F322503

General Info

Members Datasets Scaffolds Average Seq Length
212 140 212 106

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100726806|Ga0070714_1007268062
Length 117
Sequence VVDRTYTDAELDAAIAAISEPQRLRAAQELVTRVAPTLQRVLALALEEGGWFDLGHAQAVAEAAGQEDPGERLREVETLLAEETRLGMLVGVAVGFQLARELGLEPSDMNETQQEDR

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 1.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0
Rhizoplane 5.66
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101357889 3300005337 Bacteria 606
2 Ga0068868_100428007 3300005338 Bacteria 1147
3 Ga0070709_10149328 3300005434 Bacteria 1614
4 Ga0070714_100085458 3300005435 Bacteria 2756
5 Ga0070714_100436202 3300005435 Bacteria 1243
6 Ga0070714_100489885 3300005435 Bacteria 1171
7 Ga0070714_100726806 3300005435 Bacteria 959
8 Ga0070713_100137771 3300005436 Bacteria 2158
9 Ga0070713_100144941 3300005436 Bacteria 2107
10 Ga0070710_10176531 3300005437 Bacteria 1335
11 Ga0070710_10941050 3300005437 Bacteria 626
12 Ga0070711_100044344 3300005439 Bacteria 3018
13 Ga0070681_10363619 3300005458 Bacteria 1357
14 Ga0068867_100662057 3300005459 Bacteria 917
15 Ga0068853_100083951 3300005539 Bacteria 2790
16 Ga0070696_100311227 3300005546 Bacteria 1209
17 Ga0070696_101084895 3300005546 Bacteria 672
18 Ga0070693_101132078 3300005547 Bacteria 598
19 Ga0068854_100818739 3300005578 Bacteria 813
20 Ga0068856_100009135 3300005614 Bacteria 9639
21 Ga0068866_10439659 3300005718 Bacteria 850
22 Ga0081538_10024048 3300005981 Bacteria 4353
23 Ga0081539_10085366 3300005985 Bacteria 1647
24 Ga0070717_10036497 3300006028 Bacteria 3986
25 Ga0070717_10037764 3300006028 Bacteria 3923
26 Ga0070717_10049169 3300006028 Bacteria 3461
27 Ga0070717_10479066 3300006028 Bacteria 1123
28 Ga0070717_10796444 3300006028 Bacteria 860
29 Ga0075365_10016268 3300006038 Bacteria 4520
30 Ga0075365_10929849 3300006038 Bacteria 613
31 Ga0070715_10000011 3300006163 Bacteria 183857
32 Ga0070716_100180402 3300006173 Bacteria 1386
33 Ga0070712_100260613 3300006175 Bacteria 1389
34 Ga0075428_100097503 3300006844 Bacteria 3205
35 Ga0075428_100221015 3300006844 Bacteria 2045
36 Ga0075430_100008624 3300006846 Bacteria 8600
37 Ga0075430_100088409 3300006846 Bacteria 2593
38 Ga0075430_100433531 3300006846 Bacteria 1085
39 Ga0075430_100471653 3300006846 Bacteria 1036
40 Ga0075431_100124064 3300006847 Bacteria 2665
41 Ga0068865_101099916 3300006881 Unclassified 700
42 Ga0111539_11454636 3300009094 Unclassified 795
43 Ga0111539_11631906 3300009094 Archaea 748
44 Ga0114129_10002380 3300009147 Bacteria 26121
45 Ga0114129_10102800 3300009147 Bacteria 3951
46 Ga0114129_12256941 3300009147 Bacteria 654
47 Ga0105249_11431652 3300009553 Unclassified 763
48 Ga0105246_10670329 3300011119 Bacteria 905
49 Ga0163163_10631257 3300014325 Unclassified 1135
50 Ga0163163_11577223 3300014325 Bacteria 718
51 Ga0157380_11308530 3300014326 Bacteria 772
52 Ga0197907_11397970 3300020069 Bacteria 674
