F321034

General Info

Members Datasets Scaffolds Average Seq Length
210 188 121 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005376324|8005377051
Length 295
Sequence LPASQPKSQNLPVAFASGGIIGALGGLIGLGGAEFRLPLLIGLFNFAALEAVILNKAMSLVVVATALPFRAATVPFSTIAENWPIIVNLLAGSLLGAWFGAGWATRLKSETLYKVIAAMLVAIAAVLVVGHDATASQALLTGVAQMIAGVVAGFIIGIVASLLGVAGGELLIPTLVLLFGADIKLAGSLSLAVSLPTMLVGFTRFSRDQSFSVFGRNKTFLLVMAGGSIVGTFAGGLLLGIVPNAFLLPALAAILLISAIKVWRHSQFNDTREIMTLFSSFERPCCDCLCAVWIE

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
8 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
9 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
10 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
11 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
12 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
15 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
16 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
17 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
18 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
19 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
20 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
21 2643221557 Ensifer sp. Root558 Isolate Unclassified
22 2643221607 Rhizobium sp. Root73 Isolate Unclassified
23 2643221610 Ensifer sp. Root74 Isolate Unclassified
24 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
25 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
26 2643221651 Afipia sp. Root123D2 Isolate Unclassified
27 2643221668 Ensifer sp. Root423 Isolate Unclassified
28 2643221675 Ensifer sp. Root1298 Isolate Unclassified
29 2643221680 Ensifer sp. Root1312 Isolate Unclassified
30 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
31 2643221723 Ensifer sp. Root278 Isolate Unclassified
32 2643221726 Ensifer sp. Root954 Isolate Unclassified
33 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
34 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
35 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
36 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
37 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
38 2738541293 Rhizobium sp. GV031 Isolate Unclassified
39 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
40 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
41 2791355263 Rhizobium chutanense C5 Isolate Nodule
42 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
43 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
44 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
45 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
46 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
47 2838061910 Rhizobium phaseoli L15 Isolate Nodule
48 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
49 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
50 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
53 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
54 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
55 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
56 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
57 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
58 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
59 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
60 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
61 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
62 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
63 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
64 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
65 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
66 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
67 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
