F321899

General Info

Members Datasets Scaffolds Average Seq Length
211 132 209 763

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0005894|Ga0466969_0005894_3960_6383
Length 807
Sequence MVPLTKNQKVKNFTIKFKTLIRRATALSRDTLVGKWLRRLGISVAVIIILFFTLNRVFPLPDKIEYSTIITDSKGEVIHAFLTKDQKWRMKTELDEISPLLRKTIIEKEDKYFYSHPGINALAIGRAFAKNIFRWKRTSGASTITMQVARALEPKKRTYFNKVVEMFRALQLEFKYSKNEILQLYLNLVPYGGNIEGVKSASILYFKKNPDHLSLAEITALSIIPNRPSTLVMGKHNDRIILERNRWLQQFAKDKVFTQKEIQDAISEPLTATRGTVPQLIPHLAWKLKQEGGGDIIKTNIELNTQMKTEKLVADYSRILTLKNIRNAAVIIINNQTHNVITYVGSANFTDTIDAGQVNGAKAIRQPGSTLKPLLYGLCIDDGLMTPKTVITDVPVNYSGYAPENYDKQFNGYVTIEYALAHSLNIPAVKSLQMLGKDQFTQKLIDCHFQQIKKDQRKLGLSMILGGCGASLEELTGLYTIFANNGKFIPPNYTQTNQSVPHLEGVAHLKSEVTIISPAATFMINEILSQVNRPDFPLNWQSTEHMPKIAWKTGTSYGRRDAWSIGYNKKYTVGIWTGNFSALGIPELSGANIATPLLFKIFNTIDYDSDEEWFTQPKDCDIRMVCSETGLPPGEHCTSTVTDYFIPLISSTQLCNNMQEVALSADEKISYCKSCMPASGYKKKWYKVVPPEMQRYYDERHIVYEHIPPHNPDCERVFKEGGPSVLSPRNGSEYFISKKHPEPLELSCNVGNDVHKVYWYVNDQFYKAGEAHNHQFFVPEEGPVKISCTDDKGRNKDVWIRVKYVDL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
129 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10030594 3300003320 Bacteria 15723
2 rootL2_10040885 3300003322 Bacteria 2891
3 rootH1_10005022 3300003323 Bacteria 14875
4 rootH1_10114063 3300003323 Bacteria 5169
5 Ga0065712_10007023 3300005290 Bacteria 3356
6 Ga0070676_10000330 3300005328 Bacteria 21473
7 Ga0070683_100014287 3300005329 Bacteria 6941
8 Ga0070666_10006471 3300005335 Bacteria 7202
9 Ga0070666_10012735 3300005335 Bacteria 5316
10 Ga0068868_100000064 3300005338 Bacteria 61762
11 Ga0068868_100048060 3300005338 Bacteria 3346
12 Ga0068868_100056370 3300005338 Bacteria 3103
13 Ga0070689_100003109 3300005340 Bacteria 10958
14 Ga0070689_100066912 3300005340 Bacteria 2799
15 Ga0070661_100006787 3300005344 Bacteria 7890
16 Ga0070668_100003226 3300005347 Bacteria 12022
17 Ga0070675_100017978 3300005354 Bacteria 5626
18 Ga0070671_100034330 3300005355 Bacteria 4199
19 Ga0070673_100000514 3300005364 Bacteria 20769
20 Ga0070673_100020085 3300005364 Bacteria 4810
21 Ga0070688_100008218 3300005365 Bacteria 5656
22 Ga0070688_100009898 3300005365 Bacteria 5239
23 Ga0070659_100033379 3300005366 Bacteria 3997
24 Ga0070667_100060055 3300005367 Bacteria 3217
25 Ga0070678_100020817 3300005456 Bacteria 4310
26 Ga0070662_100046934 3300005457 Unclassified 3105
27 Ga0068867_100004230 3300005459 Bacteria 10102
28 Ga0070684_100017356 3300005535 Bacteria 5905
29 Ga0070684_100043341 3300005535 Bacteria 3885
30 Ga0068853_100000245 3300005539 Bacteria 38110
31 Ga0068853_100034091 3300005539 Bacteria 4320
32 Ga0070672_100001332 3300005543 Bacteria 15233
33 Ga0070665_100000008 3300005548 Bacteria 606341
34 Ga0070665_100001684 3300005548 Bacteria 25484
35 Ga0068855_100005843 3300005563 Bacteria 15020
36 Ga0068855_100037006 3300005563 Bacteria 5806
37 Ga0070664_100020571 3300005564 Bacteria 5434
38 Ga0068857_100003983 3300005577 Bacteria 12439
39 Ga0068856_100013927 3300005614 Bacteria 7779
40 Ga0068852_100002358 3300005616 Bacteria 13008
41 Ga0068859_100002196 3300005617 Bacteria 19810
42 Ga0068859_100020658 3300005617 Bacteria 6608
43 Ga0068859_100135248 3300005617 Bacteria 2538
44 Ga0068861_100035763 3300005719 Bacteria 3681
45 Ga0068851_10003250 3300005834 Bacteria 7206
46 Ga0068863_100014701 3300005841 Bacteria 7532
47 Ga0068863_100017486 3300005841 Bacteria 6873
48 Ga0068858_100025685 3300005842 Bacteria 5479
49 Ga0068858_100054752 3300005842 Bacteria 3689
50 Ga0068860_100000059 3300005843 Bacteria 196400
51 Ga0068860_100001628 3300005843 Bacteria 24094
52 Ga0068860_100010536 3300005843 Bacteria 9135
53 Ga0068860_100016347 3300005843 Bacteria 7235
54 Ga0068860_100018533 3300005843 Bacteria 6770
55 Ga0097621_100010746 3300006237 Bacteria 6713