53 Ga0206351_10890221 3300020077 Unclassified 562
54 Ga0206350_11414877 3300020080 Unclassified 789
55 Ga0224712_10125458 3300022467 Bacteria 1116
56 Ga0207692_10319636 3300025898 Bacteria 949
57 Ga0207692_10764019 3300025898 Bacteria 630
58 Ga0207685_10000001 3300025905 Bacteria 604473
59 Ga0207699_10241258 3300025906 Bacteria 1242
60 Ga0207707_10307446 3300025912 Bacteria 1370
61 Ga0207693_10031978 3300025915 Bacteria 4157
62 Ga0207693_10180578 3300025915 Bacteria 1660
63 Ga0207663_10595389 3300025916 Bacteria 868
64 Ga0207700_10372279 3300025928 Unclassified 1247
65 Ga0207700_10397878 3300025928 Bacteria 1207
66 Ga0207700_10409437 3300025928 Bacteria 1189
67 Ga0207664_10078344 3300025929 Bacteria 2680
68 Ga0207664_10085335 3300025929 Bacteria 2576
69 Ga0207664_10197963 3300025929 Bacteria 1733
70 Ga0207664_10724755 3300025929 Bacteria 894
71 Ga0207664_11077565 3300025929 Bacteria 719
72 Ga0207665_10306311 3300025939 Bacteria 1189
73 Ga0207712_10743938 3300025961 Unclassified 858
74 Ga0207712_11086747 3300025961 Unclassified 712
75 Ga0207640_10435133 3300025981 Bacteria 1077
76 Ga0207708_10880386 3300026075 Bacteria 774
77 Ga0307408_100088816 3300031548 Bacteria 2329
78 Ga0307405_10321096 3300031731 Bacteria 1183
79 Ga0307410_11332019 3300031852 Bacteria 629
80 Ga0307410_11530199 3300031852 Bacteria 588
81 Ga0307406_10012068 3300031901 Bacteria 4916
82 Ga0307406_11822619 3300031901 Unclassified 541
83 Ga0307409_100111521 3300031995 Bacteria 2295
84 Ga0307409_100213471 3300031995 Bacteria 1736
85 Ga0307409_100355987 3300031995 Unclassified 1383
86 Ga0307409_101847108 3300031995 Unclassified 633
87 Ga0307416_100128117 3300032002 Bacteria 2278
88 Ga0307416_100392542 3300032002 Bacteria 1422
89 Ga0307416_100773626 3300032002 Bacteria 1054
90 Ga0307416_102851929 3300032002 Bacteria 578
91 Ga0307416_102972321 3300032002 Bacteria 567
92 Ga0307411_10159313 3300032005 Bacteria 1688
93 Ga0307415_100082707 3300032126 Bacteria 2298
94 Ga0307415_100104701 3300032126 Bacteria 2085
95 Ga0307415_100275236 3300032126 Bacteria 1381
96 Ga0373954_0171690 3300035118 Bacteria 1062
97 Ga0373956_0207642 3300035119 Bacteria 929
98 Ga0373955_0011237 3300035172 Bacteria 4258
99 Ga0373947_0123180 3300035725 Bacteria 1649
100 Ga0395900_0608780 3300037418 Bacteria 1032
101 Ga0395898_0560362 3300037466 Bacteria 1085
102 Ga0436364_0410976 3300037853 Bacteria 704
103 Ga0436364_0513584 3300037853 Bacteria 44658
104 Ga0436364_1360660 3300037853 Bacteria 932
105 Ga0395901_1509685 3300038443 Bacteria 628
106 Ga0436365_1003737 3300039437 Bacteria 1099
107 Ga0436361_0417118 3300039447 Bacteria 1123
108 Ga0451802_2095845 3300041460 Bacteria 555
109 Ga0466969_0184227 3300044656 Bacteria 955
110 Ga0466965_0181083 3300044683 Bacteria 1112
111 Ga0466957_0455776 3300044842 Bacteria 882
112 Ga0466959_0222617 3300045049 Bacteria 1308
113 Ga0466958_0090250 3300045836 Bacteria 1896
114 Ga0466958_0093499 3300045836 Bacteria 1862
