F322865

General Info

Members Datasets Scaffolds Average Seq Length
212 138 424 295

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10105112|Ga0163163_101051122
Length 343
Sequence MPGKAFTPNPPISSFKQIGFSIKSRNFTNWRKFDYQSIVMISKSAINRRNFLLQSAVLFPGSLLAMQRLNEAPASKYRMGLQLFSIREPLSKDVVGTIKQVAAIGYEDCETYGYDPALVKYYGLKAADFKQLLTDHNLITTSGHYDFTTFFDKPDDDMMRYVDQCIEGAHVLGQKYITWPWLAPSFRTPDNFRLLTGKLNKIGERVNKANLGFAYHNHDYEFVDIGGQTAYNLIMHETDPALVKLQMDLYWVMHSSKLSPAQLIAQQPGRFVMWHIKDMDKNNRDYSELGNGSIDFTVILPEATHAGLQYYYIEQGGNFAKSPMQSVTDSAVYFKKNLEKYLR

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
89 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
90 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
110 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
111 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
112 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
113 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
116 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
117 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
118 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
119 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
120 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
121 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
122 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
123 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
124 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
127 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
128 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
137 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
138 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0
Rhizoplane 0
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 16.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10105112 3300014325 Bacteria 2849
2 rootH2_10258283 3300003320 Bacteria 1852
3 rootL2_10027096 3300003322 Bacteria 26101
4 rootL2_10059539 3300003322 Bacteria 17034
5 rootH1_10064508 3300003323 Bacteria 6081
6 rootH1_10105885 3300003323 Bacteria 4405
7 rootH1_10148193 3300003323 Bacteria 4872
8 JGI25160J50197_1007892 3300003354 Unclassified 4106
9 Ga0055531_10000362 3300003794 Bacteria 43910
10 Ga0065707_10150695 3300005295 Bacteria 1643
11 Ga0070676_10024060 3300005328 Bacteria 3428
12 Ga0070676_10044586 3300005328 Bacteria 2581
13 Ga0070676_10065854 3300005328 Bacteria 2164
14 Ga0070676_10209212 3300005328 Bacteria 1283
15 Ga0070676_10287861 3300005328 Bacteria 1109
16 Ga0070690_100320775 3300005330 Bacteria 1116
17 Ga0070670_100065741 3300005331 Bacteria 3112
18 Ga0070670_100172417 3300005331 Unclassified 1877
19 Ga0070677_10039303 3300005333 Bacteria 1856
20 Ga0070677_10054212 3300005333 Unclassified 1633
21 Ga0068869_100162306 3300005334 Unclassified 1740
22 Ga0070680_100227090 3300005336 Unclassified 1576
23 Ga0070682_100034719 3300005337 Bacteria 3073
24 Ga0070689_100148431 3300005340 Bacteria 1890
25 Ga0070687_100060654 3300005343 Bacteria 1996