56 Ga0068871_100009966 3300006358 Bacteria 6904
57 Ga0068871_100021040 3300006358 Bacteria 5007
58 Ga0075431_100002640 3300006847 Bacteria 17339
59 Ga0075429_100018930 3300006880 Bacteria 5965
60 Ga0097620_100002196 3300006931 Bacteria 19810
61 Ga0097620_100020657 3300006931 Bacteria 6608
62 Ga0097620_100135251 3300006931 Bacteria 2538
63 Ga0105240_10000153 3300009093 Bacteria 140973
64 Ga0105240_10001276 3300009093 Bacteria 43565
65 Ga0105240_10014845 3300009093 Bacteria 10617
66 Ga0105240_10016491 3300009093 Bacteria 10000
67 Ga0105240_10037919 3300009093 Bacteria 6188
68 Ga0105240_10078719 3300009093 Unclassified 4058
69 Ga0105240_10126926 3300009093 Bacteria 3064
70 Ga0111539_10013767 3300009094 Bacteria 10104
71 Ga0105245_10020329 3300009098 Bacteria 5822
72 Ga0114129_10054684 3300009147 Bacteria 5596
73 Ga0114129_10063105 3300009147 Bacteria 5175
74 Ga0114129_10294425 3300009147 Bacteria 2165
75 Ga0105243_10023920 3300009148 Bacteria 4655
76 Ga0105241_10000176 3300009174 Bacteria 47237
77 Ga0105237_10002276 3300009545 Bacteria 23891
78 Ga0105237_10005809 3300009545 Bacteria 13841
79 Ga0105237_10013349 3300009545 Bacteria 8617
80 Ga0105238_10017371 3300009551 Bacteria 7308
81 Ga0105238_10029848 3300009551 Bacteria 5552
82 Ga0105249_10009368 3300009553 Bacteria 8567
83 Ga0105249_10032842 3300009553 Bacteria 4697
84 Ga0105239_10000368 3300010375 Bacteria 66186
85 Ga0105239_10001098 3300010375 Bacteria 37369
86 Ga0105239_10008194 3300010375 Bacteria 11922
87 Ga0105239_10034820 3300010375 Bacteria 5531
88 Ga0105239_10035849 3300010375 Bacteria 5447
89 Ga0157370_10004148 3300013104 Bacteria 16774
90 Ga0157370_10014602 3300013104 Bacteria 8025
91 Ga0157369_10024682 3300013105 Bacteria 6682
92 Ga0157374_10000009 3300013296 Bacteria 564330
93 Ga0157374_10017560 3300013296 Bacteria 6302
94 Ga0157374_10073957 3300013296 Bacteria 3217
95 Ga0157374_10120469 3300013296 Bacteria 2532
96 Ga0157378_10001865 3300013297 Bacteria 18928
97 Ga0157378_10013554 3300013297 Bacteria 7132
98 Ga0157378_10029875 3300013297 Bacteria 4813
99 Ga0163162_10000337 3300013306 Bacteria 42559
100 Ga0163162_10000548 3300013306 Bacteria 34707
101 Ga0163162_10000921 3300013306 Bacteria 27280
102 Ga0163162_10041443 3300013306 Bacteria 4607
103 Ga0157372_10000983 3300013307 Bacteria 31129
104 Ga0157375_10000970 3300013308 Bacteria 24793
105 Ga0157375_10026972 3300013308 Bacteria 5363
106 Ga0157375_10031459 3300013308 Bacteria 5017
107 Ga0157375_10055221 3300013308 Bacteria 3915
108 Ga0157380_10000194 3300014326 Bacteria 35515
109 Ga0157377_10015744 3300014745 Bacteria 3876
110 Ga0157376_10003840 3300014969 Bacteria 10387
111 Ga0157376_10039672 3300014969 Bacteria 3842
112 Ga0163161_10021897 3300017792 Bacteria 4495
113 Ga0207680_10000684 3300025903 Bacteria 16006
114 Ga0207647_10004951 3300025904 Bacteria 9820
115 Ga0207647_10007634 3300025904 Bacteria 7796
116 Ga0207645_10001250 3300025907 Bacteria 20921
117 Ga0207654_10006464 3300025911 Bacteria 5898
118 Ga0207707_10000186 3300025912 Bacteria 65484
119 Ga0207695_10000446 3300025913 Bacteria 90493
120 Ga0207695_10001024 3300025913 Bacteria 49211
121 Ga0207695_10007279 3300025913 Bacteria 14135
122 Ga0207695_10011961 3300025913 Bacteria 10447
123 Ga0207671_10000036 3300025914 Bacteria 236133
124 Ga0207671_10001679 3300025914 Bacteria 25113
125 Ga0207671_10003954 3300025914 Bacteria 14423
126 Ga0207649_10009264 3300025920 Bacteria 5386
127 Ga0207694_10057137 3300025924 Bacteria 3033
128 Ga0207644_10041321 3300025931 Bacteria 3262
129 Ga0207706_10003952 3300025933 Bacteria 14046
130 Ga0207706_10032586 3300025933 Bacteria 4640
131 Ga0207670_10029340 3300025936 Unclassified 3504
132 Ga0207670_10100926 3300025936 Bacteria 2061