115 Ga0466958_0168398 3300045836 Bacteria 1387
116 Ga0466958_0187177 3300045836 Bacteria 1315
117 Ga0466967_0271585 3300045976 Bacteria 1625
118 Ga0466967_0285211 3300045976 Bacteria 1585
119 Ga0466967_0861123 3300045976 Bacteria 901
120 Ga0466967_2541530 3300045976 Bacteria 507
121 Ga0495592_0043418 3300046454 Bacteria 3364
122 Ga0495592_0147635 3300046454 Bacteria 1629
123 Ga0495629_0107597 3300046459 Bacteria 1945
124 Ga0495629_0140470 3300046459 Bacteria 1681
125 Ga0495629_1062199 3300046459 Bacteria 525
126 Ga0495641_0122061 3300046461 Unclassified 1162
127 Ga0495653_0170512 3300046463 Bacteria 1502
128 Ga0495664_0774748 3300046477 Bacteria 565
129 Ga0495608_0005958 3300046511 Bacteria 8668
130 Ga0495618_0066838 3300046514 Bacteria 2285
131 Ga0495628_0330003 3300046516 Bacteria 1124
132 Ga0495644_0353115 3300046523 Bacteria 579
133 Ga0495652_0456471 3300046529 Bacteria 893
134 Ga0495640_0321500 3300046533 Bacteria 958
135 Ga0495640_0626214 3300046533 Bacteria 649
136 Ga0495645_0034069 3300046543 Bacteria 3716
137 Ga0495645_0095315 3300046543 Bacteria 2122
138 Ga0495667_0134747 3300046559 Bacteria 1592
139 Ga0495668_0220933 3300046616 Unclassified 1037
140 Ga0495634_0243482 3300046642 Bacteria 1102
141 Ga0495634_0890948 3300046642 Bacteria 504
142 Ga0495635_0158275 3300046663 Bacteria 1541
143 Ga0495657_0064585 3300046675 Bacteria 2410
144 Ga0495646_0135317 3300046680 Bacteria 1383
145 Ga0495600_0151347 3300046809 Bacteria 1502
146 Ga0495660_0116522 3300046810 Bacteria 1357
147 Ga0495581_0230340 3300047315 Bacteria 1084
148 Ga0495680_0102881 3300047322 Bacteria 2126
149 Ga0495684_0117107 3300047471 Bacteria 2008
150 Ga0495602_0122797 3300048088 Bacteria 2086
151 Ga0496103_0657062 3300048906 Archaea 666
152 Ga0496104_0155305 3300048907 Bacteria 2196
153 Ga0496105_0081754 3300048908 Bacteria 2668
154 Ga0496107_0478568 3300048910 Bacteria 924
155 Ga0496108_0125230 3300048911 Bacteria 2206
156 Ga0496108_0311835 3300048911 Bacteria 1371
157 Ga0496109_0818198 3300048912 Bacteria 869
158 Ga0496112_0027736 3300048915 Bacteria 5461
159 Ga0496112_0136912 3300048915 Bacteria 2419
160 Ga0496113_0386348 3300048916 Bacteria 1123
161 Ga0496115_0148222 3300048918 Bacteria 1937
162 Ga0496116_0001127 3300048919 Bacteria 31841
163 Ga0496119_0001930 3300048922 Bacteria 23652
164 Ga0496125_0293467 3300048928 Bacteria 1000
165 Ga0501031_0036523 3300049568 Bacteria 3205
166 Ga0501032_0987976 3300049569 Bacteria 529
167 Ga0501033_0514232 3300049570 Bacteria 827
168 Ga0501037_1091094 3300049573 Bacteria 517
169 Ga0501042_0081941 3300049578 Bacteria 2313
170 Ga0501042_0127878 3300049578 Bacteria 1830
171 Ga0501068_0235553 3300049584 Bacteria 1165
172 Ga0501071_0348753 3300049587 Bacteria 1126
173 Ga0501071_1186562 3300049587 Bacteria 590
174 Ga0501072_0112880 3300049588 Bacteria 2163
175 Ga0501072_1291979 3300049588 Bacteria 566
176 Ga0501074_0740559 3300049590 Bacteria 693