26 Ga0070668_100044049 3300005347 Bacteria 3422
27 Ga0070668_100096320 3300005347 Bacteria 2339
28 Ga0070668_100328612 3300005347 Bacteria 1289
29 Ga0070669_100016721 3300005353 Bacteria 5236
30 Ga0070675_100028918 3300005354 Bacteria 4465
31 Ga0070675_100039599 3300005354 Unclassified 3846
32 Ga0070675_100474665 3300005354 Bacteria 1124
33 Ga0070671_100004651 3300005355 Bacteria 10884
34 Ga0070671_100054684 3300005355 Bacteria 3319
35 Ga0070673_100013881 3300005364 Bacteria 5592
36 Ga0070673_100291456 3300005364 Bacteria 1434
37 Ga0070673_100332547 3300005364 Bacteria 1344
38 Ga0070667_100136287 3300005367 Bacteria 2147
39 Ga0070667_100265866 3300005367 Bacteria 1537
40 Ga0070678_100009246 3300005456 Bacteria 5958
41 Ga0070678_100062686 3300005456 Bacteria 2746
42 Ga0070662_100014399 3300005457 Bacteria 5284
43 Ga0070662_100081161 3300005457 Bacteria 2415
44 Ga0068867_100013095 3300005459 Bacteria 5871
45 Ga0070672_100008728 3300005543 Bacteria 6957
46 Ga0070672_100011706 3300005543 Bacteria 6127
47 Ga0070686_100011924 3300005544 Bacteria 4942
48 Ga0070665_100008371 3300005548 Bacteria 10463
49 Ga0070665_100081723 3300005548 Bacteria 3236
50 Ga0070704_100314658 3300005549 Unclassified 1309
51 Ga0068859_100006050 3300005617 Bacteria 12284
52 Ga0068864_100388686 3300005618 Unclassified 1324
53 Ga0068864_100439293 3300005618 Bacteria 1246
54 Ga0068866_10032387 3300005718 Unclassified 2527
55 Ga0068861_100006156 3300005719 Bacteria 8161
56 Ga0068861_100010869 3300005719 Bacteria 6327
57 Ga0068861_100230277 3300005719 Bacteria 1571
58 Ga0068863_100028065 3300005841 Bacteria 5373
59 Ga0068862_100027843 3300005844 Bacteria 4760
60 Ga0068862_100368322 3300005844 Bacteria 1337
61 Ga0075362_10014123 3300006177 Bacteria 3217
62 Ga0097621_100002476 3300006237 Bacteria 12644
63 Ga0068871_100032849 3300006358 Unclassified 4103
64 Ga0097620_100006050 3300006931 Bacteria 12284
65 Ga0105240_10000083 3300009093 Bacteria 192934
66 Ga0111539_10004472 3300009094 Bacteria 18279
67 Ga0111539_10038087 3300009094 Bacteria 5801
68 Ga0111539_10753564 3300009094 Bacteria 1133
69 Ga0114129_10027927 3300009147 Bacteria 7990
70 Ga0114129_10704006 3300009147 Unclassified 1298
71 Ga0105241_10011702 3300009174 Bacteria 6442
72 Ga0105241_10044353 3300009174 Bacteria 3369
73 Ga0105241_10357493 3300009174 Unclassified 1270
74 Ga0105242_10047708 3300009176 Bacteria 3479
75 Ga0105237_10000198 3300009545 Bacteria 85302
76 Ga0105237_10263162 3300009545 Bacteria 1727
77 Ga0105249_10008981 3300009553 Bacteria 8731
78 Ga0105246_10006635 3300011119 Bacteria 7078
79 Ga0157378_10005392 3300013297 Bacteria 11214
80 Ga0157378_10005606 3300013297 Bacteria 10998
81 Ga0157378_10036977 3300013297 Bacteria 4322
82 Ga0157378_10191412 3300013297 Unclassified 1929
83 Ga0163162_10004562 3300013306 Bacteria 13346
84 Ga0163162_10405543 3300013306 Bacteria 1496
85 Ga0157375_10003632 3300013308 Bacteria 13383
86 Ga0157375_10016942 3300013308 Bacteria 6565
87 Ga0157375_10042020 3300013308 Bacteria 4421
88 Ga0157375_10190893 3300013308 Bacteria 2203