133 Ga0207691_10000001 3300025940 Bacteria 220829
134 Ga0207691_10028592 3300025940 Bacteria 5219
135 Ga0207689_10054567 3300025942 Unclassified 3291
136 Ga0207679_10002905 3300025945 Bacteria 10626
137 Ga0207667_10000254 3300025949 Bacteria 75138
138 Ga0207667_10007369 3300025949 Bacteria 13237
139 Ga0207667_10037112 3300025949 Bacteria 5212
140 Ga0207651_10043749 3300025960 Bacteria 2991
141 Ga0207651_10048395 3300025960 Bacteria 2874
142 Ga0207658_10009567 3300025986 Bacteria 6579
143 Ga0207677_10006600 3300026023 Bacteria 6367
144 Ga0207677_10019835 3300026023 Bacteria 4069
145 Ga0207703_10002494 3300026035 Bacteria 15954
146 Ga0207678_10013234 3300026067 Bacteria 7239
147 Ga0207641_10000967 3300026088 Bacteria 29446
148 Ga0207641_10032900 3300026088 Bacteria 4307
149 Ga0207676_10062163 3300026095 Bacteria 2961
150 Ga0207674_10006446 3300026116 Bacteria 13797
151 Ga0207674_10011936 3300026116 Bacteria 9739
152 Ga0207674_10034121 3300026116 Bacteria 5322
153 Ga0207675_100046954 3300026118 Bacteria 4033
154 Ga0207683_10003288 3300026121 Bacteria 14091
155 Ga0268266_10000016 3300028379 Bacteria 629101
156 Ga0268266_10002439 3300028379 Bacteria 19963
157 Ga0268264_10000621 3300028381 Bacteria 42149
158 Ga0268264_10002341 3300028381 Bacteria 16753
159 Ga0268264_10007744 3300028381 Bacteria 8942
160 Ga0268264_10015658 3300028381 Bacteria 6210
161 Ga0307517_10003238 3300028786 Bacteria 25505
162 Ga0307511_10000688 3300030521 Bacteria 36145
163 Ga0265327_10000010 3300031251 Bacteria 566817
164 Ga0265327_10021684 3300031251 Unclassified 3868
165 Ga0265313_10011513 3300031595 Bacteria 5491
166 Ga0265314_10005763 3300031711 Bacteria 11115
167 Ga0307516_10000966 3300031730 Bacteria 39704
168 Ga0307510_10000042 3300033180 Bacteria 100951
169 Ga0316584_0005496 3300036712 Bacteria 8512
170 Ga0439436_0008899 3300041404 Bacteria 3082
171 Ga0466969_0005894 3300044656 Bacteria 6514
172 Ga0466972_0006780 3300044658 Bacteria 5749
173 Ga0466965_0023031 3300044683 Unclassified 3006
174 Ga0453684_0005938 3300044712 Bacteria 23683
175 Ga0466957_0009313 3300044842 Bacteria 5603
176 Ga0466959_0000201 3300045049 Bacteria 39074
177 Ga0466959_0034970 3300045049 Bacteria 3716
178 Ga0495606_0007851 3300046507 Bacteria 9420
179 Ga0495668_0002239 3300046616 Bacteria 16357
180 Ga0495611_0000011 3300046648 Bacteria 146643
181 Ga0495670_0029345 3300046691 Bacteria 2730
182 Ga0495636_0000045 3300047318 Bacteria 53503
183 Ga0495672_0011870 3300047320 Bacteria 6116
184 Ga0495672_0021432 3300047320 Bacteria 4216
185 Ga0495687_000004 3300047443 Bacteria 779298
186 Ga0495686_0000165 3300047472 Bacteria 125611
187 Ga0496115_0056797 3300048918 Bacteria 3146
188 Ga0501037_0005551 3300049573 Bacteria 9203
189 Ga0501038_0055507 3300049574 Bacteria 3402
190 Ga0501043_0005980 3300049579 Bacteria 9781
191 Ga0501043_0014857 3300049579 Bacteria 6095
192 Ga0501047_0004456 3300049581 Bacteria 13179
193 Ga0501047_0009421 3300049581 Bacteria 9227
194 Ga0501219_000155 3300049703 Bacteria 12418
195 Ga0501225_0000833 3300049705 Bacteria 9603
196 Ga0501035_0013001 3300049822 Bacteria 7681
197 Ga0501035_0031616 3300049822 Bacteria 4821
198 Ga0501044_0003571 3300049823 Bacteria 17502
199 Ga0501044_0013033 3300049823 Bacteria 8998
200 Ga0501284_00073 3300050005 Bacteria 28647
201 nmdc:mga05p37_43381_c1 3300050507 Bacteria 5533
202 nmdc:mga09592_34002_c1 3300050508 Bacteria 4260
203 nmdc:mga08y16_36184_c1 3300050511 Bacteria 5184
204 Ga0500578_0000120 3300053086 Bacteria 95463
205 Ga0500583_0000106 3300053092 Bacteria 43356
206 Ga0500583_0000369 3300053092 Bacteria 14767
207 Ga0500568_0000876 3300053139 Bacteria 21116
208 Ga0500622_0034758 3300053156 Bacteria 2640
209 Ga0500637_0021214 3300053178 Bacteria 3527

