F322294

General Info

Members Datasets Scaffolds Average Seq Length
212 165 424 424

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1005215|JGI25154J39366_10052152
Length 451
Sequence MALWKLHGNGRTVEPGAVVTPEERLSWPATIAIGAQHVVAMFGATFLVPTLTGFPVSTTLLFSGIGTLLFLLITKNQLPSYLGSSFAFIAPITAAVAAGGTGSALAGVVAVGVLLAXXXXVVQFVGLRWVDALMPPVVAGAIVALIGFNLAPTAWSNFALDPVTATITLVAIILFAVLFRGFLGRISIFLGVAVGFIWAAFNGSFEVPNPLRGDKTPAELIADAPWIGLPHFQFPDFVEPGTWSTIAMFLPVVLVLIAENVGHVRGVATMTEDPAINRHTGRALIADGVATTIAGGFGGSGTTTYGENIGVMAATRVYSTAVYWVAGLFAILLAFSPKVGEVFNSIPAGVLGGATTALYGLIGIIGIKIWVDSRVDFSRPVNQYTAAVSLVIGIAGFTMQLGDFAFGGIVLGTVAALLIYHLGNLIARARKTGADDPKPLEPVGPLGGDPA

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
33 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
79 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
98 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
99 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
100 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
101 2558860280 Kutzneria sp. 744 Isolate Unclassified
102 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
103 2643221546 Microbacterium sp. Root53 Isolate Unclassified
104 2643221549 Agromyces sp. Root1464 Isolate Unclassified
105 2643221553 Microbacterium sp. Root553 Isolate Unclassified
106 2643221575 Microbacterium sp. Root61 Isolate Unclassified
107 2643221616 Leifsonia sp. Root227 Isolate Unclassified
108 2643221619 Agromyces sp. Root81 Isolate Unclassified
109 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
110 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
111 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
112 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
113 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
114 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
115 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
116 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
117 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
118 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
119 2773857759 Microbacterium sp. 1294 Isolate Unclassified
120 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
121 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
122 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
123 2808606372 Agromyces sp. 23-23 Isolate Unclassified
124 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
125 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
126 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
127 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
128 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
129 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
130 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
131 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
132 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
133 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
134 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
135 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
136 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
137 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
138 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
139 2919069694 Microbacterium sp. 1154 Isolate Unclassified
140 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
141 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
142 2922554459 Rhodococcus sp. 66b Isolate Unclassified
143 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
144 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
145 2928153084 Leifsonia sp. 563 Isolate Unclassified
146 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
147 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
148 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
149 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
150 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
151 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
152 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
153 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
154 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
155 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
156 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
157 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
158 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
159 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
160 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
161 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
162 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
163 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
164 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
165 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 66.51
Metatranscriptomes 2.36
Isolates 31.13