68 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
69 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
70 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
71 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
72 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
92 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
179 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
180 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
181 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
182 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
183 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
184 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
185 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
186 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
187 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
188 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.62
Metatranscriptomes 0
Isolates 42.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 27.14
Rhizoplane 0.95
Rhizosphere 34.76
Stem 0
Stem Tuber 0
Unclassified 23.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000040 3300002987 Bacteria 68143
2 JGI25151J46595_10002301 3300003187 Bacteria 11674
3 JGI25160J50197_1000128 3300003354 Bacteria 68143
4 JGI25161J50226_1007062 3300003374 Bacteria 1942
5 Ga0055526_1000675 3300003771 Bacteria 26151
6 Ga0055524_1000470 3300003775 Bacteria 32352
7 Ga0055524_1014755 3300003775 Bacteria 2879
8 Ga0055536_1000853 3300003781 Bacteria 20033
9 Ga0055543_1006780 3300004625 Bacteria 2727
10 Ga0065165_1000013 3300005262 Bacteria 301887
11 Ga0070682_100117181 3300005337 Bacteria 1783
12 Ga0070675_100011126 3300005354 Bacteria 7041
13 Ga0070663_100370784 3300005455 Bacteria 1163
14 Ga0068867_100334423 3300005459 Bacteria 1259
15 Ga0070679_100097968 3300005530 Bacteria 2920
16 Ga0070672_100037716 3300005543 Bacteria 3689
17 Ga0070665_100028712 3300005548 Bacteria 5601
18 Ga0068860_100177832 3300005843 Bacteria 2057
19 Ga0099795_10023366 3300007788 Bacteria 2051
20 Ga0123340_1009443 3300009763 Bacteria 9130
21 Ga0123341_1009071 3300009765 Bacteria 9089
22 Ga0213875_10034429 3300021388 Bacteria 2391
23 Ga0209436_100194 3300025208 Bacteria 28386
24 Ga0209130_1000034 3300025284 Bacteria 302439
25 Ga0209675_1040064 3300025291 Bacteria 1033
26 Ga0209025_1000314 3300025294 Bacteria 107720
27 Ga0209564_1000013 3300025295 Bacteria 775755
28 Ga0209564_1002256 3300025295 Bacteria 15797
29 Ga0209256_1000524 3300025299 Bacteria 55735
30 Ga0209256_1005824 3300025299 Bacteria 6862
31 Ga0209256_1015623 3300025299 Bacteria 2642
32 Ga0207426_1000006 3300025302 Bacteria 1025969
33 Ga0209257_1002099 3300025304 Bacteria 20905
34 Ga0207659_10029488 3300025926 Bacteria 3741
35 Ga0207691_10106897 3300025940 Bacteria 2492
36 Ga0268266_10008496 3300028379 Bacteria 9127
37 Ga0268264_10135089 3300028381 Bacteria 2192
38 Ga0265320_10004428 3300031240 Bacteria 9210
39 Ga0265327_10004193 3300031251 Bacteria 12980
40 Ga0265313_10076682 3300031595 Bacteria 1527
41 Ga0307516_10008204 3300031730 Bacteria 11860
42 Ga0307405_10107328 3300031731 Bacteria 1885
43 Ga0307412_10049900 3300031911 Bacteria 2759
44 Ga0307411_10020031 3300032005 Bacteria 3881
45 Ga0373940_0023957 3300035088 Bacteria 1579
46 Ga0373939_0002061 3300035114 Bacteria 4797
47 Ga0373942_0022947 3300035207 Bacteria 1589
48 Ga0373937_0059937 3300036401 Bacteria 3498
49 Ga0436364_0212266 3300037853 Bacteria 1454
50 Ga0436364_0755962 3300037853 Bacteria 2445
51 Ga0436360_0387720 3300039438 Unclassified 1187
52 Ga0436361_0703095 3300039447 Unclassified 1845
53 Ga0436363_1026921 3300039450 Bacteria 2008
54 Ga0451833_1115751 3300041491 Bacteria 8231