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10009368 Ga0105249_100093681 648
2 3300025936 Ga0207670_10100926 Ga0207670_101009261 653
3 3300041404 Ga0439436_0008899 Ga0439436_0008899_1105_3066 653
4 3300053139 Ga0500568_0000876 Ga0500568_0000876_11100_13088 662
5 3300049703 Ga0501219_000155 Ga0501219_000155_9447_11534 666
6 3300009147 Ga0114129_10294425 Ga0114129_102944251 692
7 3300046691 Ga0495670_0029345 Ga0495670_0029345_122_2269 715
8 3300053178 Ga0500637_0021214 Ga0500637_0021214_1305_3452 715
9 3300044683 Ga0466965_0023031 Ga0466965_0023031_15_2219 733
10 3300005335 Ga0070666_10006471 Ga0070666_100064716 734
11 3300005456 Ga0070678_100020817 Ga0070678_1000208171 734
12 3300005535 Ga0070684_100017356 Ga0070684_1000173565 734
13 3300005842 Ga0068858_100054752 Ga0068858_1000547521 734
14 3300006358 Ga0068871_100021040 Ga0068871_1000210403 734
15 3300013296 Ga0157374_10017560 Ga0157374_100175603 734
16 3300013308 Ga0157375_10026972 Ga0157375_100269722 734
17 3300014969 Ga0157376_10039672 Ga0157376_100396722 734
18 3300025904 Ga0207647_10007634 Ga0207647_100076342 734
19 3300025933 Ga0207706_10003952 Ga0207706_100039521 734
20 3300025960 Ga0207651_10048395 Ga0207651_100483952 734
21 3300026067 Ga0207678_10013234 Ga0207678_100132343 734
22 3300026116 Ga0207674_10011936 Ga0207674_100119365 734
23 3300026121 Ga0207683_10003288 Ga0207683_100032884 734
24 3300031251 Ga0265327_10000010 Ga0265327_10000010481 736
25 3300005367 Ga0070667_100060055 Ga0070667_1000600551 738
26 3300005617 Ga0068859_100002196 Ga0068859_1000021961 738
27 3300005843 Ga0068860_100001628 Ga0068860_10000162816 738
28 3300006931 Ga0097620_100002196 Ga0097620_10000219613 738
29 3300013297 Ga0157378_10013554 Ga0157378_100135542 738
30 3300025986 Ga0207658_10009567 Ga0207658_100095672 738
31 3300028381 Ga0268264_10007744 Ga0268264_100077442 738
32 3300026095 Ga0207676_10062163 Ga0207676_100621632 739
33 3300053156 Ga0500622_0034758 Ga0500622_0034758_388_2607 739
34 3300005365 Ga0070688_100008218 Ga0070688_1000082182 740
35 3300005340 Ga0070689_100003109 Ga0070689_1000031093 741
36 3300009094 Ga0111539_10013767 Ga0111539_100137672 743
37 3300009551 Ga0105238_10017371 Ga0105238_100173712 743
38 3300010375 Ga0105239_10035849 Ga0105239_100358494 743
39 3300050511 nmdc:mga08y16_36184_c1 nmdc:mga08y16_36184_c1_2296_4590 743
40 3300006358 Ga0068871_100009966 Ga0068871_1000099665 744
41 3300013306 Ga0163162_10000337 Ga0163162_100003376 744
42 3300031251 Ga0265327_10021684 Ga0265327_100216842 745
43 3300005841 Ga0068863_100017486 Ga0068863_1000174862 746
44 3300013296 Ga0157374_10120469 Ga0157374_101204691 746
45 3300013297 Ga0157378_10001865 Ga0157378_100018658 746
46 3300025931 Ga0207644_10041321 Ga0207644_100413213 746
47 3300026023 Ga0207677_10019835 Ga0207677_100198352 746
48 3300026088 Ga0207641_10032900 Ga0207641_100329002 746
49 3300005290 Ga0065712_10007023 Ga0065712_100070232 748
50 3300005340 Ga0070689_100066912 Ga0070689_1000669121 748
51 3300005354 Ga0070675_100017978 Ga0070675_1000179782 748
52 3300005364 Ga0070673_100020085 Ga0070673_1000200852 748
53 3300005365 Ga0070688_100009898 Ga0070688_1000098982 748