Biome Distribution

Category Percentage (%)
Aerial Root 1.42
Bulb 0
Endosphere 12.74
Nodule 0
Rhizoplane 5.66
Rhizosphere 47.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1005215 3300002738 Bacteria 2121
2 JGI24740J21852_10014641 3300001979 Bacteria 2884
3 JGI24735J21928_10004403 3300002067 Bacteria 4741
4 JGI24735J21928_10009031 3300002067 Bacteria 3211
5 JGI25164J39214_1000930 3300002772 Bacteria 9597
6 rootH2_10038606 3300003320 Bacteria 4166
7 Ga0006562J51391_1063934 3300003578 Bacteria 22476
8 Ga0006562J51391_1063935 3300003578 Bacteria 22046
9 Ga0006562J51391_1115019 3300003578 Bacteria 3530
10 Ga0006562J51391_1115020 3300003578 Bacteria 3180
11 Ga0055539_1000035 3300003752 Bacteria 217588
12 Ga0055533_1000001 3300003756 Bacteria 1863437
13 Ga0055525_1000231 3300003759 Bacteria 59489
14 Ga0055527_1000012 3300003760 Bacteria 348744
15 Ga0055542_1000017 3300003762 Bacteria 348744
16 Ga0055529_1000513 3300003763 Bacteria 34462
17 Ga0055541_1003584 3300003841 Bacteria 2899
18 Ga0065714_10010988 3300005288 Bacteria 2226
19 Ga0070659_100028783 3300005366 Bacteria 4292
20 Ga0068852_100069407 3300005616 Bacteria 3089
21 Ga0075363_100066060 3300006048 Bacteria 1957
22 Ga0075364_10009347 3300006051 Bacteria 5875
23 Ga0075367_10145998 3300006178 Bacteria 1467
24 Ga0075370_10054687 3300006353 Bacteria 2267
25 Ga0105243_10000571 3300009148 Bacteria 37133
26 Ga0105243_10019626 3300009148 Bacteria 5125
27 Ga0105243_10090354 3300009148 Bacteria 2520
28 Ga0105238_10014864 3300009551 Bacteria 7875
29 Ga0157369_10001631 3300013105 Bacteria 27415
30 Ga0157369_10161675 3300013105 Bacteria 2364
31 Ga0157369_10238546 3300013105 Bacteria 1899
32 Ga0171462_1005 3300013250 Bacteria 598379
33 Ga0157372_10036098 3300013307 Bacteria 5447
34 Ga0206353_10439289 3300020082 Bacteria 13600
35 Ga0209566_100055 3300025225 Bacteria 210307
36 Ga0209674_100001 3300025226 Bacteria 4013750
37 Ga0209672_100003 3300025228 Bacteria 1560476
38 Ga0209147_100801 3300025229 Bacteria 15196
39 Ga0209563_100001 3300025230 Bacteria 4013775
40 Ga0209563_100271 3300025230 Bacteria 22218
41 Ga0209646_1000202 3300025246 Bacteria 70943
42 Ga0209677_100001 3300025253 Bacteria 4013787
43 Ga0209677_100302 3300025253 Bacteria 32419
44 Ga0209148_1000004 3300025254 Bacteria 1844481
45 Ga0209129_1016727 3300025258 Bacteria 1462
46 Ga0209455_1000022 3300025272 Bacteria 688910
47 Ga0209455_1000943 3300025272 Bacteria 14894
48 Ga0207647_10053297 3300025904 Bacteria 2493
49 Ga0207694_10071120 3300025924 Bacteria 2718
50 Ga0207709_10001929 3300025935 Bacteria 13625
51 Ga0207709_10002730 3300025935 Bacteria 10893
52 Ga0307511_10000207 3300030521 Bacteria 59484
53 Ga0307405_10090316 3300031731 Bacteria 2026
54 Ga0307413_10013222 3300031824 Bacteria 4140
55 Ga0307406_10000316 3300031901 Bacteria 28120
56 Ga0307406_10010820 3300031901 Bacteria 5155
57 Ga0307406_10147449 3300031901 Bacteria 1674
58 Ga0307407_10028625 3300031903 Bacteria 2981
59 Ga0307412_10033200 3300031911 Bacteria 3278
60 Ga0307414_10117306 3300032004 Bacteria 2039
61 Ga0307415_100046165 3300032126 Bacteria 2925
62 Ga0307415_100098354 3300032126 Bacteria 2139
63 Ga0395899_0001235 3300037312 Bacteria 22310
64 Ga0395899_0044645 3300037312 Bacteria 3302
65 Ga0395900_0004071 3300037418 Bacteria 15593
66 Ga0395900_0252522 3300037418 Bacteria 1764
67 Ga0395898_0000246 3300037466 Bacteria 135487
68 Ga0395901_0119657 3300038443 Bacteria 2767
69 Ga0466969_0018616 3300044656 Bacteria 3616
70 Ga0466972_0032467 3300044658 Bacteria 2563
71 Ga0466965_0000002 3300044683 Bacteria 297957
