F321672

General Info

Members Datasets Scaffolds Average Seq Length
211 143 208 149

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10048072|Ga0207695_100480724
Length 172
Sequence LEFCIPPYPVNITKMHTIINDAVFLKKGFQISTDKSLLDLNLIYNYLDKESYWAQGIPLERVEKAIENSFCFGIYSGSEQAGFARVITDKATFAYLCDVFVLSKYRRLGLSKWLIQTIVQHPELQGLRRWSLATADAHGLYRQFGFTELSKPHVWMEIHSPYRTIKKEGDEQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
3 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
128 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
129 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
133 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
140 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
143 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.54
Nodule 0
Rhizoplane 1.42
Rhizosphere 60.66
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3895340 2162886007 Bacteria 17367
2 JGI24739J22299_10006815 3300001989 Bacteria 4300
3 JGI24739J22299_10015860 3300001989 Bacteria 2734
4 JGI25154J39366_1000192 3300002738 Bacteria 44861
5 JGI25157J39369_1004907 3300002741 Bacteria 2297
6 JGI25157J39369_1025379 3300002741 Unclassified 692
7 JGI25153J46596_10002098 3300003215 Bacteria 11709
8 JGI25153J46596_10006727 3300003215 Bacteria 5769
9 rootH1_10052378 3300003316 Bacteria 2701
10 rootH1_10192731 3300003316 Bacteria 1224
11 rootL2_10074056 3300003322 Bacteria 9616
12 rootL2_10101155 3300003322 Unclassified 3615
13 rootL2_10166127 3300003322 Bacteria 3299
14 rootH1_10012545 3300003323 Bacteria 12460
15 rootH1_10244502 3300003323 Bacteria 3567
16 JGI25160J50197_1001365 3300003354 Bacteria 12297
17 Ga0055526_1006135 3300003771 Bacteria 6624
18 Ga0055526_1015123 3300003771 Bacteria 3116
19 Ga0055528_1000610 3300003790 Bacteria 26690
20 Ga0055530_10003642 3300003791 Bacteria 8638
21 Ga0055531_10000003 3300003794 Bacteria 274424
22 Ga0055531_10023890 3300003794 Bacteria 2274
23 Ga0055543_1012578 3300004625 Bacteria 1696
24 Ga0065165_1000232 3300005262 Bacteria 97117
25 Ga0065165_1025568 3300005262 Bacteria 1960
26 Ga0065714_10002550 3300005288 Bacteria 28774
27 Ga0065714_10084465 3300005288 Bacteria 2196
28 Ga0065704_10000227 3300005289 Bacteria 66518
29 Ga0070674_100630138 3300005356 Bacteria 909
30 Ga0070673_100798388 3300005364 Bacteria 871
31 Ga0070688_100109300 3300005365 Bacteria 1836
32 Ga0070667_100002807 3300005367 Bacteria 15027
33 Ga0070667_100047532 3300005367 Bacteria 3610
34 Ga0070685_10440665 3300005466 Bacteria 910
35 Ga0070706_100610523 3300005467 Bacteria 1013
36 Ga0070697_100089400 3300005536 Bacteria 2545
37 Ga0068853_100316672 3300005539 Unclassified 1445
38 Ga0068853_100750762 3300005539 Bacteria 932
39 Ga0068853_101648862 3300005539 Bacteria 621
40 Ga0070695_100270733 3300005545 Bacteria 1244
41 Ga0070696_100304813 3300005546 Bacteria 1221
42 Ga0070665_100000063 3300005548 Bacteria 218300
43 Ga0068855_100000240 3300005563 Bacteria 69408
44 Ga0068855_100000652 3300005563 Bacteria 42351
45 Ga0068855_100206161 3300005563 Bacteria 2212
46 Ga0068857_100457939 3300005577 Bacteria 1193
47 Ga0068856_100000110 3300005614 Bacteria 81321