55 Ga0451833_1209406 3300041491 Bacteria 1183
56 Ga0451835_0556520 3300041492 Bacteria 2909
57 Ga0451837_0443335 3300041494 Bacteria 3936
58 Ga0451837_0728402 3300041494 Bacteria 5540
59 Ga0451839_0665504 3300041496 Bacteria 4676
60 Ga0451841_0994137 3300041498 Bacteria 5128
61 Ga0451847_0012930 3300041503 Bacteria 1060
62 Ga0451849_1080690 3300041505 Bacteria 1051
63 Ga0451851_0097640 3300041507 Bacteria 4613
64 Ga0451843_0345564 3300041509 Bacteria 5004
65 Ga0451853_1201684 3300041512 Bacteria 3323
66 Ga0451576_0000923 3300045051 Bacteria 55411
67 Ga0495580_0009796 3300046472 Bacteria 7515
68 Ga0495580_0021287 3300046472 Bacteria 4785
69 Ga0495605_0132997 3300046474 Bacteria 1120
70 Ga0495585_0011238 3300046492 Bacteria 5304
71 Ga0495607_0098898 3300046501 Bacteria 1566
72 Ga0495583_0000991 3300046506 Bacteria 32505
73 Ga0495620_0000833 3300046515 Bacteria 19059
74 Ga0495620_0001040 3300046515 Bacteria 17034
75 Ga0495628_0062362 3300046516 Bacteria 2922
76 Ga0495643_0046965 3300046522 Bacteria 2339
77 Ga0495622_0059694 3300046557 Bacteria 1766
78 Ga0495633_0008689 3300046558 Bacteria 5697
79 Ga0495625_0004457 3300046660 Bacteria 13235
80 Ga0495625_0023453 3300046660 Bacteria 4713
81 Ga0495649_0007591 3300046694 Bacteria 6593
82 Ga0495600_0037981 3300046809 Bacteria 3132
83 Ga0495674_0031618 3300047319 Bacteria 4807
84 Ga0495687_000183 3300047443 Bacteria 91212
85 Ga0495686_0063149 3300047472 Bacteria 2296
86 Ga0496115_0236710 3300048918 Bacteria 1505
87 Ga0496116_0000247 3300048919 Bacteria 98384
88 Ga0496116_0036897 3300048919 Bacteria 3415
89 Ga0496121_0159426 3300048924 Bacteria 1652
90 Ga0496124_0034798 3300048927 Bacteria 4414
91 Ga0496124_0351784 3300048927 Bacteria 1042
92 Ga0501298_007912 3300049521 Bacteria 1775
93 Ga0501299_009375 3300049522 Bacteria 1612
94 Ga0501031_0006441 3300049568 Bacteria 7654
95 Ga0501032_0002849 3300049569 Bacteria 13452
96 Ga0501032_0004190 3300049569 Bacteria 10920
97 Ga0501033_0001165 3300049570 Bacteria 23773
98 Ga0501034_0003552 3300049571 Bacteria 17717
99 Ga0501036_0001542 3300049572 Bacteria 17810
100 Ga0501037_0012011 3300049573 Bacteria 6380
101 Ga0501038_0002111 3300049574 Bacteria 18438
102 Ga0501039_0018842 3300049575 Bacteria 5298
103 Ga0501043_0072497 3300049579 Bacteria 2705
104 Ga0501047_0030870 3300049581 Bacteria 5166
105 Ga0501067_0001711 3300049583 Bacteria 12078
106 Ga0501070_0263176 3300049586 Bacteria 1409
107 Ga0501073_0000763 3300049589 Bacteria 22856
108 Ga0501077_0000054 3300049593 Bacteria 58519
109 Ga0501243_011953 3300049675 Bacteria 1367
110 Ga0501080_0000837 3300049742 Bacteria 25129
111 Ga0501044_0009351 3300049823 Bacteria 10687
112 Ga0501044_0021831 3300049823 Bacteria 6826
113 Ga0501212_014542 3300049851 Unclassified 1166
114 Ga0500578_0002082 3300053086 Bacteria 17786
115 Ga0500652_016859 3300053131 Bacteria 2667
116 Ga0500590_000200 3300053148 Bacteria 18250
117 Ga0500616_0002106 3300053153 Bacteria 17324
118 Ga0500616_0008825 3300053153 Bacteria 6201
119 Ga0500616_0010211 3300053153 Bacteria 5632
120 Ga0500633_0002405 3300053160 Bacteria 3840
121 Ga0501082_0070547 3300060353 Unclassified 3008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009763 Ga0123340_1009443 Ga0123340_100944313 174
2 3300049521 Ga0501298_007912 Ga0501298_007912_67_792 199
3 3300049675 Ga0501243_011953 Ga0501243_011953_614_1339 199
4 3300041491 Ga0451833_1115751 Ga0451833_1115751_6039_6821 207
5 3300041492 Ga0451835_0556520 Ga0451835_0556520_829_1611 207
6 3300041494 Ga0451837_0728402 Ga0451837_0728402_3945_4727 207
7 3300041496 Ga0451839_0665504 Ga0451839_0665504_3615_4397 207
8 3300041498 Ga0451841_0994137 Ga0451841_0994137_2101_2883 207
9 3300041505 Ga0451849_1080690 Ga0451849_1080690_125_907 207
