F321899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 132 | 209 | 763 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0005894|Ga0466969_0005894_3960_6383 |
| Length | 807 |
| Sequence | MVPLTKNQKVKNFTIKFKTLIRRATALSRDTLVGKWLRRLGISVAVIIILFFTLNRVFPLPDKIEYSTIITDSKGEVIHAFLTKDQKWRMKTELDEISPLLRKTIIEKEDKYFYSHPGINALAIGRAFAKNIFRWKRTSGASTITMQVARALEPKKRTYFNKVVEMFRALQLEFKYSKNEILQLYLNLVPYGGNIEGVKSASILYFKKNPDHLSLAEITALSIIPNRPSTLVMGKHNDRIILERNRWLQQFAKDKVFTQKEIQDAISEPLTATRGTVPQLIPHLAWKLKQEGGGDIIKTNIELNTQMKTEKLVADYSRILTLKNIRNAAVIIINNQTHNVITYVGSANFTDTIDAGQVNGAKAIRQPGSTLKPLLYGLCIDDGLMTPKTVITDVPVNYSGYAPENYDKQFNGYVTIEYALAHSLNIPAVKSLQMLGKDQFTQKLIDCHFQQIKKDQRKLGLSMILGGCGASLEELTGLYTIFANNGKFIPPNYTQTNQSVPHLEGVAHLKSEVTIISPAATFMINEILSQVNRPDFPLNWQSTEHMPKIAWKTGTSYGRRDAWSIGYNKKYTVGIWTGNFSALGIPELSGANIATPLLFKIFNTIDYDSDEEWFTQPKDCDIRMVCSETGLPPGEHCTSTVTDYFIPLISSTQLCNNMQEVALSADEKISYCKSCMPASGYKKKWYKVVPPEMQRYYDERHIVYEHIPPHNPDCERVFKEGGPSVLSPRNGSEYFISKKHPEPLELSCNVGNDVHKVYWYVNDQFYKAGEAHNHQFFVPEEGPVKISCTDDKGRNKDVWIRVKYVDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 93 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 98 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 99 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 100 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 101 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 102 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 103 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 104 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 107 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 121 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 125 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 129 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 130 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 131 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 132 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0 |
| Isolates | 0.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.84 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 91.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10030594 | 3300003320 | Bacteria | 15723 |
| 2 | rootL2_10040885 | 3300003322 | Bacteria | 2891 |
| 3 | rootH1_10005022 | 3300003323 | Bacteria | 14875 |
| 4 | rootH1_10114063 | 3300003323 | Bacteria | 5169 |
| 5 | Ga0065712_10007023 | 3300005290 | Bacteria | 3356 |
| 6 | Ga0070676_10000330 | 3300005328 | Bacteria | 21473 |
| 7 | Ga0070683_100014287 | 3300005329 | Bacteria | 6941 |
| 8 | Ga0070666_10006471 | 3300005335 | Bacteria | 7202 |
| 9 | Ga0070666_10012735 | 3300005335 | Bacteria | 5316 |
| 10 | Ga0068868_100000064 | 3300005338 | Bacteria | 61762 |
| 11 | Ga0068868_100048060 | 3300005338 | Bacteria | 3346 |
| 12 | Ga0068868_100056370 | 3300005338 | Bacteria | 3103 |
| 13 | Ga0070689_100003109 | 3300005340 | Bacteria | 10958 |
| 14 | Ga0070689_100066912 | 3300005340 | Bacteria | 2799 |
| 15 | Ga0070661_100006787 | 3300005344 | Bacteria | 7890 |
| 16 | Ga0070668_100003226 | 3300005347 | Bacteria | 12022 |
| 17 | Ga0070675_100017978 | 3300005354 | Bacteria | 5626 |
| 18 | Ga0070671_100034330 | 3300005355 | Bacteria | 4199 |
| 19 | Ga0070673_100000514 | 3300005364 | Bacteria | 20769 |
| 20 | Ga0070673_100020085 | 3300005364 | Bacteria | 4810 |
| 21 | Ga0070688_100008218 | 3300005365 | Bacteria | 5656 |
| 22 | Ga0070688_100009898 | 3300005365 | Bacteria | 5239 |
| 23 | Ga0070659_100033379 | 3300005366 | Bacteria | 3997 |
| 24 | Ga0070667_100060055 | 3300005367 | Bacteria | 3217 |
| 25 | Ga0070678_100020817 | 3300005456 | Bacteria | 4310 |
| 26 | Ga0070662_100046934 | 3300005457 | Unclassified | 3105 |
| 27 | Ga0068867_100004230 | 3300005459 | Bacteria | 10102 |
| 28 | Ga0070684_100017356 | 3300005535 | Bacteria | 5905 |
| 29 | Ga0070684_100043341 | 3300005535 | Bacteria | 3885 |
| 30 | Ga0068853_100000245 | 3300005539 | Bacteria | 38110 |
| 31 | Ga0068853_100034091 | 3300005539 | Bacteria | 4320 |
| 32 | Ga0070672_100001332 | 3300005543 | Bacteria | 15233 |