48 Ga0068856_100003903 3300005614 Bacteria 14952
49 Ga0068856_100139733 3300005614 Bacteria 2429
50 Ga0068859_100000026 3300005617 Bacteria 188742
51 Ga0068859_100023433 3300005617 Bacteria 6195
52 Ga0068863_101352169 3300005841 Bacteria 720
53 Ga0068858_100017911 3300005842 Bacteria 6633
54 Ga0068860_100000103 3300005843 Bacteria 139076
55 Ga0068860_100004577 3300005843 Bacteria 14118
56 Ga0070715_10084164 3300006163 Bacteria 1450
57 Ga0070716_100375775 3300006173 Bacteria 1014
58 Ga0075366_10367613 3300006195 Bacteria 884
59 Ga0075428_101950398 3300006844 Unclassified 609
60 Ga0075433_11143569 3300006852 Unclassified 676
61 Ga0097620_100000026 3300006931 Bacteria 188742
62 Ga0097620_100023433 3300006931 Bacteria 6195
63 Ga0105240_10065929 3300009093 Bacteria 4494
64 Ga0105240_10156943 3300009093 Bacteria 2705
65 Ga0105240_10350964 3300009093 Bacteria 1674
66 Ga0105247_10007025 3300009101 Bacteria 6927
67 Ga0114129_10005023 3300009147 Bacteria 18613
68 Ga0114129_10019491 3300009147 Bacteria 9659
69 Ga0114129_11353431 3300009147 Unclassified 880
70 Ga0105241_10015460 3300009174 Bacteria 5591
71 Ga0105241_10346592 3300009174 Unclassified 1288
72 Ga0105241_10723119 3300009174 Unclassified 911
73 Ga0105237_10219224 3300009545 Bacteria 1903
74 Ga0105249_10061848 3300009553 Bacteria 3436
75 Ga0105249_10947371 3300009553 Bacteria 929
76 Ga0105239_10000002 3300010375 Bacteria 610298
77 Ga0105239_10007919 3300010375 Bacteria 12147
78 Ga0105239_10665858 3300010375 Bacteria 1189
79 Ga0157373_10000105 3300013100 Bacteria 65415
80 Ga0157373_10699907 3300013100 Bacteria 742
81 Ga0157371_10015384 3300013102 Bacteria 5742
82 Ga0157371_10160153 3300013102 Bacteria 1607
83 Ga0157370_10022918 3300013104 Bacteria 6207
84 Ga0157370_11022766 3300013104 Bacteria 748
85 Ga0157374_10532499 3300013296 Bacteria 1181
86 Ga0157378_10007182 3300013297 Bacteria 9727
87 Ga0157378_10007416 3300013297 Bacteria 9583
88 Ga0157378_10029482 3300013297 Bacteria 4845
89 Ga0163162_10000533 3300013306 Bacteria 35238
90 Ga0157372_10305165 3300013307 Bacteria 1852
91 Ga0157379_10106309 3300014968 Bacteria 2519
92 Ga0157379_10234934 3300014968 Bacteria 1662
93 Ga0157379_10626180 3300014968 Bacteria 1006
94 Ga0182006_1020077 3300015261 Unclassified 2803
95 Ga0182005_1000357 3300015265 Bacteria 25732
96 Ga0163161_10577565 3300017792 Bacteria 924
97 Ga0207425_1024605 3300025245 Bacteria 1249
98 Ga0209646_1000031 3300025246 Bacteria 381260
99 Ga0209026_1000019 3300025250 Bacteria 381260
100 Ga0209026_1004243 3300025250 Bacteria 4348
101 Ga0209673_1000166 3300025273 Bacteria 135260
102 Ga0209673_1101598 3300025273 Unclassified 617
103 Ga0209564_1002289 3300025295 Bacteria 15606
104 Ga0209564_1002520 3300025295 Bacteria 14161
105 Ga0209758_1001139 3300025297 Bacteria 34076
106 Ga0209758_1015284 3300025297 Bacteria 3991
107 Ga0209758_1015919 3300025297 Bacteria 3858
108 Ga0209050_1001257 3300025298 Bacteria 29244
109 Ga0209050_1003589 3300025298 Bacteria 11275
110 Ga0209050_1010723 3300025298 Bacteria 4470
111 Ga0207426_1000263 3300025302 Bacteria 110923
112 Ga0207426_1000583 3300025302 Bacteria 48573