54 3300014745 Ga0157377_10015744 Ga0157377_100157442 748
55 3300025940 Ga0207691_10028592 Ga0207691_100285924 748
56 3300046507 Ga0495606_0007851 Ga0495606_0007851_303_2672 748
57 3300005328 Ga0070676_10000330 Ga0070676_100003302 749
58 3300005329 Ga0070683_100014287 Ga0070683_1000142877 749
59 3300005338 Ga0068868_100000064 Ga0068868_10000006443 749
60 3300005344 Ga0070661_100006787 Ga0070661_1000067875 749
61 3300005347 Ga0070668_100003226 Ga0070668_1000032268 749
62 3300005364 Ga0070673_100000514 Ga0070673_1000005142 749
63 3300005459 Ga0068867_100004230 Ga0068867_1000042305 749
64 3300005535 Ga0070684_100043341 Ga0070684_1000433412 749
65 3300005543 Ga0070672_100001332 Ga0070672_10000133210 749
66 3300005548 Ga0070665_100001684 Ga0070665_10000168415 749
67 3300005564 Ga0070664_100020571 Ga0070664_1000205712 749
68 3300005617 Ga0068859_100135248 Ga0068859_1001352481 749
69 3300005719 Ga0068861_100035763 Ga0068861_1000357632 749
70 3300005834 Ga0068851_10003250 Ga0068851_100032502 749
71 3300005843 Ga0068860_100018533 Ga0068860_1000185335 749
72 3300006237 Ga0097621_100010746 Ga0097621_1000107465 749
73 3300006931 Ga0097620_100135251 Ga0097620_1001352511 749
74 3300009093 Ga0105240_10126926 Ga0105240_101269262 749
75 3300009148 Ga0105243_10023920 Ga0105243_100239202 749
76 3300009553 Ga0105249_10032842 Ga0105249_100328423 749
77 3300013306 Ga0163162_10000548 Ga0163162_100005489 749
78 3300013308 Ga0157375_10000970 Ga0157375_1000097014 749
79 3300017792 Ga0163161_10021897 Ga0163161_100218973 749
80 3300025903 Ga0207680_10000684 Ga0207680_100006848 749
81 3300025907 Ga0207645_10001250 Ga0207645_1000125010 749
82 3300025920 Ga0207649_10009264 Ga0207649_100092642 749
83 3300025940 Ga0207691_10000001 Ga0207691_10000001142 749
84 3300025945 Ga0207679_10002905 Ga0207679_100029051 749
85 3300025960 Ga0207651_10043749 Ga0207651_100437492 749
86 3300026023 Ga0207677_10006600 Ga0207677_100066005 749
87 3300026035 Ga0207703_10002494 Ga0207703_1000249410 749
88 3300026116 Ga0207674_10034121 Ga0207674_100341212 749
89 3300026118 Ga0207675_100046954 Ga0207675_1000469543 749
90 3300028379 Ga0268266_10002439 Ga0268266_100024398 749
91 3300025936 Ga0207670_10029340 Ga0207670_100293401 750
92 3300005841 Ga0068863_100014701 Ga0068863_1000147013 752
93 3300005843 Ga0068860_100010536 Ga0068860_1000105363 752
94 3300026088 Ga0207641_10000967 Ga0207641_1000096711 752
95 3300028381 Ga0268264_10002341 Ga0268264_1000234112 752
96 3300005457 Ga0070662_100046934 Ga0070662_1000469342 754
97 3300005617 Ga0068859_100020658 Ga0068859_1000206582 754
98 3300005842 Ga0068858_100025685 Ga0068858_1000256853 754
99 3300006931 Ga0097620_100020657 Ga0097620_1000206572 754
100 3300013306 Ga0163162_10041443 Ga0163162_100414432 754
101 3300013308 Ga0157375_10055221 Ga0157375_100552212 754
102 3300047320 Ga0495672_0011870 Ga0495672_0011870_2350_4644 754
103 3300003323 rootH1_10114063 rootH1_101140632 755
104 3300005539 Ga0068853_100034091 Ga0068853_1000340912 756
105 3300005563 Ga0068855_100037006 Ga0068855_1000370061 756
106 3300005577 Ga0068857_100003983 Ga0068857_1000039832 756
107 3300005616 Ga0068852_100002358 Ga0068852_1000023589 756