72 Ga0466965_0009156 3300044683 Bacteria 4598
73 Ga0466965_0046061 3300044683 Bacteria 2158
74 Ga0466966_0008487 3300044684 Bacteria 6802
75 Ga0466961_0016396 3300044693 Bacteria 4760
76 Ga0466961_0021362 3300044693 Bacteria 4166
77 Ga0466963_0138048 3300044694 Bacteria 1688
78 Ga0466971_0019940 3300044719 Bacteria 2980
79 Ga0466971_0100099 3300044719 Bacteria 1331
80 Ga0466970_0010837 3300044765 Bacteria 4635
81 Ga0466970_0021598 3300044765 Bacteria 3353
82 Ga0466970_0023268 3300044765 Bacteria 3235
83 Ga0466970_0048124 3300044765 Bacteria 2273
84 Ga0466970_0090888 3300044765 Bacteria 1657
85 Ga0466957_0076338 3300044842 Bacteria 2080
86 Ga0466957_0079122 3300044842 Bacteria 2045
87 Ga0466960_0109290 3300044901 Bacteria 1434
88 Ga0466959_0001825 3300045049 Bacteria 13358
89 Ga0466959_0089353 3300045049 Bacteria 2213
90 Ga0466958_0012003 3300045836 Bacteria 4895
91 Ga0495627_001525 3300046453 Bacteria 13302
92 Ga0495665_0007500 3300046531 Bacteria 5904
93 Ga0495645_0033583 3300046543 Bacteria 3743
94 Ga0495668_0000123 3300046616 Bacteria 115173
95 Ga0495686_0150949 3300047472 Bacteria 1364
96 Ga0496101_0005066 3300048904 Bacteria 8378
97 Ga0496101_0070212 3300048904 Bacteria 2564
98 Ga0496102_0074048 3300048905 Bacteria 3130
99 Ga0496103_0016858 3300048906 Bacteria 4363
100 Ga0496105_0053238 3300048908 Bacteria 3342
101 Ga0496105_0171301 3300048908 Bacteria 1779
102 Ga0496108_0161230 3300048911 Bacteria 1938
103 Ga0496108_0199071 3300048911 Bacteria 1738
104 Ga0496109_0018629 3300048912 Bacteria 6100
105 Ga0496113_0075560 3300048916 Bacteria 2571
106 Ga0496114_0179214 3300048917 Bacteria 1850
107 Ga0496115_0083128 3300048918 Bacteria 2609
108 Ga0496116_0011247 3300048919 Bacteria 7429
109 Ga0496116_0054257 3300048919 Bacteria 2642
110 Ga0496117_0000668 3300048920 Bacteria 54828
111 Ga0496117_0004389 3300048920 Bacteria 15628
112 Ga0496117_0036475 3300048920 Bacteria 3678
113 Ga0496117_0038878 3300048920 Bacteria 3519
114 Ga0496118_0055858 3300048921 Bacteria 2973
115 Ga0496118_0087982 3300048921 Bacteria 2151
116 Ga0496119_0003276 3300048922 Bacteria 16927
117 Ga0496119_0008105 3300048922 Bacteria 9309
118 Ga0496120_0001253 3300048923 Bacteria 31922
119 Ga0496122_0000065 3300048925 Bacteria 235242
120 Ga0496122_0012814 3300048925 Bacteria 8292
121 Ga0496122_0054558 3300048925 Bacteria 3000
122 Ga0496122_0066713 3300048925 Bacteria 2597
123 Ga0496123_0000006 3300048926 Bacteria 647258
124 Ga0496124_0003086 3300048927 Bacteria 20739
125 Ga0496124_0024110 3300048927 Bacteria 5539
126 Ga0496125_0000085 3300048928 Bacteria 218570
127 Ga0496125_0006019 3300048928 Bacteria 13269
128 Ga0496125_0006981 3300048928 Bacteria 12085
129 Ga0496126_0013780 3300048929 Bacteria 8198
130 Ga0496126_0093020 3300048929 Bacteria 2648
131 Ga0501032_0012768 3300049569 Bacteria 5989
132 Ga0501033_0007158 3300049570 Bacteria 8705
133 Ga0501034_0000939 3300049571 Bacteria 42417
134 Ga0501034_0097506 3300049571 Bacteria 2936
135 Ga0501034_0197081 3300049571 Bacteria 1973
136 Ga0501038_0021114 3300049574 Bacteria 5849
137 Ga0501038_0091131 3300049574 Bacteria 2554
138 Ga0501043_0040432 3300049579 Bacteria 3665
139 Ga0501047_0037537 3300049581 Bacteria 4684
140 Ga0501070_0000200 3300049586 Bacteria 56062
141 Ga0501070_0001562 3300049586 Bacteria 20355
142 Ga0501080_0000269 3300049742 Bacteria 39318
143 Ga0501083_0048096 3300049744 Bacteria 2880
144 nmdc:mga00v17_28040_c1 3300050491 Bacteria 3294
145 Ga0500635_0000015 3300053080 Bacteria 125195
146 Ga0500568_0023184 3300053139 Bacteria 2643
147 2555229139 2554235227 Bacteria 3637389