177 Ga0501075_0157342 3300049591 Bacteria 1733
178 Ga0501076_0124575 3300049592 Bacteria 2087
179 Ga0501076_0319851 3300049592 Unclassified 1273
180 Ga0501077_0325038 3300049593 Bacteria 981
181 Ga0501079_0419055 3300049741 Bacteria 1051
182 Ga0501079_0859556 3300049741 Unclassified 714
183 Ga0501081_0889531 3300049743 Bacteria 671
184 Ga0501081_1095133 3300049743 Unclassified 603
185 Ga0501045_0047778 3300049824 Bacteria 3118
186 Ga0501045_0183447 3300049824 Bacteria 1559
187 nmdc:mga05p37_1981707_c1 3300050507 Bacteria 552
188 nmdc:mga05p37_6088_c1 3300050507 Bacteria 14205
189 nmdc:mga0qj67_1135868_c1 3300050509 Bacteria 609
190 nmdc:mga0qj67_34937_c1 3300050509 Bacteria 3929
191 nmdc:mga0qj67_685471_c1 3300050509 Bacteria 816
192 nmdc:mga06r32_180573_c1 3300050510 Bacteria 2096
193 nmdc:mga06r32_310128_c1 3300050510 Bacteria 1563
194 nmdc:mga08y16_1340281_c1 3300050511 Bacteria 681
195 nmdc:mga08y16_1421309_c1 3300050511 Bacteria 656
196 Ga0495601_0095713 3300053077 Archaea 1915
197 Ga0495601_0097680 3300053077 Bacteria 1895
198 Ga0495601_0172139 3300053077 Bacteria 1415
199 Ga0495612_0143484 3300053078 Bacteria 1037
200 Ga0495595_0071992 3300053084 Bacteria 1635
201 Ga0495619_0193577 3300053085 Bacteria 1407
202 Ga0495619_1143750 3300053085 Unclassified 517
203 Ga0500595_045144 3300053119 Bacteria 1393
204 Ga0500658_0072211 3300053134 Archaea 1459
205 Ga0500616_0011489 3300053153 Bacteria 5221
206 Ga0500599_004482 3300053736 Bacteria 1731
207 Ga0501084_0640778 3300054114 Unclassified 897
208 Ga0501082_0896580 3300060353 Bacteria 776
209 Ga0466962_0308333 3300061719 Bacteria 784
210 Ga0530510_0309101 3300061734 Bacteria 1184
211 Ga0530510_0386118 3300061734 Unclassified 1054
212 Ga0530510_0706246 3300061734 Bacteria 768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10372279 Ga0207700_103722792 76
2 3300006028 Ga0070717_10049169 Ga0070717_100491694 77
3 3300020069 Ga0197907_11397970 Ga0197907_113979702 77
4 3300020077 Ga0206351_10890221 Ga0206351_108902211 77
5 3300020080 Ga0206350_11414877 Ga0206350_114148772 77
6 3300022467 Ga0224712_10125458 Ga0224712_101254582 77
7 3300025929 Ga0207664_10197963 Ga0207664_101979632 77
8 3300045976 Ga0466967_0285211 Ga0466967_0285211_1159_1500 77
9 3300046477 Ga0495664_0774748 Ga0495664_0774748_29_379 77
10 3300006846 Ga0075430_100433531 Ga0075430_1004335312 78
11 3300053119 Ga0500595_045144 Ga0500595_045144_245_595 78
12 3300006028 Ga0070717_10036497 Ga0070717_100364972 79
13 3300025929 Ga0207664_10085335 Ga0207664_100853353 79
14 3300006038 Ga0075365_10016268 Ga0075365_100162682 80
15 3300006163 Ga0070715_10000011 Ga0070715_10000011158 80
16 3300025905 Ga0207685_10000001 Ga0207685_1000000129 80
17 3300048919 Ga0496116_0001127 Ga0496116_0001127_22575_22925 80
18 3300048922 Ga0496119_0001930 Ga0496119_0001930_14288_14638 80
19 3300053134 Ga0500658_0072211 Ga0500658_0072211_514_834 80
20 3300046642 Ga0495634_0890948 Ga0495634_0890948_42_368 81