89 Ga0157375_10840028 3300013308 Unclassified 1065
90 Ga0163163_10000613 3300014325 Bacteria 30853
91 Ga0163163_10475737 3300014325 Bacteria 1310
92 Ga0157380_10008126 3300014326 Bacteria 7476
93 Ga0157380_10015558 3300014326 Bacteria 5593
94 Ga0157380_10025066 3300014326 Bacteria 4520
95 Ga0157380_10108164 3300014326 Bacteria 2330
96 Ga0157380_10172991 3300014326 Bacteria 1889
97 Ga0157377_10016106 3300014745 Bacteria 3839
98 Ga0157377_10167527 3300014745 Unclassified 1371
99 Ga0157379_10030448 3300014968 Bacteria 4804
100 Ga0157376_10002073 3300014969 Bacteria 13470
101 Ga0163161_10005910 3300017792 Bacteria 8485
102 Ga0163161_10068572 3300017792 Bacteria 2592
103 Ga0207426_1000019 3300025302 Bacteria 558579
104 Ga0209257_1000006 3300025304 Bacteria 1570111
105 Ga0207697_10042928 3300025315 Unclassified 1859
106 Ga0207682_10122634 3300025893 Unclassified 1154
107 Ga0207645_10000175 3300025907 Bacteria 51325
108 Ga0207645_10022688 3300025907 Bacteria 4080
109 Ga0207645_10257751 3300025907 Bacteria 1155
110 Ga0207654_10070424 3300025911 Bacteria 2076
111 Ga0207707_10025595 3300025912 Bacteria 5161
112 Ga0207695_10000127 3300025913 Bacteria 227338
113 Ga0207671_10000254 3300025914 Bacteria 79974
114 Ga0207652_10037525 3300025921 Bacteria 4101
115 Ga0207681_10013455 3300025923 Bacteria 5063
116 Ga0207681_10021691 3300025923 Bacteria 4087
117 Ga0207694_10190832 3300025924 Bacteria 1664
118 Ga0207650_10040418 3300025925 Bacteria 3413
119 Ga0207659_10139361 3300025926 Bacteria 1881
120 Ga0207644_10033806 3300025931 Unclassified 3576
121 Ga0207706_10071239 3300025933 Bacteria 3057
122 Ga0207670_10016466 3300025936 Bacteria 4443
123 Ga0207691_10018866 3300025940 Bacteria 6533
124 Ga0207691_10022680 3300025940 Bacteria 5919
125 Ga0207691_10148238 3300025940 Bacteria 2064
126 Ga0207689_10002588 3300025942 Bacteria 16745
127 Ga0207689_10031192 3300025942 Bacteria 4440
128 Ga0207689_10046255 3300025942 Bacteria 3596
129 Ga0207689_10090246 3300025942 Bacteria 2518
130 Ga0207651_10005840 3300025960 Bacteria 6362
131 Ga0207651_10010366 3300025960 Bacteria 5162
132 Ga0207651_10459187 3300025960 Bacteria 1094
133 Ga0207712_10011109 3300025961 Bacteria 5730
134 Ga0207641_10049784 3300026088 Unclassified 3542
135 Ga0207648_10001610 3300026089 Bacteria 24733
136 Ga0207648_10040624 3300026089 Bacteria 4087
137 Ga0207648_10081792 3300026089 Bacteria 2816
138 Ga0207648_10241356 3300026089 Bacteria 1609
139 Ga0207676_10303830 3300026095 Unclassified 1458
140 Ga0207676_10662812 3300026095 Bacteria 1008
141 Ga0207674_10013731 3300026116 Bacteria 8966
142 Ga0207675_100000580 3300026118 Bacteria 35745
143 Ga0207675_100006426 3300026118 Bacteria 11129
144 Ga0207675_100259547 3300026118 Bacteria 1683
145 Ga0207683_10000494 3300026121 Bacteria 36475
146 Ga0207683_10186353 3300026121 Bacteria 1883
147 Ga0207428_10025062 3300027907 Bacteria 4996
148 Ga0268266_10049111 3300028379 Bacteria 3617
149 Ga0268266_10365726 3300028379 Bacteria 1358
150 Ga0268265_10023469 3300028380 Bacteria 4348