148 2559429801 2558860280 Bacteria 11429938
149 2566996669 2565956761 Bacteria 6601618
150 2643751940 2643221546 Bacteria 2910897
151 2643769431 2643221549 Bacteria 4042819
152 2643784067 2643221553 Bacteria 3544260
153 2643887441 2643221575 Bacteria 4022601
154 2644095465 2643221616 Bacteria 4066575
155 2644114045 2643221619 Bacteria 4158469
156 2644678786 2643221724 Bacteria 3593515
157 2655030858 2654587600 Bacteria 3911798
158 2723642719 2721755702 Bacteria 4373124
159 2730228298 2728369380 Bacteria 3620317
160 2738891406 2738541308 Bacteria 7020677
161 2739205510 2738543005 Bacteria 5278128
162 2739237082 2738543011 Bacteria 5731169
163 2744956660 2744054611 Bacteria 5611514
164 2747955204 2747842429 Bacteria 3914386
165 2774379150 2773857758 Bacteria 3592392
166 2774382569 2773857759 Bacteria 2963774
167 2774401181 2773857763 Bacteria 4180068
168 2808629541 2808606306 Bacteria 3608896
169 2808884467 2808606368 Bacteria 3174172
170 2808902691 2808606372 Bacteria 4649509
171 2809225673 2808606447 Bacteria 3572005
172 2812325307 2811994872 Bacteria 4121241
173 2833712992 2833709550 Bacteria 4008291
174 2844841857 2844841374 Bacteria 3917147
175 2852635468 2852632344 Bacteria 3463163
176 2852648160 2852646457 Bacteria 3408613
177 2857722864 2857720070 Bacteria 3189373
178 2857726872 2857723135 Bacteria 4217853
179 2870628480 2870628048 Bacteria 3696012
180 2889301308 2889300758 Bacteria 5690814
181 2904510588 2904509784 Bacteria 3520416
182 2904539187 2904535858 Bacteria 6308016
183 2906803511 2906799679 Bacteria 4031749
184 2908678165 2908678064 Bacteria 3482747
185 2919059048 2919055335 Bacteria 3875751
186 2919070474 2919069694 Bacteria 3622919
187 2919443274 2919443155 Bacteria 4072969
188 2919523905 2919523602 Bacteria 3788128
189 2922555855 2922554459 Bacteria 6683962
190 2928093284 2928090899 Bacteria 3158267
191 2928144779 2928142448 Bacteria 5288925
192 2928153104 2928153084 Bacteria 4020257
193 2935413110 2935409751 Bacteria 4179611
194 2939744776 2939743619 Bacteria 5762299
195 2945970180 2945968032 Bacteria 4111363
196 2946035270 2946033335 Bacteria 3835514
197 2946042556 2946041624 Bacteria 4191385
198 2946082572 2946080515 Bacteria 4310960
199 2966923556 2966921586 Bacteria 3092803
200 2974295178 2974294766 Bacteria 3767688
201 2974325019 2974324384 Bacteria 3750535
202 2977230063 2977228692 Bacteria 3450105
203 2977237870 2977236895 Bacteria 3569373
204 2977252754 2977251589 Bacteria 2952848
205 2977265268 2977264416 Bacteria 3750737
206 2984525600 2984523437 Bacteria 4508481
207 2984544348 2984542743 Bacteria 3569378
208 2984583094 2984580707 Bacteria 3351387
209 8004183117 8004182704 Bacteria 3391155
210 8004215245 8004212874 Bacteria 2861420
211 8016255423 8016254467 Bacteria 3797036
212 8045833349 8045830549 Bacteria 4444727
213 JGI25154J39366_1005215
214 JGI24740J21852_10014641
215 JGI24735J21928_10004403
216 JGI24735J21928_10009031
217 JGI25164J39214_1000930
218 rootH2_10038606
219 Ga0006562J51391_1063934
220 Ga0006562J51391_1063935
221 Ga0006562J51391_1115019
222 Ga0006562J51391_1115020
223 Ga0055539_1000035
224 Ga0055533_1000001
225 Ga0055525_1000231
226 Ga0055527_1000012
227 Ga0055542_1000017
228 Ga0055529_1000513
229 Ga0055541_1003584
230 Ga0065714_10010988
231 Ga0070659_100028783
232 Ga0068852_100069407
233 Ga0075363_100066060
234 Ga0075364_10009347
235 Ga0075367_10145998
236 Ga0075370_10054687
237 Ga0105243_10000571
238 Ga0105243_10019626
239 Ga0105243_10090354
240 Ga0105238_10014864
241 Ga0157369_10001631
242 Ga0157369_10161675
243 Ga0157369_10238546
244 Ga0171462_1005