113 Ga0209051_1015015 3300025303 Bacteria 3585
114 Ga0209257_1000008 3300025304 Bacteria 1294570
115 Ga0209257_1004524 3300025304 Bacteria 10679
116 Ga0207710_10220877 3300025900 Bacteria 941
117 Ga0207685_10385216 3300025905 Bacteria 715
118 Ga0207684_10332607 3300025910 Bacteria 1309
119 Ga0207654_10001488 3300025911 Bacteria 12379
120 Ga0207695_10048072 3300025913 Bacteria 4508
121 Ga0207695_10333650 3300025913 Bacteria 1405
122 Ga0207695_10371166 3300025913 Unclassified 1317
123 Ga0207671_10006260 3300025914 Bacteria 10658
124 Ga0207671_10739900 3300025914 Bacteria 781
125 Ga0207664_11529947 3300025929 Unclassified 589
126 Ga0207669_10075106 3300025937 Bacteria 2140
127 Ga0207667_10000037 3300025949 Bacteria 297252
128 Ga0207667_10001001 3300025949 Bacteria 36044
129 Ga0207712_10878059 3300025961 Unclassified 791
130 Ga0207658_10004562 3300025986 Bacteria 9611
131 Ga0207703_10022525 3300026035 Bacteria 4942
132 Ga0207639_10712050 3300026041 Bacteria 932
133 Ga0207702_10000151 3300026078 Bacteria 81314
134 Ga0207702_10008159 3300026078 Bacteria 8853
135 Ga0207702_10193045 3300026078 Bacteria 1883
136 Ga0207702_10710856 3300026078 Bacteria 990
137 Ga0207641_11459331 3300026088 Bacteria 685
138 Ga0268266_10000057 3300028379 Bacteria 284777
139 Ga0268264_10000013 3300028381 Bacteria 513859
140 Ga0268264_10039736 3300028381 Bacteria 3887
141 Ga0307517_10179865 3300028786 Bacteria 1368
142 Ga0307515_10168588 3300028794 Bacteria 2195
143 Ga0265338_10038899 3300028800 Bacteria 4498
144 Ga0265327_10033135 3300031251 Bacteria 2884
145 Ga0307509_10367193 3300031507 Unclassified 1157
146 Ga0307412_10000181 3300031911 Bacteria 44202
147 Ga0307412_11081447 3300031911 Bacteria 713
148 Ga0307414_10003855 3300032004 Bacteria 8067
149 Ga0307510_10002187 3300033180 Bacteria 22098
150 Ga0307510_10472683 3300033180 Unclassified 695
151 Ga0373941_0130737 3300035115 Bacteria 904
152 Ga0373937_1102105 3300036401 Bacteria 743
153 Ga0395900_0009856 3300037418 Bacteria 9787
154 Ga0395905_0000516 3300037471 Bacteria 52868
155 Ga0395901_0010588 3300038443 Bacteria 9342
156 Ga0451802_1326393 3300041460 Bacteria 586
157 Ga0451807_2487364 3300041486 Unclassified 1021
158 Ga0451853_1399857 3300041512 Bacteria 696
159 Ga0495638_0102003 3300046460 Bacteria 1715
160 Ga0495582_0217158 3300046473 Unclassified 1094
161 Ga0495606_0002671 3300046507 Bacteria 20238
162 Ga0495606_0010075 3300046507 Bacteria 7897
163 Ga0495610_0099817 3300046512 Bacteria 1302
164 Ga0495648_0310545 3300046524 Bacteria 735
165 Ga0495652_0037951 3300046529 Bacteria 4177
166 Ga0495640_0690649 3300046533 Unclassified 613
167 Ga0495668_0088672 3300046616 Bacteria 1696
168 Ga0495611_0000691 3300046648 Bacteria 19133
169 Ga0495625_0423990 3300046660 Bacteria 827
170 Ga0495661_0446861 3300046665 Bacteria 623
171 Ga0495687_000118 3300047443 Bacteria 121601
172 Ga0495675_0555643 3300047444 Bacteria 654
173 Ga0495686_0001125 3300047472 Bacteria 31631
174 Ga0496101_0797722 3300048904 Bacteria 745
175 Ga0496121_0404001 3300048924 Bacteria 894
176 Ga0496126_0028991 3300048929 Bacteria 5264
177 Ga0495678_012573 3300049459 Bacteria 4010