151 Ga0268264_10077203 3300028381 Bacteria 2836
152 Ga0307515_10121712 3300028794 Bacteria 2950
153 Ga0316177_1204591 3300030731 Bacteria 7704
154 Ga0316176_1032942 3300030732 Bacteria 7820
155 Ga0316183_1037277 3300030742 Bacteria 60977
156 Ga0316181_1123353 3300030744 Bacteria 27179
157 Ga0307513_10099467 3300031456 Bacteria 2936
158 Ga0307408_100005459 3300031548 Bacteria 8508
159 Ga0307409_100067402 3300031995 Bacteria 2826
160 Ga0307409_100537628 3300031995 Unclassified 1145
161 Ga0307414_10000017 3300032004 Bacteria 247306
162 Ga0307414_10097100 3300032004 Unclassified 2206
163 Ga0307414_10151558 3300032004 Bacteria 1830
164 Ga0307414_10278325 3300032004 Bacteria 1405
165 Ga0307411_10033338 3300032005 Bacteria 3193
166 Ga0307415_100131230 3300032126 Unclassified 1897
167 Ga0373949_0073678 3300035090 Unclassified 899
168 Ga0395899_0000011 3300037312 Bacteria 521331
169 Ga0451837_0125060 3300041494 Bacteria 1311
170 Ga0439431_0027216 3300041997 Unclassified 1404
171 Ga0439457_010159 3300042014 Bacteria 2172
172 Ga0439434_0030975 3300042435 Bacteria 1625
173 Ga0495650_0040559 3300046471 Bacteria 1997
174 Ga0495580_0215615 3300046472 Unclassified 1320
175 Ga0495625_0166898 3300046660 Unclassified 1471
176 Ga0495625_0234171 3300046660 Unclassified 1198
177 Ga0495672_0025199 3300047320 Bacteria 3814
178 Ga0495686_0268838 3300047472 Unclassified 952
179 Ga0501298_008437 3300049521 Unclassified 1731
180 Ga0501198_002596 3300049649 Bacteria 2438
181 Ga0501202_000138 3300049652 Bacteria 8541
182 Ga0501207_002393 3300049654 Bacteria 2419
183 Ga0501210_001472 3300049657 Bacteria 1347
184 Ga0501217_007855 3300049661 Bacteria 2294
185 Ga0501223_017127 3300049663 Bacteria 1430
186 Ga0501224_011636 3300049664 Unclassified 1294
187 Ga0501228_005620 3300049666 Bacteria 1116
188 Ga0501233_032870 3300049668 Bacteria 1182
189 Ga0501240_005033 3300049673 Unclassified 1563
190 Ga0501242_001251 3300049674 Bacteria 2506
191 Ga0501251_003904 3300049681 Bacteria 1515
192 Ga0501257_010408 3300049686 Unclassified 2110
193 Ga0501259_002057 3300049688 Bacteria 3321
194 Ga0501221_013192 3300049704 Bacteria 1516
195 Ga0501225_0019366 3300049705 Unclassified 1883
196 Ga0501234_008263 3300049707 Unclassified 1625
197 Ga0501264_000431 3300049761 Bacteria 6467
198 Ga0501271_010102 3300049768 Bacteria 991
199 nmdc:mga03683_15562_c1 3300050489 Bacteria 2841
200 nmdc:mga05p37_19562_c1 3300050507 Bacteria 8191
201 nmdc:mga08y16_130223_c1 3300050511 Bacteria 2617
202 nmdc:mga08y16_3369_c1 3300050511 Bacteria 16568
203 nmdc:mga08y16_34719_c1 3300050511 Bacteria 5299
204 nmdc:mga0a205_285726_c1 3300050515 Unclassified 1525
205 Ga0500604_0015616 3300053151 Bacteria 2082
206 Ga0500616_0023457 3300053153 Bacteria 3437
207 Ga0500622_0000004 3300053156 Bacteria 557587
208 Ga0500622_0000005 3300053156 Bacteria 502443
209 Ga0500622_0003546 3300053156 Bacteria 10332
210 Ga0500611_000001 3300053727 Bacteria 385744
211 2842905166 2842903701 Bacteria 6986368