21 3300005614 Ga0068856_100009135 Ga0068856_1000091358 85
22 3300039437 Ga0436365_1003737 Ga0436365_1003737_349_651 87
23 3300005547 Ga0070693_101132078 Ga0070693_1011320782 88
24 3300005578 Ga0068854_100818739 Ga0068854_1008187392 88
25 3300005718 Ga0068866_10439659 Ga0068866_104396592 88
26 3300005981 Ga0081538_10024048 Ga0081538_100240482 88
27 3300005985 Ga0081539_10085366 Ga0081539_100853662 88
28 3300006844 Ga0075428_100097503 Ga0075428_1000975034 88
29 3300006844 Ga0075428_100221015 Ga0075428_1002210152 88
30 3300006846 Ga0075430_100008624 Ga0075430_1000086249 88
31 3300006846 Ga0075430_100088409 Ga0075430_1000884094 88
32 3300006846 Ga0075430_100471653 Ga0075430_1004716532 88
33 3300006847 Ga0075431_100124064 Ga0075431_1001240642 88
34 3300009147 Ga0114129_10002380 Ga0114129_1000238012 88
35 3300009147 Ga0114129_10102800 Ga0114129_101028004 88
36 3300014326 Ga0157380_11308530 Ga0157380_113085302 88
37 3300025981 Ga0207640_10435133 Ga0207640_104351332 88
38 3300031548 Ga0307408_100088816 Ga0307408_1000888162 88
39 3300031852 Ga0307410_11530199 Ga0307410_115301992 88
40 3300031901 Ga0307406_10012068 Ga0307406_100120682 88
41 3300031901 Ga0307406_11822619 Ga0307406_118226191 88
42 3300031995 Ga0307409_100111521 Ga0307409_1001115212 88
43 3300031995 Ga0307409_100213471 Ga0307409_1002134712 88
44 3300031995 Ga0307409_100355987 Ga0307409_1003559872 88
45 3300032002 Ga0307416_100128117 Ga0307416_1001281174 88
46 3300032002 Ga0307416_100392542 Ga0307416_1003925421 88
47 3300032002 Ga0307416_100773626 Ga0307416_1007736262 88
48 3300032002 Ga0307416_102851929 Ga0307416_1028519291 88
49 3300032005 Ga0307411_10159313 Ga0307411_101593132 88
50 3300032126 Ga0307415_100082707 Ga0307415_1000827073 88
51 3300032126 Ga0307415_100104701 Ga0307415_1001047013 88
52 3300032126 Ga0307415_100275236 Ga0307415_1002752362 88
53 3300037418 Ga0395900_0608780 Ga0395900_0608780_176_499 88
54 3300037466 Ga0395898_0560362 Ga0395898_0560362_501_824 88
55 3300046523 Ga0495644_0353115 Ga0495644_0353115_240_563 88
56 3300046616 Ga0495668_0220933 Ga0495668_0220933_150_473 88
57 3300046810 Ga0495660_0116522 Ga0495660_0116522_607_930 88
58 3300049568 Ga0501031_0036523 Ga0501031_0036523_2845_3168 88
59 3300049569 Ga0501032_0987976 Ga0501032_0987976_99_422 88
60 3300049570 Ga0501033_0514232 Ga0501033_0514232_71_391 88
61 3300049573 Ga0501037_1091094 Ga0501037_1091094_92_412 88
62 3300049578 Ga0501042_0081941 Ga0501042_0081941_1500_1823 88
63 3300049578 Ga0501042_0127878 Ga0501042_0127878_662_982 88
64 3300049584 Ga0501068_0235553 Ga0501068_0235553_667_987 88
65 3300049587 Ga0501071_0348753 Ga0501071_0348753_346_666 88
66 3300049587 Ga0501071_1186562 Ga0501071_1186562_31_354 88
67 3300049588 Ga0501072_0112880 Ga0501072_0112880_680_1000 88
68 3300049590 Ga0501074_0740559 Ga0501074_0740559_31_351 88
69 3300049592 Ga0501076_0124575 Ga0501076_0124575_374_694 88
70 3300049741 Ga0501079_0859556 Ga0501079_0859556_352_675 88