108 3300009147 Ga0114129_10054684 Ga0114129_100546843 756
109 3300013104 Ga0157370_10004148 Ga0157370_100041483 756
110 3300013105 Ga0157369_10024682 Ga0157369_100246822 756
111 3300013307 Ga0157372_10000983 Ga0157372_1000098318 756
112 3300025904 Ga0207647_10004951 Ga0207647_100049512 756
113 3300025949 Ga0207667_10000254 Ga0207667_1000025444 756
114 3300026116 Ga0207674_10006446 Ga0207674_100064462 756
115 3300048918 Ga0496115_0056797 Ga0496115_0056797_289_2565 756
116 3300050507 nmdc:mga05p37_43381_c1 nmdc:mga05p37_43381_c1_1795_4176 756
117 iso_pu_bacteria 2739367866 2740034365 756
118 3300028786 Ga0307517_10003238 Ga0307517_1000323813 760
119 3300033180 Ga0307510_10000042 Ga0307510_1000004217 760
120 3300044712 Ga0453684_0005938 Ga0453684_0005938_18720_21056 760
121 3300047320 Ga0495672_0021432 Ga0495672_0021432_91_2415 760
122 3300006847 Ga0075431_100002640 Ga0075431_1000026402 761
123 3300006880 Ga0075429_100018930 Ga0075429_1000189304 761
124 3300009098 Ga0105245_10020329 Ga0105245_100203292 761
125 3300009147 Ga0114129_10063105 Ga0114129_100631053 761
126 3300014326 Ga0157380_10000194 Ga0157380_100001944 761
127 3300049573 Ga0501037_0005551 Ga0501037_0005551_4024_6309 761
128 3300049574 Ga0501038_0055507 Ga0501038_0055507_221_2506 761
129 3300049579 Ga0501043_0005980 Ga0501043_0005980_5380_7665 761
130 3300049579 Ga0501043_0014857 Ga0501043_0014857_2384_4669 761
131 3300049581 Ga0501047_0009421 Ga0501047_0009421_4797_7082 761
132 3300049822 Ga0501035_0013001 Ga0501035_0013001_775_3060 761
133 3300049823 Ga0501044_0003571 Ga0501044_0003571_8922_11207 761
134 3300050508 nmdc:mga09592_34002_c1 nmdc:mga09592_34002_c1_1929_4223 761
135 3300005338 Ga0068868_100048060 Ga0068868_1000480602 762
136 3300005355 Ga0070671_100034330 Ga0070671_1000343302 762
137 3300005548 Ga0070665_100000008 Ga0070665_100000008403 762
138 3300013296 Ga0157374_10073957 Ga0157374_100739572 762
139 3300013297 Ga0157378_10029875 Ga0157378_100298753 762
140 3300013308 Ga0157375_10031459 Ga0157375_100314593 762
141 3300025933 Ga0207706_10032586 Ga0207706_100325862 762
142 3300025942 Ga0207689_10054567 Ga0207689_100545673 762
143 3300028379 Ga0268266_10000016 Ga0268266_10000016401 762
144 3300031711 Ga0265314_10005763 Ga0265314_100057632 762
145 3300036712 Ga0316584_0005496 Ga0316584_0005496_1608_3929 762
146 3300046616 Ga0495668_0002239 Ga0495668_0002239_5879_8272 762
147 3300005366 Ga0070659_100033379 Ga0070659_1000333792 763
148 3300005539 Ga0068853_100000245 Ga0068853_10000024521 763
149 3300009093 Ga0105240_10001276 Ga0105240_1000127628 763
150 3300009093 Ga0105240_10014845 Ga0105240_100148454 763
151 3300009093 Ga0105240_10016491 Ga0105240_100164913 763
152 3300009093 Ga0105240_10037919 Ga0105240_100379192 763
153 3300009174 Ga0105241_10000176 Ga0105241_1000017630 763
154 3300009551 Ga0105238_10029848 Ga0105238_100298484 763
155 3300010375 Ga0105239_10000368 Ga0105239_100003684 763
156 3300013104 Ga0157370_10014602 Ga0157370_100146023 763
157 3300013296 Ga0157374_10000009 Ga0157374_10000009349 763
158 3300014969 Ga0157376_10003840 Ga0157376_100038402 763
159 3300025912 Ga0207707_10000186 Ga0207707_100001867 763