| 33 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 34 | Ga0070665_100001684 | 3300005548 | Bacteria | 25484 |
| 35 | Ga0068855_100005843 | 3300005563 | Bacteria | 15020 |
| 36 | Ga0068855_100037006 | 3300005563 | Bacteria | 5806 |
| 37 | Ga0070664_100020571 | 3300005564 | Bacteria | 5434 |
| 38 | Ga0068857_100003983 | 3300005577 | Bacteria | 12439 |
| 39 | Ga0068856_100013927 | 3300005614 | Bacteria | 7779 |
| 40 | Ga0068852_100002358 | 3300005616 | Bacteria | 13008 |
| 41 | Ga0068859_100002196 | 3300005617 | Bacteria | 19810 |
| 42 | Ga0068859_100020658 | 3300005617 | Bacteria | 6608 |
| 43 | Ga0068859_100135248 | 3300005617 | Bacteria | 2538 |
| 44 | Ga0068861_100035763 | 3300005719 | Bacteria | 3681 |
| 45 | Ga0068851_10003250 | 3300005834 | Bacteria | 7206 |
| 46 | Ga0068863_100014701 | 3300005841 | Bacteria | 7532 |
| 47 | Ga0068863_100017486 | 3300005841 | Bacteria | 6873 |
| 48 | Ga0068858_100025685 | 3300005842 | Bacteria | 5479 |
| 49 | Ga0068858_100054752 | 3300005842 | Bacteria | 3689 |
| 50 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 51 | Ga0068860_100001628 | 3300005843 | Bacteria | 24094 |
| 52 | Ga0068860_100010536 | 3300005843 | Bacteria | 9135 |
| 53 | Ga0068860_100016347 | 3300005843 | Bacteria | 7235 |
| 54 | Ga0068860_100018533 | 3300005843 | Bacteria | 6770 |
| 55 | Ga0097621_100010746 | 3300006237 | Bacteria | 6713 |
| 56 | Ga0068871_100009966 | 3300006358 | Bacteria | 6904 |
| 57 | Ga0068871_100021040 | 3300006358 | Bacteria | 5007 |
| 58 | Ga0075431_100002640 | 3300006847 | Bacteria | 17339 |
| 59 | Ga0075429_100018930 | 3300006880 | Bacteria | 5965 |
| 60 | Ga0097620_100002196 | 3300006931 | Bacteria | 19810 |
| 61 | Ga0097620_100020657 | 3300006931 | Bacteria | 6608 |
| 62 | Ga0097620_100135251 | 3300006931 | Bacteria | 2538 |
| 63 | Ga0105240_10000153 | 3300009093 | Bacteria | 140973 |
| 64 | Ga0105240_10001276 | 3300009093 | Bacteria | 43565 |
| 65 | Ga0105240_10014845 | 3300009093 | Bacteria | 10617 |
| 66 | Ga0105240_10016491 | 3300009093 | Bacteria | 10000 |
| 67 | Ga0105240_10037919 | 3300009093 | Bacteria | 6188 |
| 68 | Ga0105240_10078719 | 3300009093 | Unclassified | 4058 |
| 69 | Ga0105240_10126926 | 3300009093 | Bacteria | 3064 |
| 70 | Ga0111539_10013767 | 3300009094 | Bacteria | 10104 |
| 71 | Ga0105245_10020329 | 3300009098 | Bacteria | 5822 |
| 72 | Ga0114129_10054684 | 3300009147 | Bacteria | 5596 |
| 73 | Ga0114129_10063105 | 3300009147 | Bacteria | 5175 |
| 74 | Ga0114129_10294425 | 3300009147 | Bacteria | 2165 |
| 75 | Ga0105243_10023920 | 3300009148 | Bacteria | 4655 |
| 76 | Ga0105241_10000176 | 3300009174 | Bacteria | 47237 |
| 77 | Ga0105237_10002276 | 3300009545 | Bacteria | 23891 |
| 78 | Ga0105237_10005809 | 3300009545 | Bacteria | 13841 |
| 79 | Ga0105237_10013349 | 3300009545 | Bacteria | 8617 |
| 80 | Ga0105238_10017371 | 3300009551 | Bacteria | 7308 |
| 81 | Ga0105238_10029848 | 3300009551 | Bacteria | 5552 |
| 82 | Ga0105249_10009368 | 3300009553 | Bacteria | 8567 |
| 83 | Ga0105249_10032842 | 3300009553 | Bacteria | 4697 |
| 84 | Ga0105239_10000368 | 3300010375 | Bacteria | 66186 |
| 85 | Ga0105239_10001098 | 3300010375 | Bacteria | 37369 |
| 86 | Ga0105239_10008194 | 3300010375 | Bacteria | 11922 |
| 87 | Ga0105239_10034820 | 3300010375 | Bacteria | 5531 |
| 88 | Ga0105239_10035849 | 3300010375 | Bacteria | 5447 |
| 89 | Ga0157370_10004148 | 3300013104 | Bacteria | 16774 |
| 90 | Ga0157370_10014602 | 3300013104 | Bacteria | 8025 |
| 91 | Ga0157369_10024682 | 3300013105 | Bacteria | 6682 |
| 92 | Ga0157374_10000009 | 3300013296 | Bacteria | 564330 |
| 93 | Ga0157374_10017560 | 3300013296 | Bacteria | 6302 |
| 94 | Ga0157374_10073957 | 3300013296 | Bacteria | 3217 |
| 95 | Ga0157374_10120469 | 3300013296 | Bacteria | 2532 |
| 96 | Ga0157378_10001865 | 3300013297 | Bacteria | 18928 |
| 97 | Ga0157378_10013554 | 3300013297 | Bacteria | 7132 |
| 98 | Ga0157378_10029875 | 3300013297 | Bacteria | 4813 |