71 3300049743 Ga0501081_0889531 Ga0501081_0889531_18_338 88
72 3300049824 Ga0501045_0047778 Ga0501045_0047778_2508_2828 88
73 3300049824 Ga0501045_0183447 Ga0501045_0183447_152_475 88
74 3300050507 nmdc:mga05p37_1981707_c1 nmdc:mga05p37_1981707_c1_180_503 88
75 3300050507 nmdc:mga05p37_6088_c1 nmdc:mga05p37_6088_c1_10580_10903 88
76 3300050509 nmdc:mga0qj67_1135868_c1 nmdc:mga0qj67_1135868_c1_169_492 88
77 3300050509 nmdc:mga0qj67_34937_c1 nmdc:mga0qj67_34937_c1_2939_3262 88
78 3300050509 nmdc:mga0qj67_685471_c1 nmdc:mga0qj67_685471_c1_422_745 88
79 3300050510 nmdc:mga06r32_180573_c1 nmdc:mga06r32_180573_c1_44_367 88
80 3300050510 nmdc:mga06r32_310128_c1 nmdc:mga06r32_310128_c1_787_1110 88
81 3300050511 nmdc:mga08y16_1340281_c1 nmdc:mga08y16_1340281_c1_265_588 88
82 3300054114 Ga0501084_0640778 Ga0501084_0640778_411_734 88
83 3300060353 Ga0501082_0896580 Ga0501082_0896580_193_513 88
84 3300061734 Ga0530510_0386118 Ga0530510_0386118_201_524 88
85 3300061734 Ga0530510_0706246 Ga0530510_0706246_94_414 88
86 3300005539 Ga0068853_100083951 Ga0068853_1000839513 89
87 3300006881 Ga0068865_101099916 Ga0068865_1010999162 89
88 3300026075 Ga0207708_10880386 Ga0207708_108803862 89
89 3300031731 Ga0307405_10321096 Ga0307405_103210962 89
90 3300031995 Ga0307409_101847108 Ga0307409_1018471082 89
91 3300032002 Ga0307416_102972321 Ga0307416_1029723212 89
92 3300005435 Ga0070714_100436202 Ga0070714_1004362022 90
93 3300006038 Ga0075365_10929849 Ga0075365_109298491 90
94 3300014325 Ga0163163_10631257 Ga0163163_106312572 90
95 3300025928 Ga0207700_10397878 Ga0207700_103978782 90
96 3300046454 Ga0495592_0147635 Ga0495592_0147635_254_583 90
97 3300046459 Ga0495629_0107597 Ga0495629_0107597_570_899 90
98 3300046461 Ga0495641_0122061 Ga0495641_0122061_258_587 90
99 3300046516 Ga0495628_0330003 Ga0495628_0330003_29_358 90
100 3300046543 Ga0495645_0034069 Ga0495645_0034069_2630_2959 90
101 3300048906 Ga0496103_0657062 Ga0496103_0657062_180_509 90
102 3300049591 Ga0501075_0157342 Ga0501075_0157342_1231_1560 90
103 3300049592 Ga0501076_0319851 Ga0501076_0319851_515_841 90
104 3300049593 Ga0501077_0325038 Ga0501077_0325038_598_924 90
105 3300049741 Ga0501079_0419055 Ga0501079_0419055_442_771 90
106 3300049743 Ga0501081_1095133 Ga0501081_1095133_139_465 90
107 3300053077 Ga0495601_0095713 Ga0495601_0095713_1304_1633 90
108 3300061734 Ga0530510_0309101 Ga0530510_0309101_441_767 90
109 3300009094 Ga0111539_11454636 Ga0111539_114546361 91
110 3300044683 Ga0466965_0181083 Ga0466965_0181083_330_659 92
111 3300045836 Ga0466958_0187177 Ga0466958_0187177_496_825 92
112 3300005338 Ga0068868_100428007 Ga0068868_1004280072 93
113 3300005435 Ga0070714_100085458 Ga0070714_1000854581 93
114 3300005436 Ga0070713_100144941 Ga0070713_1001449412 93
115 3300005458 Ga0070681_10363619 Ga0070681_103636191 93
116 3300005459 Ga0068867_100662057 Ga0068867_1006620572 93
117 3300005546 Ga0070696_100311227 Ga0070696_1003112272 93