178 Ga0501296_081891 3300049519 Unclassified 512
179 Ga0501047_0648505 3300049581 Unclassified 875
180 nmdc:mga0k408_476533_c1 3300050493 Unclassified 740
181 nmdc:mga0k408_77748_c1 3300050493 Bacteria 1940
182 nmdc:mga05p37_312176_c1 3300050507 Bacteria 1863
183 nmdc:mga05p37_3380_c1 3300050507 Bacteria 18623
184 Ga0500646_0006638 3300053090 Bacteria 2945
185 Ga0500646_0218065 3300053090 Unclassified 661
186 Ga0500647_0309425 3300053091 Unclassified 672
187 Ga0500583_0000097 3300053092 Bacteria 48045
188 Ga0500583_0001933 3300053092 Bacteria 6082
189 Ga0500583_0019226 3300053092 Bacteria 2796
190 Ga0500583_0029920 3300053092 Bacteria 2380
191 Ga0500583_0150335 3300053092 Bacteria 1159
192 Ga0500566_0248720 3300053094 Bacteria 866
193 Ga0500618_000526 3300053125 Bacteria 24101
194 Ga0500642_0032899 3300053130 Bacteria 2180
195 Ga0500642_0113606 3300053130 Unclassified 1265
196 Ga0500652_001778 3300053131 Bacteria 6534
197 Ga0500658_0445410 3300053134 Unclassified 590
198 Ga0500568_0009830 3300053139 Bacteria 4520
199 Ga0500568_0042676 3300053139 Bacteria 1816
200 Ga0500589_066446 3300053147 Bacteria 1640
201 Ga0500616_0000044 3300053153 Bacteria 339611
202 Ga0500622_0001237 3300053156 Bacteria 20921
203 Ga0500622_0042208 3300053156 Bacteria 2371
204 Ga0500622_0058057 3300053156 Bacteria 1978
205 Ga0500637_0010271 3300053178 Bacteria 4796
206 Ga0500611_010634 3300053727 Bacteria 1498
207 Ga0500645_047035 3300053730 Unclassified 1265
208 Ga0500587_004779 3300053739 Bacteria 1850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_476533_c1 nmdc:mga0k408_476533_c1_33_425 130
2 3300028381 Ga0268264_10000013 Ga0268264_10000013245 132
3 3300041460 Ga0451802_1326393 Ga0451802_1326393_17_418 133
4 3300005539 Ga0068853_100316672 Ga0068853_1003166722 136
5 3300025913 Ga0207695_10371166 Ga0207695_103711662 136
6 3300005563 Ga0068855_100000652 Ga0068855_10000065219 138
7 3300005614 Ga0068856_100000110 Ga0068856_10000011025 138
8 3300025949 Ga0207667_10001001 Ga0207667_1000100130 138
9 3300026078 Ga0207702_10000151 Ga0207702_1000015125 138
10 3300026078 Ga0207702_10193045 Ga0207702_101930452 138
11 3300013100 Ga0157373_10699907 Ga0157373_106999072 139
12 3300028794 Ga0307515_10168588 Ga0307515_101685884 139
13 3300003323 rootH1_10244502 rootH1_102445023 140
14 3300005614 Ga0068856_100139733 Ga0068856_1001397333 140
15 3300013104 Ga0157370_11022766 Ga0157370_110227662 140
16 3300026078 Ga0207702_10710856 Ga0207702_107108562 140
17 3300046616 Ga0495668_0088672 Ga0495668_0088672_978_1433 140
18 3300046665 Ga0495661_0446861 Ga0495661_0446861_94_549 140
19 3300053125 Ga0500618_000526 Ga0500618_000526_10638_11093 140
20 iso_pu_bacteria 2929921140 2929921343 140
21 iso_pu_bacteria 8003151029 8003157613 140
22 3300003316 rootH1_10192731 rootH1_101927312 141
23 3300005614 Ga0068856_100003903 Ga0068856_1000039034 141
24 3300013296 Ga0157374_10532499 Ga0157374_105324992 141
25 3300026078 Ga0207702_10008159 Ga0207702_100081593 141
26 3300031507 Ga0307509_10367193 Ga0307509_103671933 141
27 3300037418 Ga0395900_0009856 Ga0395900_0009856_6867_7313 141