| 99 | Ga0163162_10000337 | 3300013306 | Bacteria | 42559 |
| 100 | Ga0163162_10000548 | 3300013306 | Bacteria | 34707 |
| 101 | Ga0163162_10000921 | 3300013306 | Bacteria | 27280 |
| 102 | Ga0163162_10041443 | 3300013306 | Bacteria | 4607 |
| 103 | Ga0157372_10000983 | 3300013307 | Bacteria | 31129 |
| 104 | Ga0157375_10000970 | 3300013308 | Bacteria | 24793 |
| 105 | Ga0157375_10026972 | 3300013308 | Bacteria | 5363 |
| 106 | Ga0157375_10031459 | 3300013308 | Bacteria | 5017 |
| 107 | Ga0157375_10055221 | 3300013308 | Bacteria | 3915 |
| 108 | Ga0157380_10000194 | 3300014326 | Bacteria | 35515 |
| 109 | Ga0157377_10015744 | 3300014745 | Bacteria | 3876 |
| 110 | Ga0157376_10003840 | 3300014969 | Bacteria | 10387 |
| 111 | Ga0157376_10039672 | 3300014969 | Bacteria | 3842 |
| 112 | Ga0163161_10021897 | 3300017792 | Bacteria | 4495 |
| 113 | Ga0207680_10000684 | 3300025903 | Bacteria | 16006 |
| 114 | Ga0207647_10004951 | 3300025904 | Bacteria | 9820 |
| 115 | Ga0207647_10007634 | 3300025904 | Bacteria | 7796 |
| 116 | Ga0207645_10001250 | 3300025907 | Bacteria | 20921 |
| 117 | Ga0207654_10006464 | 3300025911 | Bacteria | 5898 |
| 118 | Ga0207707_10000186 | 3300025912 | Bacteria | 65484 |
| 119 | Ga0207695_10000446 | 3300025913 | Bacteria | 90493 |
| 120 | Ga0207695_10001024 | 3300025913 | Bacteria | 49211 |
| 121 | Ga0207695_10007279 | 3300025913 | Bacteria | 14135 |
| 122 | Ga0207695_10011961 | 3300025913 | Bacteria | 10447 |
| 123 | Ga0207671_10000036 | 3300025914 | Bacteria | 236133 |
| 124 | Ga0207671_10001679 | 3300025914 | Bacteria | 25113 |
| 125 | Ga0207671_10003954 | 3300025914 | Bacteria | 14423 |
| 126 | Ga0207649_10009264 | 3300025920 | Bacteria | 5386 |
| 127 | Ga0207694_10057137 | 3300025924 | Bacteria | 3033 |
| 128 | Ga0207644_10041321 | 3300025931 | Bacteria | 3262 |
| 129 | Ga0207706_10003952 | 3300025933 | Bacteria | 14046 |
| 130 | Ga0207706_10032586 | 3300025933 | Bacteria | 4640 |
| 131 | Ga0207670_10029340 | 3300025936 | Unclassified | 3504 |
| 132 | Ga0207670_10100926 | 3300025936 | Bacteria | 2061 |
| 133 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 134 | Ga0207691_10028592 | 3300025940 | Bacteria | 5219 |
| 135 | Ga0207689_10054567 | 3300025942 | Unclassified | 3291 |
| 136 | Ga0207679_10002905 | 3300025945 | Bacteria | 10626 |
| 137 | Ga0207667_10000254 | 3300025949 | Bacteria | 75138 |
| 138 | Ga0207667_10007369 | 3300025949 | Bacteria | 13237 |
| 139 | Ga0207667_10037112 | 3300025949 | Bacteria | 5212 |
| 140 | Ga0207651_10043749 | 3300025960 | Bacteria | 2991 |
| 141 | Ga0207651_10048395 | 3300025960 | Bacteria | 2874 |
| 142 | Ga0207658_10009567 | 3300025986 | Bacteria | 6579 |
| 143 | Ga0207677_10006600 | 3300026023 | Bacteria | 6367 |
| 144 | Ga0207677_10019835 | 3300026023 | Bacteria | 4069 |
| 145 | Ga0207703_10002494 | 3300026035 | Bacteria | 15954 |
| 146 | Ga0207678_10013234 | 3300026067 | Bacteria | 7239 |
| 147 | Ga0207641_10000967 | 3300026088 | Bacteria | 29446 |
| 148 | Ga0207641_10032900 | 3300026088 | Bacteria | 4307 |
| 149 | Ga0207676_10062163 | 3300026095 | Bacteria | 2961 |
| 150 | Ga0207674_10006446 | 3300026116 | Bacteria | 13797 |
| 151 | Ga0207674_10011936 | 3300026116 | Bacteria | 9739 |
| 152 | Ga0207674_10034121 | 3300026116 | Bacteria | 5322 |
| 153 | Ga0207675_100046954 | 3300026118 | Bacteria | 4033 |
| 154 | Ga0207683_10003288 | 3300026121 | Bacteria | 14091 |
| 155 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 156 | Ga0268266_10002439 | 3300028379 | Bacteria | 19963 |
| 157 | Ga0268264_10000621 | 3300028381 | Bacteria | 42149 |
| 158 | Ga0268264_10002341 | 3300028381 | Bacteria | 16753 |
| 159 | Ga0268264_10007744 | 3300028381 | Bacteria | 8942 |
| 160 | Ga0268264_10015658 | 3300028381 | Bacteria | 6210 |
| 161 | Ga0307517_10003238 | 3300028786 | Bacteria | 25505 |
| 162 | Ga0307511_10000688 | 3300030521 | Bacteria | 36145 |
| 163 | Ga0265327_10000010 | 3300031251 | Bacteria | 566817 |
| 164 | Ga0265327_10021684 | 3300031251 | Unclassified | 3868 |