160 3300025913 Ga0207695_10000446 Ga0207695_100004464 763
161 3300025913 Ga0207695_10001024 Ga0207695_100010243 763
162 3300025913 Ga0207695_10007279 Ga0207695_100072792 763
163 3300031595 Ga0265313_10011513 Ga0265313_100115133 763
164 3300045049 Ga0466959_0034970 Ga0466959_0034970_493_2808 763
165 3300046648 Ga0495611_0000011 Ga0495611_0000011_96186_98495 763
166 3300005563 Ga0068855_100005843 Ga0068855_1000058432 764
167 3300009545 Ga0105237_10005809 Ga0105237_1000580911 764
168 3300010375 Ga0105239_10008194 Ga0105239_100081942 764
169 3300025924 Ga0207694_10057137 Ga0207694_100571371 764
170 3300025949 Ga0207667_10007369 Ga0207667_100073696 764
171 3300049705 Ga0501225_0000833 Ga0501225_0000833_955_3291 764
172 3300003322 rootL2_10040885 rootL2_100408852 765
173 3300003323 rootH1_10005022 rootH1_100050221 765
174 3300005335 Ga0070666_10012735 Ga0070666_100127352 765
175 3300005843 Ga0068860_100000059 Ga0068860_1000000592 765
176 3300009093 Ga0105240_10000153 Ga0105240_1000015312 765
177 3300013306 Ga0163162_10000921 Ga0163162_1000092112 765
178 3300025911 Ga0207654_10006464 Ga0207654_100064644 765
179 3300025913 Ga0207695_10011961 Ga0207695_100119613 765
180 3300025914 Ga0207671_10003954 Ga0207671_100039547 765
181 3300028381 Ga0268264_10000621 Ga0268264_100006212 765
182 3300044658 Ga0466972_0006780 Ga0466972_0006780_1936_4320 765
183 3300044842 Ga0466957_0009313 Ga0466957_0009313_649_3033 765
184 3300049581 Ga0501047_0004456 Ga0501047_0004456_3479_5863 765
185 3300049822 Ga0501035_0031616 Ga0501035_0031616_2046_4430 765
186 3300049823 Ga0501044_0013033 Ga0501044_0013033_636_3020 765
187 3300050005 Ga0501284_00073 Ga0501284_00073_5447_7831 765
188 3300053086 Ga0500578_0000120 Ga0500578_0000120_67252_69636 765
189 3300053092 Ga0500583_0000106 Ga0500583_0000106_23283_25667 765
190 3300053092 Ga0500583_0000369 Ga0500583_0000369_5892_8276 765
191 iso_pu_bacteria 2738541278 2738731454 765
192 3300009093 Ga0105240_10078719 Ga0105240_100787192 767
193 3300010375 Ga0105239_10034820 Ga0105239_100348201 767
194 3300025949 Ga0207667_10037112 Ga0207667_100371122 767
195 3300009545 Ga0105237_10002276 Ga0105237_1000227613 771
196 3300025914 Ga0207671_10000036 Ga0207671_10000036109 771
197 3300047318 Ga0495636_0000045 Ga0495636_0000045_352_2712 771
198 3300044656 Ga0466969_0005894 Ga0466969_0005894_3960_6383 773
199 3300045049 Ga0466959_0000201 Ga0466959_0000201_35553_37976 773
200 3300047472 Ga0495686_0000165 Ga0495686_0000165_33078_35408 775
201 3300031730 Ga0307516_10000966 Ga0307516_100009662 776
202 3300005614 Ga0068856_100013927 Ga0068856_1000139274 778
203 3300047443 Ga0495687_000004 Ga0495687_000004_543119_545458 778
204 3300005338 Ga0068868_100056370 Ga0068868_1000563702 784
205 3300005843 Ga0068860_100016347 Ga0068860_1000163474 784
206 3300009545 Ga0105237_10013349 Ga0105237_100133494 784
207 3300010375 Ga0105239_10001098 Ga0105239_1000109815 784
208 3300025914 Ga0207671_10001679 Ga0207671_1000167917 784
209 3300028381 Ga0268264_10015658 Ga0268264_100156584 784
210 3300030521 Ga0307511_10000688 Ga0307511_100006885 786
211 3300003320 rootH2_10030594 rootH2_100305942 789