28 3300037471 Ga0395905_0000516 Ga0395905_0000516_48485_48931 141
29 3300038443 Ga0395901_0010588 Ga0395901_0010588_8304_8750 141
30 3300046460 Ga0495638_0102003 Ga0495638_0102003_478_945 141
31 3300046507 Ga0495606_0010075 Ga0495606_0010075_6864_7322 141
32 3300046524 Ga0495648_0310545 Ga0495648_0310545_105_551 141
33 3300046660 Ga0495625_0423990 Ga0495625_0423990_207_632 141
34 3300047472 Ga0495686_0001125 Ga0495686_0001125_14242_14688 141
35 3300049459 Ga0495678_012573 Ga0495678_012573_1646_2083 141
36 3300049519 Ga0501296_081891 Ga0501296_081891_22_468 141
37 3300053092 Ga0500583_0019226 Ga0500583_0019226_94_561 141
38 3300053130 Ga0500642_0113606 Ga0500642_0113606_164_631 141
39 3300053134 Ga0500658_0445410 Ga0500658_0445410_35_502 141
40 3300053156 Ga0500622_0001237 Ga0500622_0001237_7671_8138 141
41 3300001989 JGI24739J22299_10006815 JGI24739J22299_100068152 142
42 3300002741 JGI25157J39369_1025379 JGI25157J39369_10253792 142
43 3300003215 JGI25153J46596_10006727 JGI25153J46596_100067272 142
44 3300003354 JGI25160J50197_1001365 JGI25160J50197_10013654 142
45 3300003771 Ga0055526_1006135 Ga0055526_10061353 142
46 3300003771 Ga0055526_1015123 Ga0055526_10151233 142
47 3300003790 Ga0055528_1000610 Ga0055528_100061025 142
48 3300003791 Ga0055530_10003642 Ga0055530_100036426 142
49 3300003794 Ga0055531_10023890 Ga0055531_100238903 142
50 3300004625 Ga0055543_1012578 Ga0055543_10125782 142
51 3300005262 Ga0065165_1000232 Ga0065165_100023224 142
52 3300013102 Ga0157371_10160153 Ga0157371_101601532 142
53 3300015265 Ga0182005_1000357 Ga0182005_100035713 142
54 3300025250 Ga0209026_1004243 Ga0209026_10042434 142
55 3300025273 Ga0209673_1000166 Ga0209673_100016644 142
56 3300025273 Ga0209673_1101598 Ga0209673_11015981 142
57 3300025295 Ga0209564_1002289 Ga0209564_100228910 142
58 3300025295 Ga0209564_1002520 Ga0209564_10025207 142
59 3300025297 Ga0209758_1001139 Ga0209758_100113911 142
60 3300025297 Ga0209758_1015284 Ga0209758_10152843 142
61 3300025298 Ga0209050_1003589 Ga0209050_10035892 142
62 3300025302 Ga0207426_1000583 Ga0207426_100058316 142
63 3300025303 Ga0209051_1015015 Ga0209051_10150153 142
64 3300025304 Ga0209257_1004524 Ga0209257_10045245 142
65 3300031911 Ga0307412_11081447 Ga0307412_110814471 142
66 3300047443 Ga0495687_000118 Ga0495687_000118_111776_112204 142
67 3300049581 Ga0501047_0648505 Ga0501047_0648505_242_856 142
68 3300053091 Ga0500647_0309425 Ga0500647_0309425_172_615 142
69 3300001989 JGI24739J22299_10015860 JGI24739J22299_100158603 144
70 3300002738 JGI25154J39366_1000192 JGI25154J39366_100019227 144
71 3300002741 JGI25157J39369_1004907 JGI25157J39369_10049072 144
72 3300003215 JGI25153J46596_10002098 JGI25153J46596_100020983 144
73 3300003794 Ga0055531_10000003 Ga0055531_1000000392 144
74 3300005262 Ga0065165_1025568 Ga0065165_10255682 144
75 3300005288 Ga0065714_10084465 Ga0065714_100844654 144
76 3300005548 Ga0070665_100000063 Ga0070665_100000063112 144
77 3300005843 Ga0068860_100000103 Ga0068860_10000010377 144
78 3300006163 Ga0070715_10084164 Ga0070715_100841643 144
79 3300013306 Ga0163162_10000533 Ga0163162_100005333 144
