039442
324 Ga0496121_0035682
325 Ga0496122_0000030
326 Ga0496122_0029507
327 Ga0496123_0000024
328 Ga0496123_0028721
329 Ga0496124_0000439
330 Ga0496124_0020994
331 Ga0496124_0087399
332 Ga0496124_0099277
333 Ga0496125_0000061
334 Ga0496125_0022774
335 Ga0496125_0104060
336 Ga0496126_0000013
337 Ga0496126_0088821
338 Ga0496126_0120073
339 Ga0501032_0010988
340 Ga0501032_0035064
341 Ga0501032_0139052
342 Ga0501033_0010127
343 Ga0501033_0121626
344 Ga0501033_0160319
345 Ga0501034_0015746
346 Ga0501034_0072690
347 Ga0501034_0078862
348 Ga0501034_0101240
349 Ga0501034_0118574
350 Ga0501034_0206720
351 Ga0501036_0244224
352 Ga0501037_0022947
353 Ga0501037_0066543
354 Ga0501038_0065789
355 Ga0501038_0094995
356 Ga0501039_0140715
357 Ga0501042_0003175
358 Ga0501043_0033886
359 Ga0501043_0051250
360 Ga0501043_0209445
361 Ga0501043_0292905
362 Ga0501046_0014152
363 Ga0501046_0014818
364 Ga0501047_0003067
365 Ga0501047_0010294
366 Ga0501047_0043053
367 Ga0501067_0021659
368 Ga0501070_0000088
369 Ga0501070_0041776
370 Ga0501070_0071291
371 Ga0501070_0095654
372 Ga0501072_0055684
373 Ga0501074_0068040
374 Ga0501083_0000052
375 Ga0501083_0008309
376 Ga0501035_0014725
377 Ga0501035_0099565
378 Ga0501044_0003513
379 Ga0501044_0011377
380 Ga0501044_0066729
381 Ga0501044_0365407
382 Ga0500635_0000013
383 Ga0500559_0000372
384 Ga0500568_0002975
385 Ga0500590_035525
386 2644110733
387 2501939832
388 2643767472
389 2643875439
390 2644199100
391 2644279312
392 2644382494
393 2723642351
394 2753301717
395 2774384553
396 2795797867
397 2808631158
398 2808885673
399 2808902326
400 2893684458
401 2895661529
402 2902584855
403 2904433136
404 2904502743
405 2906800697
406 2908677574
407 2909075142
408 2919040556
409 2919043656
410 2919445959
411 2920883758
412 2928106566
413 2928501616
414 2935412732
415 2939658281
416 2939664003
417 2977253857
418 2984553875
419 8002811854
420 8047711576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

147

350

0.99

PF13604

AAA_30

AAA domain

151

377

0.84

PF13245

AAA_19

AAA domain

155

308

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dtj-assembly4.cif.gz_D crystal structure of nova-2 kh3 k-homology rna-binding domain 0.888 16 76
6y2d-assembly1.cif.gz_A crystal structure of the second kh domain of fubp1 0.8874 16 78
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8792 112 313
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8783 112 313
6qh2-assembly1.cif.gz_A solution nmr ensemble for a chimeric kh-s1 domain construct of exosomal polynucleotide phosphrylase at 298k compiled using the comand method 0.8776 17 79
ID Description Score Start End Superfamily
af_O59810_737_809_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9297 17 85 3.30.1370.10
af_F1R9Y8_652_728_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9275 15 82 3.30.1370.10
af_D4A4T3_493_567_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.927 15 83 3.30.1370.10
af_Q17832_484_564_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9256 15 85 3.30.1370.10
af_Q2FY01_1_104_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9199 17 100 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A358NH73-F1-model_v4 Phosphate starvation-inducible protein PhoH 0.9404 14 100 GO:0003723
AF-A0A496LEA0-F1-model_v4 deleted 0.9296 14 100
AF-A0A436M343-F1-model_v4 deleted 0.9267 12 99
AF-A0A353K4T4-F1-model_v4 deleted 0.9261 8 100
AF-A0A380FH42-F1-model_v4 PhoH-like protein 0.9082 106 285 GO:0005524
GO:0005829

Map