| 165 | Ga0265313_10011513 | 3300031595 | Bacteria | 5491 |
| 166 | Ga0265314_10005763 | 3300031711 | Bacteria | 11115 |
| 167 | Ga0307516_10000966 | 3300031730 | Bacteria | 39704 |
| 168 | Ga0307510_10000042 | 3300033180 | Bacteria | 100951 |
| 169 | Ga0316584_0005496 | 3300036712 | Bacteria | 8512 |
| 170 | Ga0439436_0008899 | 3300041404 | Bacteria | 3082 |
| 171 | Ga0466969_0005894 | 3300044656 | Bacteria | 6514 |
| 172 | Ga0466972_0006780 | 3300044658 | Bacteria | 5749 |
| 173 | Ga0466965_0023031 | 3300044683 | Unclassified | 3006 |
| 174 | Ga0453684_0005938 | 3300044712 | Bacteria | 23683 |
| 175 | Ga0466957_0009313 | 3300044842 | Bacteria | 5603 |
| 176 | Ga0466959_0000201 | 3300045049 | Bacteria | 39074 |
| 177 | Ga0466959_0034970 | 3300045049 | Bacteria | 3716 |
| 178 | Ga0495606_0007851 | 3300046507 | Bacteria | 9420 |
| 179 | Ga0495668_0002239 | 3300046616 | Bacteria | 16357 |
| 180 | Ga0495611_0000011 | 3300046648 | Bacteria | 146643 |
| 181 | Ga0495670_0029345 | 3300046691 | Bacteria | 2730 |
| 182 | Ga0495636_0000045 | 3300047318 | Bacteria | 53503 |
| 183 | Ga0495672_0011870 | 3300047320 | Bacteria | 6116 |
| 184 | Ga0495672_0021432 | 3300047320 | Bacteria | 4216 |
| 185 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 186 | Ga0495686_0000165 | 3300047472 | Bacteria | 125611 |
| 187 | Ga0496115_0056797 | 3300048918 | Bacteria | 3146 |
| 188 | Ga0501037_0005551 | 3300049573 | Bacteria | 9203 |
| 189 | Ga0501038_0055507 | 3300049574 | Bacteria | 3402 |
| 190 | Ga0501043_0005980 | 3300049579 | Bacteria | 9781 |
| 191 | Ga0501043_0014857 | 3300049579 | Bacteria | 6095 |
| 192 | Ga0501047_0004456 | 3300049581 | Bacteria | 13179 |
| 193 | Ga0501047_0009421 | 3300049581 | Bacteria | 9227 |
| 194 | Ga0501219_000155 | 3300049703 | Bacteria | 12418 |
| 195 | Ga0501225_0000833 | 3300049705 | Bacteria | 9603 |
| 196 | Ga0501035_0013001 | 3300049822 | Bacteria | 7681 |
| 197 | Ga0501035_0031616 | 3300049822 | Bacteria | 4821 |
| 198 | Ga0501044_0003571 | 3300049823 | Bacteria | 17502 |
| 199 | Ga0501044_0013033 | 3300049823 | Bacteria | 8998 |
| 200 | Ga0501284_00073 | 3300050005 | Bacteria | 28647 |
| 201 | nmdc:mga05p37_43381_c1 | 3300050507 | Bacteria | 5533 |
| 202 | nmdc:mga09592_34002_c1 | 3300050508 | Bacteria | 4260 |
| 203 | nmdc:mga08y16_36184_c1 | 3300050511 | Bacteria | 5184 |
| 204 | Ga0500578_0000120 | 3300053086 | Bacteria | 95463 |
| 205 | Ga0500583_0000106 | 3300053092 | Bacteria | 43356 |
| 206 | Ga0500583_0000369 | 3300053092 | Bacteria | 14767 |
| 207 | Ga0500568_0000876 | 3300053139 | Bacteria | 21116 |
| 208 | Ga0500622_0034758 | 3300053156 | Bacteria | 2640 |
| 209 | Ga0500637_0021214 | 3300053178 | Bacteria | 3527 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009553 | Ga0105249_10009368 | Ga0105249_100093681 | 648 |
| 2 | 3300025936 | Ga0207670_10100926 | Ga0207670_101009261 | 653 |
| 3 | 3300041404 | Ga0439436_0008899 | Ga0439436_0008899_1105_3066 | 653 |
| 4 | 3300053139 | Ga0500568_0000876 | Ga0500568_0000876_11100_13088 | 662 |
| 5 | 3300049703 | Ga0501219_000155 | Ga0501219_000155_9447_11534 | 666 |
| 6 | 3300009147 | Ga0114129_10294425 | Ga0114129_102944251 | 692 |
| 7 | 3300046691 | Ga0495670_0029345 | Ga0495670_0029345_122_2269 | 715 |
| 8 | 3300053178 | Ga0500637_0021214 | Ga0500637_0021214_1305_3452 | 715 |
| 9 | 3300044683 | Ga0466965_0023031 | Ga0466965_0023031_15_2219 | 733 |
| 10 | 3300005335 | Ga0070666_10006471 | Ga0070666_100064716 | 734 |
| 11 | 3300005456 | Ga0070678_100020817 | Ga0070678_1000208171 | 734 |
| 12 | 3300005535 | Ga0070684_100017356 | Ga0070684_1000173565 | 734 |
| 13 | 3300005842 | Ga0068858_100054752 | Ga0068858_1000547521 | 734 |
| 14 | 3300006358 | Ga0068871_100021040 | Ga0068871_1000210403 | 734 |
| 15 | 3300013296 | Ga0157374_10017560 | Ga0157374_100175603 | 734 |
| 16 | 3300013308 | Ga0157375_10026972 | Ga0157375_100269722 | 734 |
| 17 | 3300014969 | Ga0157376_10039672 | Ga0157376_100396722 | 734 |
| 18 | 3300025904 | Ga0207647_10007634 | Ga0207647_100076342 | 734 |