80 3300013307 Ga0157372_10305165 Ga0157372_103051652 144
81 3300014968 Ga0157379_10626180 Ga0157379_106261802 144
82 3300025245 Ga0207425_1024605 Ga0207425_10246052 144
83 3300025246 Ga0209646_1000031 Ga0209646_100003126 144
84 3300025250 Ga0209026_1000019 Ga0209026_100001926 144
85 3300025297 Ga0209758_1015919 Ga0209758_10159192 144
86 3300025302 Ga0207426_1000263 Ga0207426_100026329 144
87 3300025304 Ga0209257_1000008 Ga0209257_1000008304 144
88 3300025905 Ga0207685_10385216 Ga0207685_103852162 144
89 3300028379 Ga0268266_10000057 Ga0268266_10000057171 144
90 3300031251 Ga0265327_10033135 Ga0265327_100331353 144
91 3300033180 Ga0307510_10002187 Ga0307510_100021873 144
92 3300033180 Ga0307510_10472683 Ga0307510_104726831 144
93 3300046507 Ga0495606_0002671 Ga0495606_0002671_16299_16733 144
94 3300048904 Ga0496101_0797722 Ga0496101_0797722_156_590 144
95 3300048924 Ga0496121_0404001 Ga0496121_0404001_153_587 144
96 3300048929 Ga0496126_0028991 Ga0496126_0028991_1562_1996 144
97 3300053131 Ga0500652_001778 Ga0500652_001778_4963_5397 144
98 3300053139 Ga0500568_0009830 Ga0500568_0009830_995_1429 144
99 3300053139 Ga0500568_0042676 Ga0500568_0042676_772_1206 144
100 3300005356 Ga0070674_100630138 Ga0070674_1006301382 145
101 3300005364 Ga0070673_100798388 Ga0070673_1007983882 145
102 3300005539 Ga0068853_100750762 Ga0068853_1007507622 145
103 3300005539 Ga0068853_101648862 Ga0068853_1016488621 145
104 3300005563 Ga0068855_100000240 Ga0068855_10000024056 145
105 3300005563 Ga0068855_100206161 Ga0068855_1002061613 145
106 3300009093 Ga0105240_10065929 Ga0105240_100659294 145
107 3300009093 Ga0105240_10156943 Ga0105240_101569434 145
108 3300009174 Ga0105241_10346592 Ga0105241_103465922 145
109 3300009174 Ga0105241_10723119 Ga0105241_107231192 145
110 3300009545 Ga0105237_10219224 Ga0105237_102192243 145
111 3300010375 Ga0105239_10000002 Ga0105239_10000002574 145
112 3300010375 Ga0105239_10007919 Ga0105239_1000791911 145
113 3300010375 Ga0105239_10665858 Ga0105239_106658582 145
114 3300013297 Ga0157378_10007182 Ga0157378_100071828 145
115 3300013297 Ga0157378_10029482 Ga0157378_100294822 145
116 3300025298 Ga0209050_1001257 Ga0209050_100125718 145
117 3300025298 Ga0209050_1010723 Ga0209050_10107231 145
118 3300025913 Ga0207695_10048072 Ga0207695_100480724 145
119 3300025913 Ga0207695_10333650 Ga0207695_103336502 145
120 3300025914 Ga0207671_10006260 Ga0207671_1000626010 145
121 3300025914 Ga0207671_10739900 Ga0207671_107399002 145
122 3300025929 Ga0207664_11529947 Ga0207664_115299471 145
123 3300025937 Ga0207669_10075106 Ga0207669_100751062 145
124 3300025949 Ga0207667_10000037 Ga0207667_1000003778 145
125 3300026041 Ga0207639_10712050 Ga0207639_107120502 145
126 3300028786 Ga0307517_10179865 Ga0307517_101798652 145
127 3300028800 Ga0265338_10038899 Ga0265338_100388995 145
128 3300035115 Ga0373941_0130737 Ga0373941_0130737_242_712 145
129 3300041486 Ga0451807_2487364 Ga0451807_2487364_11_448 145
130 3300041512 Ga0451853_1399857 Ga0451853_1399857_34_471 145
131 3300046529 Ga0495652_0037951 Ga0495652_0037951_1560_2036 145
132 3300046648 Ga0495611_0000691 Ga0495611_0000691_455_892 145