245 Ga0157372_10036098
246 Ga0206353_10439289
247 Ga0209566_100055
248 Ga0209674_100001
249 Ga0209672_100003
250 Ga0209147_100801
251 Ga0209563_100001
252 Ga0209563_100271
253 Ga0209646_1000202
254 Ga0209677_100001
255 Ga0209677_100302
256 Ga0209148_1000004
257 Ga0209129_1016727
258 Ga0209455_1000022
259 Ga0209455_1000943
260 Ga0207647_10053297
261 Ga0207694_10071120
262 Ga0207709_10001929
263 Ga0207709_10002730
264 Ga0307511_10000207
265 Ga0307405_10090316
266 Ga0307413_10013222
267 Ga0307406_10000316
268 Ga0307406_10010820
269 Ga0307406_10147449
270 Ga0307407_10028625
271 Ga0307412_10033200
272 Ga0307414_10117306
273 Ga0307415_100046165
274 Ga0307415_100098354
275 Ga0395899_0001235
276 Ga0395899_0044645
277 Ga0395900_0004071
278 Ga0395900_0252522
279 Ga0395898_0000246
280 Ga0395901_0119657
281 Ga0466969_0018616
282 Ga0466972_0032467
283 Ga0466965_0000002
284 Ga0466965_0009156
285 Ga0466965_0046061
286 Ga0466966_0008487
287 Ga0466961_0016396
288 Ga0466961_0021362
289 Ga0466963_0138048
290 Ga0466971_0019940
291 Ga0466971_0100099
292 Ga0466970_0010837
293 Ga0466970_0021598
294 Ga0466970_0023268
295 Ga0466970_0048124
296 Ga0466970_0090888
297 Ga0466957_0076338
298 Ga0466957_0079122
299 Ga0466960_0109290
300 Ga0466959_0001825
301 Ga0466959_0089353
302 Ga0466958_0012003
303 Ga0495627_001525
304 Ga0495665_0007500
305 Ga0495645_0033583
306 Ga0495668_0000123
307 Ga0495686_0150949
308 Ga0496101_0005066
309 Ga0496101_0070212
310 Ga0496102_0074048
311 Ga0496103_0016858
312 Ga0496105_0053238
313 Ga0496105_0171301
314 Ga0496108_0161230
315 Ga0496108_0199071
316 Ga0496109_0018629
317 Ga0496113_0075560
318 Ga0496114_0179214
319 Ga0496115_0083128
320 Ga0496116_0011247
321 Ga0496116_0054257
322 Ga0496117_0000668
323 Ga0496117_0004389
324 Ga0496117_0036475
325 Ga0496117_0038878
326 Ga0496118_0055858
327 Ga0496118_0087982
328 Ga0496119_0003276
329 Ga0496119_0008105
330 Ga0496120_0001253
331 Ga0496122_0000065
332 Ga0496122_0012814
333 Ga0496122_0054558
334 Ga0496122_0066713
335 Ga0496123_0000006
336 Ga0496124_0003086
337 Ga0496124_0024110
338 Ga0496125_0000085
339 Ga0496125_0006019
340 Ga0496125_0006981
341 Ga0496126_0013780
342 Ga0496126_0093020
343 Ga0501032_0012768
344 Ga0501033_0007158
345 Ga0501034_0000939
346 Ga0501034_0097506
347 Ga0501034_0197081
348 Ga0501038_0021114
349 Ga0501038_0091131
350 Ga0501043_0040432
351 Ga0501047_0037537
352 Ga0501070_0000200
353 Ga0501070_0001562
354 Ga0501080_0000269
355 Ga0501083_0048096
356 nmdc:mga00v17_28040_c1
357 Ga0500635_0000015
358 Ga0500568_0023184
359 2555229139
360 2559429801
361 2566996669
362 2643751940
363 2643769431
364 2643784067
365 2643887441
366 2644095465
367 2644114045
368 2644678786
369 2655030858
370 2723642719
371 2730228298
372 2738891406
373 2739205510
374 2739237082
375 2744956660
376 2747955204
377 2774379150
378 2774382569
379 2774401181
380 2808629541
381 2808884467
382 2808902691
383 2809225673
384 2812325307
385 2833712992
386 2844841857
387 2852635468
388 2852648160
389 2857722864
390 2857726872
391 2870628480
392 2889301308
393 2904510588
394 2904539187
395 2906803511
396 2908678165
397 2919059048
398 2919070474
399 2919443274
400 2919523905
401 2922555855
402 2928093284
403 2928144779
404 2928153104
405 2935413110
406 2939744776
407 2945970180
408 2946035270
409 2946042556
410 2946082572
411 2966923556
412 2974295178
413 2974325019
414 2977230063
415 2977237870
416 2977252754
417 2977265268
418 2984525600
419 2984544348
420 2984583094
421 8004183117
422 8004215245
423 8016255423
424 8045833349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00860