118 3300005546 Ga0070696_101084895 Ga0070696_1010848951 93
119 3300006028 Ga0070717_10037764 Ga0070717_100377644 93
120 3300006028 Ga0070717_10796444 Ga0070717_107964442 93
121 3300006175 Ga0070712_100260613 Ga0070712_1002606132 93
122 3300009094 Ga0111539_11631906 Ga0111539_116319062 93
123 3300009553 Ga0105249_11431652 Ga0105249_114316522 93
124 3300025898 Ga0207692_10319636 Ga0207692_103196362 93
125 3300025912 Ga0207707_10307446 Ga0207707_103074463 93
126 3300025915 Ga0207693_10180578 Ga0207693_101805783 93
127 3300025929 Ga0207664_10078344 Ga0207664_100783441 93
128 3300025929 Ga0207664_11077565 Ga0207664_110775652 93
129 3300025961 Ga0207712_10743938 Ga0207712_107439382 93
130 3300025961 Ga0207712_11086747 Ga0207712_110867472 93
131 3300037853 Ga0436364_0410976 Ga0436364_0410976_69_422 93
132 3300037853 Ga0436364_0513584 Ga0436364_0513584_24173_24508 93
133 3300037853 Ga0436364_1360660 Ga0436364_1360660_372_725 93
134 3300039447 Ga0436361_0417118 Ga0436361_0417118_754_1101 93
135 3300041460 Ga0451802_2095845 Ga0451802_2095845_24_371 93
136 3300044656 Ga0466969_0184227 Ga0466969_0184227_61_390 93
137 3300044842 Ga0466957_0455776 Ga0466957_0455776_13_345 93
138 3300045049 Ga0466959_0222617 Ga0466959_0222617_947_1285 93
139 3300045836 Ga0466958_0090250 Ga0466958_0090250_1114_1467 93
140 3300045836 Ga0466958_0093499 Ga0466958_0093499_930_1262 93
141 3300045836 Ga0466958_0168398 Ga0466958_0168398_289_627 93
142 3300045976 Ga0466967_0271585 Ga0466967_0271585_808_1155 93
143 3300045976 Ga0466967_0861123 Ga0466967_0861123_435_788 93
144 3300045976 Ga0466967_2541530 Ga0466967_2541530_43_387 93
145 3300046459 Ga0495629_1062199 Ga0495629_1062199_20_376 93
146 3300046533 Ga0495640_0626214 Ga0495640_0626214_57_389 93
147 3300048928 Ga0496125_0293467 Ga0496125_0293467_48_389 93
148 3300049588 Ga0501072_1291979 Ga0501072_1291979_165_494 93
149 3300050511 nmdc:mga08y16_1421309_c1 nmdc:mga08y16_1421309_c1_153_482 93
150 3300053077 Ga0495601_0097680 Ga0495601_0097680_1057_1413 93
151 3300053078 Ga0495612_0143484 Ga0495612_0143484_230_562 93
152 3300053085 Ga0495619_1143750 Ga0495619_1143750_149_505 93
153 3300053153 Ga0500616_0011489 Ga0500616_0011489_3418_3744 93
154 3300053736 Ga0500599_004482 Ga0500599_004482_553_879 93
155 3300061719 Ga0466962_0308333 Ga0466962_0308333_136_474 93
156 3300005434 Ga0070709_10149328 Ga0070709_101493282 94
157 3300005435 Ga0070714_100489885 Ga0070714_1004898851 94
158 3300005435 Ga0070714_100726806 Ga0070714_1007268062 94
159 3300005436 Ga0070713_100137771 Ga0070713_1001377712 94
160 3300005437 Ga0070710_10176531 Ga0070710_101765313 94
161 3300005437 Ga0070710_10941050 Ga0070710_109410502 94
162 3300005439 Ga0070711_100044344 Ga0070711_1000443442 94
163 3300006028 Ga0070717_10479066 Ga0070717_104790662 94
164 3300006173 Ga0070716_100180402 Ga0070716_1001804022 94
165 3300025898 Ga0207692_10764019 Ga0207692_107640191 94
166 3300025906 Ga0207699_10241258 Ga0207699_102412582 94