212 2896114928 2896109856 Bacteria 7140722
213 Ga0163163_10105112
214 rootH2_10258283
215 rootL2_10027096
216 rootL2_10059539
217 rootH1_10064508
218 rootH1_10105885
219 rootH1_10148193
220 JGI25160J50197_1007892
221 Ga0055531_10000362
222 Ga0065707_10150695
223 Ga0070676_10024060
224 Ga0070676_10044586
225 Ga0070676_10065854
226 Ga0070676_10209212
227 Ga0070676_10287861
228 Ga0070690_100320775
229 Ga0070670_100065741
230 Ga0070670_100172417
231 Ga0070677_10039303
232 Ga0070677_10054212
233 Ga0068869_100162306
234 Ga0070680_100227090
235 Ga0070682_100034719
236 Ga0070689_100148431
237 Ga0070687_100060654
238 Ga0070668_100044049
239 Ga0070668_100096320
240 Ga0070668_100328612
241 Ga0070669_100016721
242 Ga0070675_100028918
243 Ga0070675_100039599
244 Ga0070675_100474665
245 Ga0070671_100004651
246 Ga0070671_100054684
247 Ga0070673_100013881
248 Ga0070673_100291456
249 Ga0070673_100332547
250 Ga0070667_100136287
251 Ga0070667_100265866
252 Ga0070678_100009246
253 Ga0070678_100062686
254 Ga0070662_100014399
255 Ga0070662_100081161
256 Ga0068867_100013095
257 Ga0070672_100008728
258 Ga0070672_100011706
259 Ga0070686_100011924
260 Ga0070665_100008371
261 Ga0070665_100081723
262 Ga0070704_100314658
263 Ga0068859_100006050
264 Ga0068864_100388686
265 Ga0068864_100439293
266 Ga0068866_10032387
267 Ga0068861_100006156
268 Ga0068861_100010869
269 Ga0068861_100230277
270 Ga0068863_100028065
271 Ga0068862_100027843
272 Ga0068862_100368322
273 Ga0075362_10014123
274 Ga0097621_100002476
275 Ga0068871_100032849
276 Ga0097620_100006050
277 Ga0105240_10000083
278 Ga0111539_10004472
279 Ga0111539_10038087
280 Ga0111539_10753564
281 Ga0114129_10027927
282 Ga0114129_10704006
283 Ga0105241_10011702
284 Ga0105241_10044353
285 Ga0105241_10357493
286 Ga0105242_10047708
287 Ga0105237_10000198
288 Ga0105237_10263162
289 Ga0105249_10008981
290 Ga0105246_10006635
291 Ga0157378_10005392
292 Ga0157378_10005606
293 Ga0157378_10036977
294 Ga0157378_10191412
295 Ga0163162_10004562
296 Ga0163162_10405543
297 Ga0157375_10003632
298 Ga0157375_10016942
299 Ga0157375_10042020
300 Ga0157375_10190893
301 Ga0157375_10840028
302 Ga0163163_10000613
303 Ga0163163_10475737
304 Ga0157380_10008126
305 Ga0157380_10015558
306 Ga0157380_10025066
307 Ga0157380_10108164
308 Ga0157380_10172991
309 Ga0157377_10016106
310 Ga0157377_10167527
311 Ga0157379_10030448
312 Ga0157376_10002073
313 Ga0163161_10005910
314 Ga0163161_10068572
315 Ga0207426_1000019
316 Ga0209257_1000006
317 Ga0207697_10042928
318 Ga0207682_10122634
319 Ga0207645_10000175
320 Ga0207645_10022688
321 Ga0207645_10257751
322 Ga0207654_10070424
323 Ga0207707_10025595
324 Ga0207695_10000127
325 Ga0207671_10000254
326 Ga0207652_10037525
327 Ga0207681_10013455
328 Ga0207681_10021691
329 Ga0207694_10190832
330 Ga0207650_10040418
331 Ga0207659_10139361
332 Ga0207644_10033806
333 Ga0207706_10071239
334 Ga0207670_10016466
335 Ga0207691_10018866
336 Ga0207691_10022680
337 Ga0207691_10148238
338 Ga0207689_10002588
339 Ga0207689_10031192
340 Ga0207689_10046255