10 3300041507 Ga0451851_0097640 Ga0451851_0097640_3615_4397 207
11 3300041509 Ga0451843_0345564 Ga0451843_0345564_3615_4397 207
12 3300046492 Ga0495585_0011238 Ga0495585_0011238_3583_4365 207
13 3300046558 Ga0495633_0008689 Ga0495633_0008689_4560_5342 207
14 3300046660 Ga0495625_0023453 Ga0495625_0023453_3590_4372 207
15 3300041503 Ga0451847_0012930 Ga0451847_0012930_160_1041 212
16 3300053160 Ga0500633_0002405 Ga0500633_0002405_2471_3349 212
17 3300046522 Ga0495643_0046965 Ga0495643_0046965_293_1087 215
18 3300053086 Ga0500578_0002082 Ga0500578_0002082_5449_6243 215
19 3300053153 Ga0500616_0010211 Ga0500616_0010211_4102_4896 215
20 3300036401 Ga0373937_0059937 Ga0373937_0059937_560_1330 216
21 3300041512 Ga0451853_1201684 Ga0451853_1201684_197_1078 216
22 3300046472 Ga0495580_0021287 Ga0495580_0021287_456_1259 216
23 3300046516 Ga0495628_0062362 Ga0495628_0062362_123_926 216
24 3300047319 Ga0495674_0031618 Ga0495674_0031618_3527_4330 216
25 3300007788 Ga0099795_10023366 Ga0099795_100233662 219
26 3300048924 Ga0496121_0159426 Ga0496121_0159426_15_803 219
27 iso_pu_bacteria 2767802442 2770196022 219
28 3300009765 Ga0123341_1009071 Ga0123341_100907113 220
29 3300041494 Ga0451837_0443335 Ga0451837_0443335_1988_2794 220
30 3300046515 Ga0495620_0001040 Ga0495620_0001040_5302_6066 220
31 iso_pu_bacteria 2585427649 2586058792 220
32 3300046474 Ga0495605_0132997 Ga0495605_0132997_198_1001 221
33 3300046501 Ga0495607_0098898 Ga0495607_0098898_478_1281 221
34 3300046506 Ga0495583_0000991 Ga0495583_0000991_26117_26920 221
35 3300046515 Ga0495620_0000833 Ga0495620_0000833_17018_17821 221
36 3300046557 Ga0495622_0059694 Ga0495622_0059694_608_1411 221
37 3300046660 Ga0495625_0004457 Ga0495625_0004457_11085_11888 221
38 3300046694 Ga0495649_0007591 Ga0495649_0007591_2693_3496 221
39 3300047443 Ga0495687_000183 Ga0495687_000183_20208_21011 221
40 3300047472 Ga0495686_0063149 Ga0495686_0063149_645_1448 221
41 3300048918 Ga0496115_0236710 Ga0496115_0236710_419_1246 221
42 3300049522 Ga0501299_009375 Ga0501299_009375_248_1048 221
43 3300049851 Ga0501212_014542 Ga0501212_014542_253_1053 221
44 3300005455 Ga0070663_100370784 Ga0070663_1003707842 222
45 3300031911 Ga0307412_10049900 Ga0307412_100499003 223
46 3300039450 Ga0436363_1026921 Ga0436363_1026921_164_991 223
47 3300048919 Ga0496116_0000247 Ga0496116_0000247_80533_81339 223
48 3300005354 Ga0070675_100011126 Ga0070675_1000111266 224
49 3300005459 Ga0068867_100334423 Ga0068867_1003344231 224
50 3300005843 Ga0068860_100177832 Ga0068860_1001778321 224
51 3300025926 Ga0207659_10029488 Ga0207659_100294883 224
52 3300028381 Ga0268264_10135089 Ga0268264_101350892 224
53 iso_pu_bacteria 2882632389 2882633164 224
54 3300003775 Ga0055524_1014755 Ga0055524_10147553 225
55 3300005337 Ga0070682_100117181 Ga0070682_1001171812 225
56 3300005530 Ga0070679_100097968 Ga0070679_1000979682 225
57 3300005543 Ga0070672_100037716 Ga0070672_1000377161 225
58 3300005548 Ga0070665_100028712 Ga0070665_1000287124 225
59 3300025295 Ga0209564_1002256 Ga0209564_10022562 225
60 3300025299 Ga0209256_1015623 Ga0209256_10156233 225
61 3300025940 Ga0207691_10106897 Ga0207691_101068974 225
62 3300028379 Ga0268266_10008496 Ga0268266_100084969 225
63 3300031240 Ga0265320_10004428 Ga0265320_100044282 225
64 3300031595 Ga0265313_10076682 Ga0265313_100766821 225
65 3300048927 Ga0496124_0034798 Ga0496124_0034798_1808_2614 225
66 3300048919 Ga0496116_0036897 Ga0496116_0036897_2134_2946 226
67 3300048927 Ga0496124_0351784 Ga0496124_0351784_81_893 226
68 3300053131 Ga0500652_016859 Ga0500652_016859_1591_2382 226
69 3300031731 Ga0307405_10107328 Ga0307405_101073282 228
70 3300032005 Ga0307411_10020031 Ga0307411_100200311 228