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00912

Transgly

Transglycosylase

74

252

0.94

PF06832

BiPBP_C

Penicillin-Binding Protein C-terminus Family

712

802

0.87

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

328

592

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d3h-assembly1.cif.gz_A-2 crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a 0.9197 56 235
3nb7-assembly1.cif.gz_A-2 crystal structure of aquifex aeolicus peptidoglycan glycosyltransferase in complex with decarboxylated neryl moenomycin 0.9137 56 235
2oqo-assembly1.cif.gz_A-2 crystal structure of a peptidoglycan glycosyltransferase from a class a pbp: insight into bacterial cell wall synthesis 0.9063 56 235
3d3h-assembly1.cif.gz_A-2 crystal structure of a complex of the peptidoglycan glycosyltransferase domain from aquifex aeolicus and neryl moenomycin a 0.9047 56 235
3nb6-assembly1.cif.gz_A-2 crystal structure of aquifex aeolicus peptidoglycan glycosyltransferase in complex with methylphosphoryl neryl moenomycin 0.8981 56 235
ID Description Score Start End Superfamily
af_P76577_56_250_1.10.3810.10 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9608 48 240 1.10.3810.10
af_P76577_56_250_1.10.3810.10 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9465 48 240 1.10.3810.10
3d3hA00 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9197 56 235 1.10.3810.10
3fwmA02 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9135 48 216 1.10.3810.10
3d3hA00 Mainly Alpha;Orthogonal Bundle;Penicillin binding protein transpeptidase fold;Biosynthetic peptidoglycan transglycosylase-like 0.9047 56 235 1.10.3810.10
ID Description Score Start End GO Terms
AF-W7YSE8-F1-model_v4 Penicillin-binding protein 1A 0.9602 323 446 GO:0008658
GO:0008955
GO:0009252
GO:0030288
AF-A0A527CW11-F1-model_v4 Penicillin-binding protein 1C 0.9452 54 184 GO:0008955
GO:0009252
GO:0030288
AF-A0A1W9STY0-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) 0.9401 15 789 GO:0004180
GO:0006508
GO:0006793
GO:0008658
GO:0008955
GO:0009252
GO:0030288
AF-A0A354YGE9-F1-model_v4 Penicillin-binding protein 1C 0.9397 81 243 GO:0008955
GO:0009252
GO:0030288
AF-A0A162NWH2-F1-model_v4 Penicillin-binding protein 1C 0.938 202 789 GO:0008658
GO:0008955
GO:0009252
GO:0030288

Feature Viewer

pLDDT pTM Quality
85.56 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map