167 3300025915 Ga0207693_10031978 Ga0207693_100319782 94
168 3300025916 Ga0207663_10595389 Ga0207663_105953892 94
169 3300025928 Ga0207700_10409437 Ga0207700_104094372 94
170 3300025929 Ga0207664_10724755 Ga0207664_107247552 94
171 3300025939 Ga0207665_10306311 Ga0207665_103063112 94
172 3300031852 Ga0307410_11332019 Ga0307410_113320192 94
173 3300035118 Ga0373954_0171690 Ga0373954_0171690_370_714 94
174 3300035119 Ga0373956_0207642 Ga0373956_0207642_355_699 94
175 3300035172 Ga0373955_0011237 Ga0373955_0011237_2555_2899 94
176 3300035725 Ga0373947_0123180 Ga0373947_0123180_744_1088 94
177 3300046454 Ga0495592_0043418 Ga0495592_0043418_1034_1378 94
178 3300046459 Ga0495629_0140470 Ga0495629_0140470_313_657 94
179 3300046463 Ga0495653_0170512 Ga0495653_0170512_683_1027 94
180 3300046511 Ga0495608_0005958 Ga0495608_0005958_5701_6045 94
181 3300046514 Ga0495618_0066838 Ga0495618_0066838_1921_2265 94
182 3300046529 Ga0495652_0456471 Ga0495652_0456471_477_821 94
183 3300046533 Ga0495640_0321500 Ga0495640_0321500_215_559 94
184 3300046543 Ga0495645_0095315 Ga0495645_0095315_1050_1394 94
185 3300046559 Ga0495667_0134747 Ga0495667_0134747_1110_1454 94
186 3300046642 Ga0495634_0243482 Ga0495634_0243482_725_1069 94
187 3300046663 Ga0495635_0158275 Ga0495635_0158275_626_970 94
188 3300046675 Ga0495657_0064585 Ga0495657_0064585_1501_1845 94
189 3300046680 Ga0495646_0135317 Ga0495646_0135317_777_1121 94
190 3300046809 Ga0495600_0151347 Ga0495600_0151347_93_437 94
191 3300047315 Ga0495581_0230340 Ga0495581_0230340_93_437 94
192 3300047322 Ga0495680_0102881 Ga0495680_0102881_787_1131 94
193 3300047471 Ga0495684_0117107 Ga0495684_0117107_737_1081 94
194 3300048088 Ga0495602_0122797 Ga0495602_0122797_955_1299 94
195 3300048907 Ga0496104_0155305 Ga0496104_0155305_870_1214 94
196 3300048908 Ga0496105_0081754 Ga0496105_0081754_1720_2064 94
197 3300048910 Ga0496107_0478568 Ga0496107_0478568_61_414 94
198 3300048911 Ga0496108_0311835 Ga0496108_0311835_570_914 94
199 3300048912 Ga0496109_0818198 Ga0496109_0818198_173_517 94
200 3300048915 Ga0496112_0027736 Ga0496112_0027736_1218_1562 94
201 3300048916 Ga0496113_0386348 Ga0496113_0386348_343_687 94
202 3300048918 Ga0496115_0148222 Ga0496115_0148222_1561_1905 94
203 3300053077 Ga0495601_0172139 Ga0495601_0172139_604_948 94
204 3300053084 Ga0495595_0071992 Ga0495595_0071992_23_367 94
205 3300053085 Ga0495619_0193577 Ga0495619_0193577_249_593 94
206 3300038443 Ga0395901_1509685 Ga0395901_1509685_95_430 96
207 3300048915 Ga0496112_0136912 Ga0496112_0136912_664_999 96
208 3300005337 Ga0070682_101357889 Ga0070682_1013578891 97
209 3300009147 Ga0114129_12256941 Ga0114129_122569412 97
210 3300011119 Ga0105246_10670329 Ga0105246_106703292 97
211 3300014325 Ga0163163_11577223 Ga0163163_115772231 97
212 3300048911 Ga0496108_0125230 Ga0496108_0125230_1296_1634 97

Feature Viewer

pLDDT pTM Quality
84.8 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map