| 19 | 3300025933 | Ga0207706_10003952 | Ga0207706_100039521 | 734 |
| 20 | 3300025960 | Ga0207651_10048395 | Ga0207651_100483952 | 734 |
| 21 | 3300026067 | Ga0207678_10013234 | Ga0207678_100132343 | 734 |
| 22 | 3300026116 | Ga0207674_10011936 | Ga0207674_100119365 | 734 |
| 23 | 3300026121 | Ga0207683_10003288 | Ga0207683_100032884 | 734 |
| 24 | 3300031251 | Ga0265327_10000010 | Ga0265327_10000010481 | 736 |
| 25 | 3300005367 | Ga0070667_100060055 | Ga0070667_1000600551 | 738 |
| 26 | 3300005617 | Ga0068859_100002196 | Ga0068859_1000021961 | 738 |
| 27 | 3300005843 | Ga0068860_100001628 | Ga0068860_10000162816 | 738 |
| 28 | 3300006931 | Ga0097620_100002196 | Ga0097620_10000219613 | 738 |
| 29 | 3300013297 | Ga0157378_10013554 | Ga0157378_100135542 | 738 |
| 30 | 3300025986 | Ga0207658_10009567 | Ga0207658_100095672 | 738 |
| 31 | 3300028381 | Ga0268264_10007744 | Ga0268264_100077442 | 738 |
| 32 | 3300026095 | Ga0207676_10062163 | Ga0207676_100621632 | 739 |
| 33 | 3300053156 | Ga0500622_0034758 | Ga0500622_0034758_388_2607 | 739 |
| 34 | 3300005365 | Ga0070688_100008218 | Ga0070688_1000082182 | 740 |
| 35 | 3300005340 | Ga0070689_100003109 | Ga0070689_1000031093 | 741 |
| 36 | 3300009094 | Ga0111539_10013767 | Ga0111539_100137672 | 743 |
| 37 | 3300009551 | Ga0105238_10017371 | Ga0105238_100173712 | 743 |
| 38 | 3300010375 | Ga0105239_10035849 | Ga0105239_100358494 | 743 |
| 39 | 3300050511 | nmdc:mga08y16_36184_c1 | nmdc:mga08y16_36184_c1_2296_4590 | 743 |
| 40 | 3300006358 | Ga0068871_100009966 | Ga0068871_1000099665 | 744 |
| 41 | 3300013306 | Ga0163162_10000337 | Ga0163162_100003376 | 744 |
| 42 | 3300031251 | Ga0265327_10021684 | Ga0265327_100216842 | 745 |
| 43 | 3300005841 | Ga0068863_100017486 | Ga0068863_1000174862 | 746 |
| 44 | 3300013296 | Ga0157374_10120469 | Ga0157374_101204691 | 746 |
| 45 | 3300013297 | Ga0157378_10001865 | Ga0157378_100018658 | 746 |
| 46 | 3300025931 | Ga0207644_10041321 | Ga0207644_100413213 | 746 |
| 47 | 3300026023 | Ga0207677_10019835 | Ga0207677_100198352 | 746 |
| 48 | 3300026088 | Ga0207641_10032900 | Ga0207641_100329002 | 746 |
| 49 | 3300005290 | Ga0065712_10007023 | Ga0065712_100070232 | 748 |
| 50 | 3300005340 | Ga0070689_100066912 | Ga0070689_1000669121 | 748 |
| 51 | 3300005354 | Ga0070675_100017978 | Ga0070675_1000179782 | 748 |
| 52 | 3300005364 | Ga0070673_100020085 | Ga0070673_1000200852 | 748 |
| 53 | 3300005365 | Ga0070688_100009898 | Ga0070688_1000098982 | 748 |
| 54 | 3300014745 | Ga0157377_10015744 | Ga0157377_100157442 | 748 |
| 55 | 3300025940 | Ga0207691_10028592 | Ga0207691_100285924 | 748 |
| 56 | 3300046507 | Ga0495606_0007851 | Ga0495606_0007851_303_2672 | 748 |
| 57 | 3300005328 | Ga0070676_10000330 | Ga0070676_100003302 | 749 |
| 58 | 3300005329 | Ga0070683_100014287 | Ga0070683_1000142877 | 749 |
| 59 | 3300005338 | Ga0068868_100000064 | Ga0068868_10000006443 | 749 |
| 60 | 3300005344 | Ga0070661_100006787 | Ga0070661_1000067875 | 749 |
| 61 | 3300005347 | Ga0070668_100003226 | Ga0070668_1000032268 | 749 |
| 62 | 3300005364 | Ga0070673_100000514 | Ga0070673_1000005142 | 749 |
| 63 | 3300005459 | Ga0068867_100004230 | Ga0068867_1000042305 | 749 |
| 64 | 3300005535 | Ga0070684_100043341 | Ga0070684_1000433412 | 749 |
| 65 | 3300005543 | Ga0070672_100001332 | Ga0070672_10000133210 | 749 |
| 66 | 3300005548 | Ga0070665_100001684 | Ga0070665_10000168415 | 749 |
| 67 | 3300005564 | Ga0070664_100020571 | Ga0070664_1000205712 | 749 |
| 68 | 3300005617 | Ga0068859_100135248 | Ga0068859_1001352481 | 749 |
| 69 | 3300005719 | Ga0068861_100035763 | Ga0068861_1000357632 | 749 |
| 70 | 3300005834 | Ga0068851_10003250 | Ga0068851_100032502 | 749 |
| 71 | 3300005843 | Ga0068860_100018533 | Ga0068860_1000185335 | 749 |
| 72 | 3300006237 | Ga0097621_100010746 | Ga0097621_1000107465 | 749 |
| 73 | 3300006931 | Ga0097620_100135251 | Ga0097620_1001352511 | 749 |
| 74 | 3300009093 | Ga0105240_10126926 | Ga0105240_101269262 | 749 |