133 3300053090 Ga0500646_0006638 Ga0500646_0006638_1923_2360 145
134 3300053090 Ga0500646_0218065 Ga0500646_0218065_169_612 145
135 3300053092 Ga0500583_0000097 Ga0500583_0000097_25673_26110 145
136 3300053092 Ga0500583_0001933 Ga0500583_0001933_1254_1691 145
137 3300053130 Ga0500642_0032899 Ga0500642_0032899_905_1378 145
138 3300053147 Ga0500589_066446 Ga0500589_066446_448_885 145
139 3300053153 Ga0500616_0000044 Ga0500616_0000044_138819_139256 145
140 3300053156 Ga0500622_0042208 Ga0500622_0042208_575_1012 145
141 3300053156 Ga0500622_0058057 Ga0500622_0058057_256_693 145
142 3300053727 Ga0500611_010634 Ga0500611_010634_21_458 145
143 3300053739 Ga0500587_004779 Ga0500587_004779_156_593 145
144 iso_pu_bacteria 2977232053 2977232644 145
145 3300005467 Ga0070706_100610523 Ga0070706_1006105232 146
146 3300005536 Ga0070697_100089400 Ga0070697_1000894004 146
147 3300005545 Ga0070695_100270733 Ga0070695_1002707332 146
148 3300005546 Ga0070696_100304813 Ga0070696_1003048133 146
149 3300006173 Ga0070716_100375775 Ga0070716_1003757752 146
150 3300006844 Ga0075428_101950398 Ga0075428_1019503981 146
151 3300006852 Ga0075433_11143569 Ga0075433_111435692 146
152 3300009147 Ga0114129_10019491 Ga0114129_1001949111 146
153 3300025910 Ga0207684_10332607 Ga0207684_103326072 146
154 3300050507 nmdc:mga05p37_312176_c1 nmdc:mga05p37_312176_c1_1099_1563 146
155 3300053092 Ga0500583_0029920 Ga0500583_0029920_679_1119 146
156 3300053092 Ga0500583_0150335 Ga0500583_0150335_289_729 146
157 3300053178 Ga0500637_0010271 Ga0500637_0010271_1770_2240 146
158 2162886007 SwRhRL2b_contig_3895340 SwRhRL2b_0721.00004660 147
159 3300003316 rootH1_10052378 rootH1_100523782 147
160 3300003322 rootL2_10074056 rootL2_100740567 147
161 3300003322 rootL2_10101155 rootL2_101011555 147
162 3300003322 rootL2_10166127 rootL2_101661274 147
163 3300003323 rootH1_10012545 rootH1_100125458 147
164 3300005288 Ga0065714_10002550 Ga0065714_1000255027 147
165 3300005289 Ga0065704_10000227 Ga0065704_1000022760 147
166 3300005365 Ga0070688_100109300 Ga0070688_1001093003 147
167 3300005367 Ga0070667_100002807 Ga0070667_10000280711 147
168 3300005367 Ga0070667_100047532 Ga0070667_1000475322 147
169 3300005466 Ga0070685_10440665 Ga0070685_104406652 147
170 3300005577 Ga0068857_100457939 Ga0068857_1004579392 147
171 3300005617 Ga0068859_100000026 Ga0068859_10000002675 147
172 3300005617 Ga0068859_100023433 Ga0068859_1000234339 147
173 3300005841 Ga0068863_101352169 Ga0068863_1013521691 147
174 3300005842 Ga0068858_100017911 Ga0068858_1000179112 147
175 3300005843 Ga0068860_100004577 Ga0068860_10000457715 147
176 3300006195 Ga0075366_10367613 Ga0075366_103676132 147
177 3300006931 Ga0097620_100000026 Ga0097620_10000002675 147
178 3300006931 Ga0097620_100023433 Ga0097620_1000234339 147
179 3300009093 Ga0105240_10350964 Ga0105240_103509643 147
180 3300009101 Ga0105247_10007025 Ga0105247_100070255 147
181 3300009147 Ga0114129_10005023 Ga0114129_100050232 147
182 3300009147 Ga0114129_11353431 Ga0114129_113534312 147
183 3300009174 Ga0105241_10015460 Ga0105241_100154604 147
184 3300009553 Ga0105249_10061848 Ga0105249_100618484 147