71 3300037853 Ga0436364_0755962 Ga0436364_0755962_349_1164 228
72 iso_pu_bacteria 2513237090 2513608562 228
73 3300037853 Ga0436364_0212266 Ga0436364_0212266_181_954 229
74 iso_pu_bacteria 2718217997 2719669104 229
75 iso_pu_bacteria 2718218199 2720489798 229
76 iso_pu_bacteria 2721755556 2723030563 229
77 iso_pu_bacteria 2721755684 2723564925 229
78 iso_pu_bacteria 2728369352 2730111096 229
79 iso_pu_bacteria 2838016132 2838016672 229
80 iso_pu_bacteria 2838061910 2838064457 229
81 iso_pu_bacteria 8005282627 8005284226 229
82 3300031251 Ga0265327_10004193 Ga0265327_100041939 230
83 3300045051 Ga0451576_0000923 Ga0451576_0000923_24114_24947 230
84 iso_pu_bacteria 2508501127 2509140175 230
85 iso_pu_bacteria 2513237085 2513575644 230
86 iso_pu_bacteria 2585427633 2585995596 230
87 iso_pu_bacteria 2989392574 2989395277 230
88 iso_pu_bacteria 8055617313 8055617468 230
89 3300046809 Ga0495600_0037981 Ga0495600_0037981_177_1088 231
90 3300053148 Ga0500590_000200 Ga0500590_000200_16830_17741 231
91 3300060353 Ga0501082_0070547 Ga0501082_0070547_699_1517 231
92 iso_pu_bacteria 2585427526 2585525075 231
93 3300049568 Ga0501031_0006441 Ga0501031_0006441_2602_3402 232
94 3300049569 Ga0501032_0002849 Ga0501032_0002849_68_877 232
95 3300049569 Ga0501032_0004190 Ga0501032_0004190_7646_8446 232
96 3300049570 Ga0501033_0001165 Ga0501033_0001165_13628_14428 232
97 3300049571 Ga0501034_0003552 Ga0501034_0003552_12685_13485 232
98 3300049572 Ga0501036_0001542 Ga0501036_0001542_12440_13240 232
99 3300049573 Ga0501037_0012011 Ga0501037_0012011_1363_2163 232
100 3300049574 Ga0501038_0002111 Ga0501038_0002111_4945_5745 232
101 3300049575 Ga0501039_0018842 Ga0501039_0018842_756_1556 232
102 3300049579 Ga0501043_0072497 Ga0501043_0072497_438_1238 232
103 3300049581 Ga0501047_0030870 Ga0501047_0030870_1821_2621 232
104 3300049583 Ga0501067_0001711 Ga0501067_0001711_10864_11673 232
105 3300049586 Ga0501070_0263176 Ga0501070_0263176_402_1202 232
106 3300049589 Ga0501073_0000763 Ga0501073_0000763_1831_2640 232
107 3300049593 Ga0501077_0000054 Ga0501077_0000054_23277_24086 232
108 3300049742 Ga0501080_0000837 Ga0501080_0000837_19453_20262 232
109 3300049823 Ga0501044_0009351 Ga0501044_0009351_2976_3785 232
110 3300049823 Ga0501044_0021831 Ga0501044_0021831_1693_2493 232
111 iso_pu_bacteria 2508501122 2509112337 232
112 iso_pu_bacteria 2615840624 2616298468 232
113 iso_pu_bacteria 2791355082 2792584476 232
114 iso_pu_bacteria 2802429606 2805937313 232
115 iso_pu_bacteria 2916076590 2916082147 232
116 iso_pu_bacteria 2935901341 2935905196 232
117 iso_pu_bacteria 8005497431 8005503824 232
118 iso_pu_bacteria 8005668836 8005675603 232
119 iso_pu_bacteria 8049293176 8049299016 232
120 3300035088 Ga0373940_0023957 Ga0373940_0023957_120_905 233
121 3300035114 Ga0373939_0002061 Ga0373939_0002061_2259_3044 233
122 3300035207 Ga0373942_0022947 Ga0373942_0022947_477_1262 233
123 iso_pu_bacteria 2554235132 2554818375 233
124 3300053153 Ga0500616_0008825 Ga0500616_0008825_3145_3933 234
125 iso_pu_bacteria 2643221623 2644132346 234
126 iso_pu_bacteria 8005497431 8005502241 234
127 iso_pu_bacteria 8005668836 8005673667 234
128 iso_pu_bacteria 2513237088 2513597522 235
129 iso_pu_bacteria 2582581867 2585399322 235
130 iso_pu_bacteria 2643221651 2644291572 235
131 iso_pu_bacteria 2874168670 2874176390 235
132 iso_pu_bacteria 2929199973 2929201772 235
133 iso_pu_bacteria 2957443900 2957448979 235
134 iso_pu_bacteria 2960660292 2960665599 235
135 iso_pu_bacteria 3004334049 3004340611 235
136 iso_pu_bacteria 8018150411 8018153779 235
137 iso_pu_bacteria 2513237088 2513599439 236
138 iso_pu_bacteria 2513237146 2513924793 236
139 iso_pu_bacteria 2582581294 2585203251 236