341 Ga0207689_10090246
342 Ga0207651_10005840
343 Ga0207651_10010366
344 Ga0207651_10459187
345 Ga0207712_10011109
346 Ga0207641_10049784
347 Ga0207648_10001610
348 Ga0207648_10040624
349 Ga0207648_10081792
350 Ga0207648_10241356
351 Ga0207676_10303830
352 Ga0207676_10662812
353 Ga0207674_10013731
354 Ga0207675_100000580
355 Ga0207675_100006426
356 Ga0207675_100259547
357 Ga0207683_10000494
358 Ga0207683_10186353
359 Ga0207428_10025062
360 Ga0268266_10049111
361 Ga0268266_10365726
362 Ga0268265_10023469
363 Ga0268264_10077203
364 Ga0307515_10121712
365 Ga0316177_1204591
366 Ga0316176_1032942
367 Ga0316183_1037277
368 Ga0316181_1123353
369 Ga0307513_10099467
370 Ga0307408_100005459
371 Ga0307409_100067402
372 Ga0307409_100537628
373 Ga0307414_10000017
374 Ga0307414_10097100
375 Ga0307414_10151558
376 Ga0307414_10278325
377 Ga0307411_10033338
378 Ga0307415_100131230
379 Ga0373949_0073678
380 Ga0395899_0000011
381 Ga0451837_0125060
382 Ga0439431_0027216
383 Ga0439457_010159
384 Ga0439434_0030975
385 Ga0495650_0040559
386 Ga0495580_0215615
387 Ga0495625_0166898
388 Ga0495625_0234171
389 Ga0495672_0025199
390 Ga0495686_0268838
391 Ga0501298_008437
392 Ga0501198_002596
393 Ga0501202_000138
394 Ga0501207_002393
395 Ga0501210_001472
396 Ga0501217_007855
397 Ga0501223_017127
398 Ga0501224_011636
399 Ga0501228_005620
400 Ga0501233_032870
401 Ga0501240_005033
402 Ga0501242_001251
403 Ga0501251_003904
404 Ga0501257_010408
405 Ga0501259_002057
406 Ga0501221_013192
407 Ga0501225_0019366
408 Ga0501234_008263
409 Ga0501264_000431
410 Ga0501271_010102
411 nmdc:mga03683_15562_c1
412 nmdc:mga05p37_19562_c1
413 nmdc:mga08y16_130223_c1
414 nmdc:mga08y16_3369_c1
415 nmdc:mga08y16_34719_c1
416 nmdc:mga0a205_285726_c1
417 Ga0500604_0015616
418 Ga0500616_0023457
419 Ga0500622_0000004
420 Ga0500622_0000005
421 Ga0500622_0003546
422 Ga0500611_000001
423 2842905166
424 2896114928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

98

317

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8764 35 272
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.873 36 297
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8617 32 297
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8536 35 272
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8321 35 297
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8153 36 297 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7963 36 297 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7849 36 297 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7816 35 296 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7711 36 297 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A5C8V5I7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9867 37 300 GO:0016853
AF-A0A5C8V5I7-F1-model_v4 Sugar phosphate isomerase/epimerase 0.983 37 300 GO:0016853
AF-A0A844N7L7-F1-model_v4 deleted 0.9774 24 300
AF-A0A2E7FD66-F1-model_v4 Xylose isomerase 0.9729 48 280 GO:0016853
AF-A0A2E7FD66-F1-model_v4 Xylose isomerase 0.9689 48 280 GO:0016853

Map