| 75 | 3300009148 | Ga0105243_10023920 | Ga0105243_100239202 | 749 |
| 76 | 3300009553 | Ga0105249_10032842 | Ga0105249_100328423 | 749 |
| 77 | 3300013306 | Ga0163162_10000548 | Ga0163162_100005489 | 749 |
| 78 | 3300013308 | Ga0157375_10000970 | Ga0157375_1000097014 | 749 |
| 79 | 3300017792 | Ga0163161_10021897 | Ga0163161_100218973 | 749 |
| 80 | 3300025903 | Ga0207680_10000684 | Ga0207680_100006848 | 749 |
| 81 | 3300025907 | Ga0207645_10001250 | Ga0207645_1000125010 | 749 |
| 82 | 3300025920 | Ga0207649_10009264 | Ga0207649_100092642 | 749 |
| 83 | 3300025940 | Ga0207691_10000001 | Ga0207691_10000001142 | 749 |
| 84 | 3300025945 | Ga0207679_10002905 | Ga0207679_100029051 | 749 |
| 85 | 3300025960 | Ga0207651_10043749 | Ga0207651_100437492 | 749 |
| 86 | 3300026023 | Ga0207677_10006600 | Ga0207677_100066005 | 749 |
| 87 | 3300026035 | Ga0207703_10002494 | Ga0207703_1000249410 | 749 |
| 88 | 3300026116 | Ga0207674_10034121 | Ga0207674_100341212 | 749 |
| 89 | 3300026118 | Ga0207675_100046954 | Ga0207675_1000469543 | 749 |
| 90 | 3300028379 | Ga0268266_10002439 | Ga0268266_100024398 | 749 |
| 91 | 3300025936 | Ga0207670_10029340 | Ga0207670_100293401 | 750 |
| 92 | 3300005841 | Ga0068863_100014701 | Ga0068863_1000147013 | 752 |
| 93 | 3300005843 | Ga0068860_100010536 | Ga0068860_1000105363 | 752 |
| 94 | 3300026088 | Ga0207641_10000967 | Ga0207641_1000096711 | 752 |
| 95 | 3300028381 | Ga0268264_10002341 | Ga0268264_1000234112 | 752 |
| 96 | 3300005457 | Ga0070662_100046934 | Ga0070662_1000469342 | 754 |
| 97 | 3300005617 | Ga0068859_100020658 | Ga0068859_1000206582 | 754 |
| 98 | 3300005842 | Ga0068858_100025685 | Ga0068858_1000256853 | 754 |
| 99 | 3300006931 | Ga0097620_100020657 | Ga0097620_1000206572 | 754 |
| 100 | 3300013306 | Ga0163162_10041443 | Ga0163162_100414432 | 754 |
| 101 | 3300013308 | Ga0157375_10055221 | Ga0157375_100552212 | 754 |
| 102 | 3300047320 | Ga0495672_0011870 | Ga0495672_0011870_2350_4644 | 754 |
| 103 | 3300003323 | rootH1_10114063 | rootH1_101140632 | 755 |
| 104 | 3300005539 | Ga0068853_100034091 | Ga0068853_1000340912 | 756 |
| 105 | 3300005563 | Ga0068855_100037006 | Ga0068855_1000370061 | 756 |
| 106 | 3300005577 | Ga0068857_100003983 | Ga0068857_1000039832 | 756 |
| 107 | 3300005616 | Ga0068852_100002358 | Ga0068852_1000023589 | 756 |
| 108 | 3300009147 | Ga0114129_10054684 | Ga0114129_100546843 | 756 |
| 109 | 3300013104 | Ga0157370_10004148 | Ga0157370_100041483 | 756 |
| 110 | 3300013105 | Ga0157369_10024682 | Ga0157369_100246822 | 756 |
| 111 | 3300013307 | Ga0157372_10000983 | Ga0157372_1000098318 | 756 |
| 112 | 3300025904 | Ga0207647_10004951 | Ga0207647_100049512 | 756 |
| 113 | 3300025949 | Ga0207667_10000254 | Ga0207667_1000025444 | 756 |
| 114 | 3300026116 | Ga0207674_10006446 | Ga0207674_100064462 | 756 |
| 115 | 3300048918 | Ga0496115_0056797 | Ga0496115_0056797_289_2565 | 756 |
| 116 | 3300050507 | nmdc:mga05p37_43381_c1 | nmdc:mga05p37_43381_c1_1795_4176 | 756 |
| 117 | iso_pu_bacteria | 2739367866 | 2740034365 | 756 |
| 118 | 3300028786 | Ga0307517_10003238 | Ga0307517_1000323813 | 760 |
| 119 | 3300033180 | Ga0307510_10000042 | Ga0307510_1000004217 | 760 |
| 120 | 3300044712 | Ga0453684_0005938 | Ga0453684_0005938_18720_21056 | 760 |
| 121 | 3300047320 | Ga0495672_0021432 | Ga0495672_0021432_91_2415 | 760 |
| 122 | 3300006847 | Ga0075431_100002640 | Ga0075431_1000026402 | 761 |
| 123 | 3300006880 | Ga0075429_100018930 | Ga0075429_1000189304 | 761 |
| 124 | 3300009098 | Ga0105245_10020329 | Ga0105245_100203292 | 761 |
| 125 | 3300009147 | Ga0114129_10063105 | Ga0114129_100631053 | 761 |
| 126 | 3300014326 | Ga0157380_10000194 | Ga0157380_100001944 | 761 |
| 127 | 3300049573 | Ga0501037_0005551 | Ga0501037_0005551_4024_6309 | 761 |
| 128 | 3300049574 | Ga0501038_0055507 | Ga0501038_0055507_221_2506 | 761 |
| 129 | 3300049579 | Ga0501043_0005980 | Ga0501043_0005980_5380_7665 | 761 |
| 130 | 3300049579 | Ga0501043_0014857 | Ga0501043_0014857_2384_4669 | 761 |