Xan_ur_permease

Permease family

28

402

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.8876 19 412
5xls-assembly1.cif.gz_A-2 crystal structure of uraa in occluded conformation 0.8567 19 412
3qe7-assembly1.cif.gz_A crystal structure of uracil transporter--uraa 0.81 18 404
3qe7-assembly1.cif.gz_A crystal structure of uracil transporter--uraa 0.7716 18 404
5i6c-assembly1.cif.gz_B the structure of the eukaryotic purine/h+ symporter, uapa, in complex with xanthine 0.7553 18 410
ID Description Score Start End Superfamily
af_Q5A1D7_182_536_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7331 123 416 1.20.1730.10
af_Q6ZIE6_46_504_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.7166 30 413 1.20.1730.10
af_Q57772_21_432_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7145 30 416 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.693 28 405 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6837 28 405 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A519H1X3-F1-model_v4 Nitrate reductase 0.9182 207 434 GO:0005886
GO:0042907
AF-G8N0F6-F1-model_v4 deleted 0.9118 18 405
AF-C4RFI7-F1-model_v4 Uracil-xanthine permease 0.905 46 414 GO:0005886
GO:0042907
AF-H5TSD2-F1-model_v4 Putative uracil permease 0.9042 63 420 GO:0005886
GO:0042907
AF-A0A2G0VL75-F1-model_v4 Uracil transporter 0.902 27 405 GO:0005886
GO:0015205

Map