140 iso_pu_bacteria 2582581308 2585282726 236
141 iso_pu_bacteria 2585427633 2585993930 236
142 iso_pu_bacteria 2599185170 2599416353 236
143 iso_pu_bacteria 2643221557 2643803934 236
144 iso_pu_bacteria 2643221607 2644050134 236
145 iso_pu_bacteria 2643221610 2644067149 236
146 iso_pu_bacteria 2643221636 2644204807 236
147 iso_pu_bacteria 2643221668 2644377032 236
148 iso_pu_bacteria 2643221675 2644418241 236
149 iso_pu_bacteria 2643221680 2644451663 236
150 iso_pu_bacteria 2643221686 2644483055 236
151 iso_pu_bacteria 2643221726 2644687118 236
152 iso_pu_bacteria 2791355263 2793343577 236
153 iso_pu_bacteria 2802429636 2806070886 236
154 iso_pu_bacteria 2838022645 2838022802 236
155 iso_pu_bacteria 2838035591 2838036471 236
156 iso_pu_bacteria 2842198810 2842201371 236
157 iso_pu_bacteria 2916014648 2916015602 236
158 iso_pu_bacteria 2923556063 2923561602 236
159 iso_pu_bacteria 2936367885 2936368353 236
160 iso_pu_bacteria 2936375103 2936376185 236
161 iso_pu_bacteria 2937002841 2937009662 236
162 iso_pu_bacteria 3005452660 3005455743 236
163 iso_pu_bacteria 8005376324 8005376841 236
164 iso_pu_bacteria 8005542996 8005550072 236
165 iso_pu_bacteria 8024479707 8024480880 236
166 3300046472 Ga0495580_0009796 Ga0495580_0009796_6200_7018 237
167 iso_pu_bacteria 2513237088 2513595468 237
168 iso_pu_bacteria 2515154122 2515684011 237
169 iso_pu_bacteria 2841734538 2841736419 237
170 iso_pu_bacteria 2871474448 2871477217 237
171 iso_pu_bacteria 2878788777 2878788968 237
172 iso_pu_bacteria 2902682994 2902687185 237
173 iso_pu_bacteria 2937836603 2937843341 237
174 iso_pu_bacteria 2958071322 2958077374 237
175 iso_pu_bacteria 2958122699 2958126364 237
176 iso_pu_bacteria 2977872689 2977877103 237
177 iso_pu_bacteria 8004633249 8004634681 237
178 iso_pu_bacteria 2510461076 2510898197 238
179 iso_pu_bacteria 2513237084 2513573487 238
180 iso_pu_bacteria 2515075009 2515110845 238
181 iso_pu_bacteria 2515154116 2515661814 238
182 iso_pu_bacteria 2643221723 2644676135 238
183 iso_pu_bacteria 2738541293 2738805187 238
184 iso_pu_bacteria 8005376324 8005377051 238
185 iso_pu_bacteria 8005460587 8005461483 238
186 3300041491 Ga0451833_1209406 Ga0451833_1209406_233_1042 239
187 3300053153 Ga0500616_0002106 Ga0500616_0002106_5841_6695 239
188 3300003187 JGI25151J46595_10002301 JGI25151J46595_100023014 240
189 3300003771 Ga0055526_1000675 Ga0055526_100067511 240
190 3300003775 Ga0055524_1000470 Ga0055524_10004707 240
191 3300021388 Ga0213875_10034429 Ga0213875_100344291 240
192 3300025291 Ga0209675_1040064 Ga0209675_10400642 240
193 3300025294 Ga0209025_1000314 Ga0209025_100031476 240
194 3300025295 Ga0209564_1000013 Ga0209564_1000013213 240
195 3300025299 Ga0209256_1000524 Ga0209256_100052424 240
196 3300025299 Ga0209256_1005824 Ga0209256_10058247 240
197 3300025304 Ga0209257_1002099 Ga0209257_100209910 240
198 3300031730 Ga0307516_10008204 Ga0307516_100082043 241
199 3300039438 Ga0436360_0387720 Ga0436360_0387720_147_965 241
200 3300039447 Ga0436361_0703095 Ga0436361_0703095_788_1606 241
201 iso_pu_bacteria 2854916844 2854917975 241
202 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004079 242
203 3300003354 JGI25160J50197_1000128 JGI25160J50197_10001282 242
204 3300003374 JGI25161J50226_1007062 JGI25161J50226_10070622 242
205 3300003781 Ga0055536_1000853 Ga0055536_10008532 242
206 3300004625 Ga0055543_1006780 Ga0055543_10067802 242
207 3300005262 Ga0065165_1000013 Ga0065165_1000013221 242
208 3300025208 Ga0209436_100194 Ga0209436_1001943 242
209 3300025284 Ga0209130_1000034 Ga0209130_1000034215 242
210 3300025302 Ga0207426_1000006 Ga0207426_1000006588 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