185 3300009553 Ga0105249_10947371 Ga0105249_109473711 147
186 3300013100 Ga0157373_10000105 Ga0157373_1000010518 147
187 3300013102 Ga0157371_10015384 Ga0157371_100153846 147
188 3300013104 Ga0157370_10022918 Ga0157370_100229189 147
189 3300013297 Ga0157378_10007416 Ga0157378_100074165 147
190 3300014968 Ga0157379_10106309 Ga0157379_101063092 147
191 3300014968 Ga0157379_10234934 Ga0157379_102349342 147
192 3300015261 Ga0182006_1020077 Ga0182006_10200772 147
193 3300017792 Ga0163161_10577565 Ga0163161_105775651 147
194 3300025900 Ga0207710_10220877 Ga0207710_102208771 147
195 3300025911 Ga0207654_10001488 Ga0207654_1000148812 147
196 3300025961 Ga0207712_10878059 Ga0207712_108780591 147
197 3300025986 Ga0207658_10004562 Ga0207658_100045622 147
198 3300026035 Ga0207703_10022525 Ga0207703_100225253 147
199 3300026088 Ga0207641_11459331 Ga0207641_114593311 147
200 3300028381 Ga0268264_10039736 Ga0268264_100397362 147
201 3300031911 Ga0307412_10000181 Ga0307412_1000018112 147
202 3300032004 Ga0307414_10003855 Ga0307414_1000385511 147
203 3300036401 Ga0373937_1102105 Ga0373937_1102105_55_516 147
204 3300046473 Ga0495582_0217158 Ga0495582_0217158_36_497 147
205 3300046512 Ga0495610_0099817 Ga0495610_0099817_566_1015 147
206 3300046533 Ga0495640_0690649 Ga0495640_0690649_128_574 147
207 3300047444 Ga0495675_0555643 Ga0495675_0555643_84_530 147
208 3300050493 nmdc:mga0k408_77748_c1 nmdc:mga0k408_77748_c1_259_726 147
209 3300050507 nmdc:mga05p37_3380_c1 nmdc:mga05p37_3380_c1_17533_17985 147
210 3300053094 Ga0500566_0248720 Ga0500566_0248720_80_523 147
211 3300053730 Ga0500645_047035 Ga0500645_047035_267_713 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

146

0.91

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

44

158

0.86

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

67

148

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.956 1 139
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.9301 1 139
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8624 44 92
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8457 43 92
7ypv-assembly1.cif.gz_B crystal structure of ore-st-f 0.8404 43 92
ID Description Score Start End Superfamily
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9582 3 131 3.40.630.30
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9368 3 131 3.40.630.30
af_Q2FVP9_1_111_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8358 33 135 3.40.630.30
af_Q8IP78_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8351 46 92 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8322 43 118 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0F9Q6R2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9782 39 131 GO:0016747
AF-L0G0P7-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9778 3 134 GO:0016747
AF-A0A7V3CT59-F1-model_v4 N-acetyltransferase 0.9768 4 134 GO:0016747
AF-A0A3D3P9Y4-F1-model_v4 GNAT family N-acetyltransferase 0.9758 46 135 GO:0016747
AF-A0A8A6BIZ0-F1-model_v4 deleted 0.9749 39 135

Feature Viewer

pLDDT pTM Quality
94.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map