| 131 | 3300049581 | Ga0501047_0009421 | Ga0501047_0009421_4797_7082 | 761 |
| 132 | 3300049822 | Ga0501035_0013001 | Ga0501035_0013001_775_3060 | 761 |
| 133 | 3300049823 | Ga0501044_0003571 | Ga0501044_0003571_8922_11207 | 761 |
| 134 | 3300050508 | nmdc:mga09592_34002_c1 | nmdc:mga09592_34002_c1_1929_4223 | 761 |
| 135 | 3300005338 | Ga0068868_100048060 | Ga0068868_1000480602 | 762 |
| 136 | 3300005355 | Ga0070671_100034330 | Ga0070671_1000343302 | 762 |
| 137 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008403 | 762 |
| 138 | 3300013296 | Ga0157374_10073957 | Ga0157374_100739572 | 762 |
| 139 | 3300013297 | Ga0157378_10029875 | Ga0157378_100298753 | 762 |
| 140 | 3300013308 | Ga0157375_10031459 | Ga0157375_100314593 | 762 |
| 141 | 3300025933 | Ga0207706_10032586 | Ga0207706_100325862 | 762 |
| 142 | 3300025942 | Ga0207689_10054567 | Ga0207689_100545673 | 762 |
| 143 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016401 | 762 |
| 144 | 3300031711 | Ga0265314_10005763 | Ga0265314_100057632 | 762 |
| 145 | 3300036712 | Ga0316584_0005496 | Ga0316584_0005496_1608_3929 | 762 |
| 146 | 3300046616 | Ga0495668_0002239 | Ga0495668_0002239_5879_8272 | 762 |
| 147 | 3300005366 | Ga0070659_100033379 | Ga0070659_1000333792 | 763 |
| 148 | 3300005539 | Ga0068853_100000245 | Ga0068853_10000024521 | 763 |
| 149 | 3300009093 | Ga0105240_10001276 | Ga0105240_1000127628 | 763 |
| 150 | 3300009093 | Ga0105240_10014845 | Ga0105240_100148454 | 763 |
| 151 | 3300009093 | Ga0105240_10016491 | Ga0105240_100164913 | 763 |
| 152 | 3300009093 | Ga0105240_10037919 | Ga0105240_100379192 | 763 |
| 153 | 3300009174 | Ga0105241_10000176 | Ga0105241_1000017630 | 763 |
| 154 | 3300009551 | Ga0105238_10029848 | Ga0105238_100298484 | 763 |
| 155 | 3300010375 | Ga0105239_10000368 | Ga0105239_100003684 | 763 |
| 156 | 3300013104 | Ga0157370_10014602 | Ga0157370_100146023 | 763 |
| 157 | 3300013296 | Ga0157374_10000009 | Ga0157374_10000009349 | 763 |
| 158 | 3300014969 | Ga0157376_10003840 | Ga0157376_100038402 | 763 |
| 159 | 3300025912 | Ga0207707_10000186 | Ga0207707_100001867 | 763 |
| 160 | 3300025913 | Ga0207695_10000446 | Ga0207695_100004464 | 763 |
| 161 | 3300025913 | Ga0207695_10001024 | Ga0207695_100010243 | 763 |
| 162 | 3300025913 | Ga0207695_10007279 | Ga0207695_100072792 | 763 |
| 163 | 3300031595 | Ga0265313_10011513 | Ga0265313_100115133 | 763 |
| 164 | 3300045049 | Ga0466959_0034970 | Ga0466959_0034970_493_2808 | 763 |
| 165 | 3300046648 | Ga0495611_0000011 | Ga0495611_0000011_96186_98495 | 763 |
| 166 | 3300005563 | Ga0068855_100005843 | Ga0068855_1000058432 | 764 |
| 167 | 3300009545 | Ga0105237_10005809 | Ga0105237_1000580911 | 764 |
| 168 | 3300010375 | Ga0105239_10008194 | Ga0105239_100081942 | 764 |
| 169 | 3300025924 | Ga0207694_10057137 | Ga0207694_100571371 | 764 |
| 170 | 3300025949 | Ga0207667_10007369 | Ga0207667_100073696 | 764 |
| 171 | 3300049705 | Ga0501225_0000833 | Ga0501225_0000833_955_3291 | 764 |
| 172 | 3300003322 | rootL2_10040885 | rootL2_100408852 | 765 |
| 173 | 3300003323 | rootH1_10005022 | rootH1_100050221 | 765 |
| 174 | 3300005335 | Ga0070666_10012735 | Ga0070666_100127352 | 765 |
| 175 | 3300005843 | Ga0068860_100000059 | Ga0068860_1000000592 | 765 |
| 176 | 3300009093 | Ga0105240_10000153 | Ga0105240_1000015312 | 765 |
| 177 | 3300013306 | Ga0163162_10000921 | Ga0163162_1000092112 | 765 |
| 178 | 3300025911 | Ga0207654_10006464 | Ga0207654_100064644 | 765 |
| 179 | 3300025913 | Ga0207695_10011961 | Ga0207695_100119613 | 765 |
| 180 | 3300025914 | Ga0207671_10003954 | Ga0207671_100039547 | 765 |
| 181 | 3300028381 | Ga0268264_10000621 | Ga0268264_100006212 | 765 |
| 182 | 3300044658 | Ga0466972_0006780 | Ga0466972_0006780_1936_4320 | 765 |
| 183 | 3300044842 | Ga0466957_0009313 | Ga0466957_0009313_649_3033 | 765 |
| 184 | 3300049581 | Ga0501047_0004456 | Ga0501047_0004456_3479_5863 | 765 |
| 185 | 3300049822 | Ga0501035_0031616 | Ga0501035_0031616_2046_4430 | 765 |