2

127

0.9

PF01925

TauE

Sulfite exporter TauE/SafE

133

283

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.3881 16 237
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.3642 16 237
5f3q-assembly1.cif.gz_B crystal structure of a noncanonical dicer protein from entamoeba histolytica 0.3166 59 221
6qsk-assembly2.cif.gz_G-2 crystal structure of a nucleotide sugar transporter with bound nucleotide monophosphate. 0.3092 14 225
5f3q-assembly1.cif.gz_A crystal structure of a noncanonical dicer protein from entamoeba histolytica 0.3063 59 221
ID Description Score Start End Superfamily
af_Q8BH31_42_222_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3946 52 227 1.20.1250.20
af_A0A1D6PYC4_373_583_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.376 52 242 1.20.1250.20
af_C0HHN4_355_518_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3648 52 242 1.20.1250.20
af_A4IBH0_39_267_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3528 52 227 1.20.1250.20
af_C0HHN4_355_518_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3471 52 242 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4R8UNW1-F1-model_v4 deleted 0.9087 35 230
AF-A0A229SVZ9-F1-model_v4 Probable membrane transporter protein 0.8854 14 241 GO:0005886
AF-A0A5J6JH36-F1-model_v4 Probable membrane transporter protein 0.8815 12 242 GO:0005886
AF-A0A0A0J1H7-F1-model_v4 Probable membrane transporter protein 0.8741 31 213 GO:0005886
AF-A0A249MRK4-F1-model_v4 Probable membrane transporter protein 0.872 10 242 GO:0005886

Feature Viewer

pLDDT pTM Quality
73.41 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map