| 186 | 3300049823 | Ga0501044_0013033 | Ga0501044_0013033_636_3020 | 765 |
| 187 | 3300050005 | Ga0501284_00073 | Ga0501284_00073_5447_7831 | 765 |
| 188 | 3300053086 | Ga0500578_0000120 | Ga0500578_0000120_67252_69636 | 765 |
| 189 | 3300053092 | Ga0500583_0000106 | Ga0500583_0000106_23283_25667 | 765 |
| 190 | 3300053092 | Ga0500583_0000369 | Ga0500583_0000369_5892_8276 | 765 |
| 191 | iso_pu_bacteria | 2738541278 | 2738731454 | 765 |
| 192 | 3300009093 | Ga0105240_10078719 | Ga0105240_100787192 | 767 |
| 193 | 3300010375 | Ga0105239_10034820 | Ga0105239_100348201 | 767 |
| 194 | 3300025949 | Ga0207667_10037112 | Ga0207667_100371122 | 767 |
| 195 | 3300009545 | Ga0105237_10002276 | Ga0105237_1000227613 | 771 |
| 196 | 3300025914 | Ga0207671_10000036 | Ga0207671_10000036109 | 771 |
| 197 | 3300047318 | Ga0495636_0000045 | Ga0495636_0000045_352_2712 | 771 |
| 198 | 3300044656 | Ga0466969_0005894 | Ga0466969_0005894_3960_6383 | 773 |
| 199 | 3300045049 | Ga0466959_0000201 | Ga0466959_0000201_35553_37976 | 773 |
| 200 | 3300047472 | Ga0495686_0000165 | Ga0495686_0000165_33078_35408 | 775 |
| 201 | 3300031730 | Ga0307516_10000966 | Ga0307516_100009662 | 776 |
| 202 | 3300005614 | Ga0068856_100013927 | Ga0068856_1000139274 | 778 |
| 203 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_543119_545458 | 778 |
| 204 | 3300005338 | Ga0068868_100056370 | Ga0068868_1000563702 | 784 |
| 205 | 3300005843 | Ga0068860_100016347 | Ga0068860_1000163474 | 784 |
| 206 | 3300009545 | Ga0105237_10013349 | Ga0105237_100133494 | 784 |
| 207 | 3300010375 | Ga0105239_10001098 | Ga0105239_1000109815 | 784 |
| 208 | 3300025914 | Ga0207671_10001679 | Ga0207671_1000167917 | 784 |
| 209 | 3300028381 | Ga0268264_10015658 | Ga0268264_100156584 | 784 |
| 210 | 3300030521 | Ga0307511_10000688 | Ga0307511_100006885 | 786 |
| 211 | 3300003320 | rootH2_10030594 | rootH2_100305942 | 789 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d3h-assembly1.cif.gz_A-2 | crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a | 0.9197 | 56 | 235 |
| 3nb7-assembly1.cif.gz_A-2 | crystal structure of aquifex aeolicus peptidoglycan glycosyltransferase in complex with decarboxylated neryl moenomycin | 0.9137 | 56 | 235 |
| 2oqo-assembly1.cif.gz_A-2 | crystal structure of a peptidoglycan glycosyltransferase from a class a pbp: insight into bacterial cell wall synthesis | 0.9063 | 56 | 235 |
| 3d3h-assembly1.cif.gz_A-2 | crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a | 0.9047 | 56 | 235 |
| 3nb6-assembly1.cif.gz_A-2 | crystal structure of aquifex aeolicus peptidoglycan glycosyltransferase in complex with methylphosphoryl neryl moenomycin | 0.8981 | 56 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76577_56_250_1.10.3810.10 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9608 | 48 | 240 | 1.10.3810.10 |
| af_P76577_56_250_1.10.3810.10 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9465 | 48 | 240 | 1.10.3810.10 |
| 3d3hA00 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9197 | 56 | 235 | 1.10.3810.10 |
| 3fwmA02 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9135 | 48 | 216 | 1.10.3810.10 |
| 3d3hA00 | Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like | 0.9047 | 56 | 235 | 1.10.3810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7YSE8-F1-model_v4 | Penicillin-binding protein 1A | 0.9602 | 323 | 446 |
GO:0008658
GO:0008955 GO:0009252 GO:0030288 |
| AF-A0A527CW11-F1-model_v4 | Penicillin-binding protein 1C | 0.9452 | 54 | 184 |
GO:0008955
GO:0009252 GO:0030288 |
| AF-A0A1W9STY0-F1-model_v4 | peptidoglycan glycosyltransferase (EC 2.4.99.28) | 0.9401 | 15 | 789 |
GO:0004180
GO:0006508 GO:0006793 GO:0008658 GO:0008955 GO:0009252 GO:0030288 |
| AF-A0A354YGE9-F1-model_v4 | Penicillin-binding protein 1C | 0.9397 | 81 | 243 |
GO:0008955
GO:0009252 GO:0030288 |
| AF-A0A162NWH2-F1-model_v4 | Penicillin-binding protein 1C | 0.938 | 202 | 789 |
GO:0008658
GO:0008955 GO:0009252 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar