F322982

General Info

Members Datasets Scaffolds Average Seq Length
212 158 169 230

Family's Representative Sequence

Representative Sequence 3300030522|Ga0307512_10025992|Ga0307512_100259923
Length 258
Sequence MTDKARKRAAGDRVGRMTSPSEAPEETRSAVPYGTPAAPRIAVRGEAHLEVDPEIARIGITVSARGTDRRDALTDLTRRNATALDLVKTYGDAVERLETGAFSITPELTKHGRGERIRAYHGRVHITAELTDFTALGELTTRLADLDLTRVDGPWWALRPDSPAHRRARQQAVREXXXXAREYAEALGTTLAALVELADIGAENAHPYGMEAQAARSMRTMAFDASAPEGAPALDLEPERQHVYAQVNARFTMAPPEL

Samples

Sample ID Description Type Environment
1 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
5 2643221647 Streptomyces sp. Root369 Isolate Unclassified
6 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
7 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
8 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
9 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
10 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
11 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
12 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
13 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
14 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
17 2862574272 Streptomyces sp. AcE210 Isolate Nodule
18 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
19 2867369537 Streptomyces sp. Z26 Isolate Unclassified
20 2867428634 Streptomyces sp. RP5T Isolate Unclassified
21 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
22 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
23 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
24 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
25 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
26 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
27 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
28 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
29 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
30 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
31 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
32 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
33 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
34 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
35 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
36 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
37 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
38 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
50 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
60 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
65 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
66 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
67 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
68 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
155 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
156 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
157 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
158 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.72
Metatranscriptomes 0
Isolates 20.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 1.42
Rhizoplane 0.47
Rhizosphere 80.19
Stem 0
Stem Tuber 0
Unclassified 17.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100406989 3300005577 Bacteria 1267
2 Ga0075370_10077718 3300006353 Bacteria 1905
3 Ga0105246_10005332 3300011119 Bacteria 7828
4 Ga0182008_10007297 3300014497 Bacteria 6114
5 Ga0182007_10010356 3300015262 Bacteria 3691
6 Ga0182005_1056074 3300015265 Bacteria 1074
7 Ga0183367_1007 3300015688 Bacteria 498079
8 Ga0307517_10004661 3300028786 Bacteria 21021
9 Ga0307515_10008399 3300028794 Bacteria 20135
10 Ga0268256_1028028 3300030500 Bacteria 1396
11 Ga0307511_10006903 3300030521 Bacteria 11443
12 Ga0307512_10025992 3300030522 Bacteria 5174
13 Ga0307512_10090463 3300030522 Bacteria 2134
14 Ga0307513_10010653 3300031456 Bacteria 11501
15 Ga0307513_10054765 3300031456 Bacteria 4274
16 Ga0307509_10059779 3300031507 Bacteria 4031
17 Ga0307508_10103896 3300031616 Bacteria 2438
18 Ga0307514_10006436 3300031649 Bacteria 10241
19 Ga0307514_10096959 3300031649 Bacteria 2129
20 Ga0307514_10156028 3300031649 Bacteria 1521
21 Ga0307518_10128028 3300031838 Bacteria 1788
22 Ga0307518_10371091 3300031838 Bacteria 819
23 Ga0307507_10026673 3300033179 Bacteria 6216
24 Ga0307507_10029004 3300033179 Bacteria 5879
25 Ga0307507_10098646 3300033179 Bacteria 2458
26 Ga0395900_0435956 3300037418 Bacteria 1269
27 Ga0395898_0031019 3300037466 Bacteria 5346
28 Ga0439436_0000670 3300041404 Bacteria 9171
29 Ga0439436_0003098 3300041404 Bacteria 5041
30 Ga0439439_0010476 3300041406 Bacteria 2217
31 Ga0451802_0505829 3300041460 Bacteria 2665
32 Ga0451837_0250012 3300041494 Bacteria 1778
33 Ga0451853_0188415 3300041512 Bacteria 5439
34 Ga0451853_0884962 3300041512 Bacteria 6618
35 Ga0451853_1309389 3300041512 Bacteria 2928
36 Ga0439433_0007562 3300041999 Bacteria 2347
37 Ga0439442_018832 3300042002 Bacteria 1428
38 Ga0439449_0029831 3300042007 Bacteria 2032
39 Ga0439457_000095 3300042014 Bacteria 20373
40 Ga0439457_005204 3300042014 Bacteria 3299
41 Ga0450894_001863 3300042131 Bacteria 2923
42 Ga0450903_000250 3300042138 Bacteria 11984
43 Ga0439458_0000561 3300042157 Bacteria 9548
44 Ga0439458_0036446 3300042157 Bacteria 1184
45 Ga0439458_0063577 3300042157 Bacteria 924
46 Ga0466972_0004856 3300044658 Bacteria 6742
47 Ga0466972_0006937 3300044658 Bacteria 5681
48 Ga0466965_0004668 3300044683 Bacteria 6109
49 Ga0466966_0004300 3300044684 Bacteria 9395
50 Ga0466961_0009387 3300044693 Bacteria 6233
51 Ga0466961_0225760 3300044693 Bacteria 1153
52 Ga0466963_0034068 3300044694 Bacteria 3312
53 Ga0466964_0007660 3300044706 Bacteria 4040
54 Ga0466971_0000186 3300044719 Bacteria 23665
55 Ga0466970_0007499 3300044765 Bacteria 5473
56 Ga0466957_0000142 3300044842 Bacteria 30899
57 Ga0466960_0023559 3300044901 Bacteria 2765
58 Ga0466958_0003556 3300045836 Bacteria 8107
59 Ga0495617_003689 3300046452 Bacteria 5709
60 Ga0495627_030305 3300046453 Bacteria 1715
61 Ga0495592_0019923 3300046454 Bacteria 5100
62 Ga0495603_0010991 3300046455 Bacteria 5491
63 Ga0495603_0012364 3300046455 Bacteria 5168
64 Ga0495603_0136480 3300046455 Bacteria 1427
65 Ga0495629_0014844 3300046459 Bacteria 5603
66 Ga0495629_0041709 3300046459 Bacteria 3228
67 Ga0495629_0068956 3300046459 Bacteria 2467
68 Ga0495638_0083825 3300046460 Bacteria 1930
69 Ga0495651_0030801 3300046462 Bacteria 4183
70 Ga0495580_0219295 3300046472 Bacteria 1307
71 Ga0495605_0017637 3300046474 Bacteria 3839
72 Ga0495662_0010614 3300046476 Bacteria 4505
73 Ga0495662_0052980 3300046476 Bacteria 1959
74 Ga0495664_0001685 3300046477 Bacteria 11752
75 Ga0495585_0156202 3300046492 Bacteria 1186
76 Ga0495594_0048905 3300046499 Bacteria 2323
77 Ga0495594_0086156 3300046499 Bacteria 1757
78 Ga0495594_0108694 3300046499 Bacteria 1563
79 Ga0495607_0004800 3300046501 Bacteria 9863
80 Ga0495583_0157755 3300046506 Bacteria 937
81 Ga0495606_0048375 3300046507 Bacteria 2797
82 Ga0495608_0064683 3300046511 Bacteria 2397
83 Ga0495610_0036901 3300046512 Bacteria 2493
84 Ga0495616_0020840 3300046513 Bacteria 3560
85 Ga0495618_0055187 3300046514 Bacteria 2515
86 Ga0495620_0083260 3300046515 Bacteria 1291
87 Ga0495620_0123797 3300046515 Bacteria 1017
88 Ga0495628_0169583 3300046516 Bacteria 1655
89 Ga0495628_0206531 3300046516 Bacteria 1478
90 Ga0495630_0043404 3300046517 Bacteria 3359
91 Ga0495631_0002506 3300046518 Bacteria 10336
92 Ga0495643_0005293 3300046522 Bacteria 8762
93 Ga0495644_0049228 3300046523 Bacteria 1582
94 Ga0495648_0140037 3300046524 Bacteria 1274
95 Ga0495648_0190382 3300046524 Bacteria 1035
96 Ga0495652_0096039 3300046529 Bacteria 2414
97 Ga0495640_0022236 3300046533 Bacteria 4639
98 Ga0495645_0179033 3300046543 Bacteria 1454
99 Ga0495645_0263367 3300046543 Bacteria 1140
100 Ga0495622_0023090 3300046557 Bacteria 2899
101 Ga0495622_0063137 3300046557 Bacteria 1714
102 Ga0495633_0043120 3300046558 Bacteria 2140
103 Ga0495634_0013918 3300046642 Bacteria 5813
104 Ga0495634_0279374 3300046642 Bacteria 1014
105 Ga0495611_0042220 3300046648 Bacteria 2036
106 Ga0495611_0047229 3300046648 Bacteria 1931
107 Ga0495625_0012343 3300046660 Bacteria 6927
108 Ga0495625_0131110 3300046660 Bacteria 1698
109 Ga0495635_0002533 3300046663 Bacteria 12500
110 Ga0495588_0003495 3300046674 Bacteria 6848
111 Ga0495657_0009254 3300046675 Bacteria 7477
112 Ga0495599_0106017 3300046678 Bacteria 1751
113 Ga0495599_0151553 3300046678 Bacteria 1436
114 Ga0495646_0015021 3300046680 Bacteria 4918
115 Ga0495646_0031890 3300046680 Bacteria 3281
116 Ga0495613_0054339 3300046689 Bacteria 2944
117 Ga0495613_0105545 3300046689 Bacteria 2033
118 Ga0495624_0029814 3300046690 Bacteria 3556
119 Ga0495624_0249906 3300046690 Bacteria 1072
120 Ga0495671_0003017 3300046692 Bacteria 10466
121 Ga0495671_0111516 3300046692 Bacteria 1336
122 Ga0495649_0074258 3300046694 Bacteria 1821
123 Ga0495589_0060231 3300046794 Bacteria 1864
124 Ga0495589_0124933 3300046794 Bacteria 1237
125 Ga0495589_0157513 3300046794 Bacteria 1082
126 Ga0495589_0167189 3300046794 Bacteria 1046
127 Ga0495600_0064691 3300046809 Bacteria 2390
128 Ga0495600_0157390 3300046809 Bacteria 1469
129 Ga0495660_0081925 3300046810 Bacteria 1690
130 Ga0495660_0156618 3300046810 Bacteria 1120
131 Ga0495604_0000463 3300047317 Bacteria 36017
132 Ga0495636_0004615 3300047318 Bacteria 5403
133 Ga0495636_0049670 3300047318 Bacteria 1754
134 Ga0495674_0030398 3300047319 Bacteria 4911
135 Ga0495672_0029267 3300047320 Bacteria 3472
136 Ga0495676_0001882 3300047321 Bacteria 18410
137 Ga0495676_0037684 3300047321 Bacteria 4021
138 Ga0495676_0044022 3300047321 Bacteria 3647
139 Ga0495680_0166087 3300047322 Bacteria 1600
140 Ga0495683_0182439 3300047323 Bacteria 957
141 Ga0495687_003207 3300047443 Bacteria 12119
142 Ga0495687_008019 3300047443 Bacteria 6109
143 Ga0495687_064976 3300047443 Bacteria 1487
144 Ga0495687_106732 3300047443 Bacteria 1038
145 Ga0495687_110960 3300047443 Bacteria 1008
146 Ga0495675_0111160 3300047444 Bacteria 1710
147 Ga0495685_011434 3300047447 Bacteria 2994
148 Ga0495685_033774 3300047447 Bacteria 1757
149 Ga0495685_040431 3300047447 Bacteria 1595
150 Ga0495685_064079 3300047447 Bacteria 1236
151 Ga0495681_0009883 3300047470 Bacteria 5831
152 Ga0495593_0018894 3300047673 Bacteria 3867
153 Ga0495602_0004050 3300048088 Bacteria 15267
154 Ga0495614_0047870 3300048089 Bacteria 1833
155 Ga0495614_0104357 3300048089 Bacteria 1241
156 Ga0495614_0134358 3300048089 Bacteria 1096
157 Ga0495626_0055764 3300048091 Bacteria 1810
158 Ga0495682_0005566 3300049460 Bacteria 5214
159 Ga0501031_0111094 3300049568 Bacteria 1790
160 Ga0501034_0246789 3300049571 Bacteria 1730
161 Ga0501038_0014466 3300049574 Bacteria 7191
162 Ga0501043_0070358 3300049579 Bacteria 2748
163 Ga0501047_0023473 3300049581 Bacteria 5921
164 Ga0501047_0225385 3300049581 Bacteria 1729
165 Ga0501080_0203130 3300049742 Bacteria 1819
166 Ga0501035_0040233 3300049822 Bacteria 4226
167 Ga0501044_0014797 3300049823 Bacteria 8411
168 Ga0501044_0155021 3300049823 Bacteria 2270
169 Ga0466962_0003371 3300061719 Bacteria 7603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0006937 Ga0466972_0006937_1051_1776 205
2 3300044683 Ga0466965_0004668 Ga0466965_0004668_3733_4458 205
3 3300044693 Ga0466961_0009387 Ga0466961_0009387_4661_5386 205
4 3300044765 Ga0466970_0007499 Ga0466970_0007499_926_1651 205
5 3300044901 Ga0466960_0023559 Ga0466960_0023559_1919_2632 209
6 3300031456 Ga0307513_10010653 Ga0307513_100106539 210
7 3300031649 Ga0307514_10096959 Ga0307514_100969592 210
8 3300037466 Ga0395898_0031019 Ga0395898_0031019_3725_4444 211
9 3300041512 Ga0451853_1309389 Ga0451853_1309389_1305_2030 211
10 iso_pu_bacteria 8054160619 8054163556 211
11 3300044684 Ga0466966_0004300 Ga0466966_0004300_1209_1928 212
12 3300044693 Ga0466961_0225760 Ga0466961_0225760_257_976 212
13 iso_pu_bacteria 2784746768 2785367820 213
14 iso_pu_bacteria 2811994917 2812481815 213
15 iso_pu_bacteria 2862178590 2862183084 213
16 iso_pu_bacteria 2867428634 2867432387 213
17 iso_pu_bacteria 2877676314 2877682738 213
18 iso_pu_bacteria 2954380949 2954387931 213
19 iso_pu_bacteria 2954691527 2954698741 213
20 iso_pu_bacteria 2954701450 2954703481 213
21 iso_pu_bacteria 3006486233 3006492267 213
22 iso_pu_bacteria 2912757875 2912759397 214
23 3300006353 Ga0075370_10077718 Ga0075370_100777182 215
24 3300042157 Ga0439458_0036446 Ga0439458_0036446_304_1011 215
25 3300046460 Ga0495638_0083825 Ga0495638_0083825_296_1021 215
26 3300046476 Ga0495662_0052980 Ga0495662_0052980_180_914 215
27 3300046543 Ga0495645_0179033 Ga0495645_0179033_505_1239 215
28 3300046660 Ga0495625_0131110 Ga0495625_0131110_779_1474 215
29 3300046689 Ga0495613_0054339 Ga0495613_0054339_1219_1953 215
30 3300046809 Ga0495600_0157390 Ga0495600_0157390_192_926 215
31 3300047443 Ga0495687_110960 Ga0495687_110960_16_717 215
32 3300047447 Ga0495685_011434 Ga0495685_011434_376_1071 215
33 iso_pu_bacteria 2616644941 2616899310 215
34 iso_pu_bacteria 3006393351 3006396041 215
35 iso_pu_bacteria 8025530807 8025535491 215
36 3300031649 Ga0307514_10006436 Ga0307514_100064365 216
37 3300037418 Ga0395900_0435956 Ga0395900_0435956_344_1060 216
38 3300042157 Ga0439458_0063577 Ga0439458_0063577_68_754 216
39 iso_pu_bacteria 2582581313 2585306682 216
40 iso_pu_bacteria 2643221647 2644270999 216
41 iso_pu_bacteria 8056667051 8056667671 216
42 3300030500 Ga0268256_1028028 Ga0268256_10280282 217
43 3300041460 Ga0451802_0505829 Ga0451802_0505829_1809_2525 217
44 3300047321 Ga0495676_0037684 Ga0495676_0037684_2799_3509 217
45 iso_pu_bacteria 2808606982 2811847482 217
46 iso_pu_bacteria 8048406513 8048410008 217
47 3300041494 Ga0451837_0250012 Ga0451837_0250012_451_1170 218
48 3300041512 Ga0451853_0188415 Ga0451853_0188415_2718_3437 218
49 iso_pu_bacteria 2784746763 2785345063 218
50 iso_pu_bacteria 2862574272 2862583088 218
51 iso_pu_bacteria 2867369537 2867370521 218
52 iso_pu_bacteria 2873151551 2873157133 218
53 iso_pu_bacteria 2919468124 2919473078 218
54 3300041512 Ga0451853_0884962 Ga0451853_0884962_3230_3931 219
55 3300042138 Ga0450903_000250 Ga0450903_000250_1080_1772 219
56 3300042157 Ga0439458_0000561 Ga0439458_0000561_6489_7181 219
57 3300044706 Ga0466964_0007660 Ga0466964_0007660_964_1689 219
58 3300044719 Ga0466971_0000186 Ga0466971_0000186_16576_17301 219
59 3300044842 Ga0466957_0000142 Ga0466957_0000142_5067_5792 219
60 3300045836 Ga0466958_0003556 Ga0466958_0003556_3847_4572 219
61 3300047444 Ga0495675_0111160 Ga0495675_0111160_565_1260 219
62 3300049581 Ga0501047_0225385 Ga0501047_0225385_364_1077 219
63 3300049823 Ga0501044_0014797 Ga0501044_0014797_350_1063 219
64 3300061719 Ga0466962_0003371 Ga0466962_0003371_40_765 219
65 iso_pu_bacteria 2786546132 2786668864 219
66 iso_pu_bacteria 2954673503 2954675143 219
67 iso_pu_bacteria 2954682443 2954688992 219
68 3300031838 Ga0307518_10371091 Ga0307518_103710911 220
69 iso_pu_bacteria 2862382967 2862391209 220
70 iso_pu_bacteria 8008558824 8008561985 220
71 3300015688 Ga0183367_1007 Ga0183367_1007292 221
72 3300030522 Ga0307512_10090463 Ga0307512_100904632 221
73 3300033179 Ga0307507_10098646 Ga0307507_100986462 221
74 3300046452 Ga0495617_003689 Ga0495617_003689_1199_1912 221
75 3300046462 Ga0495651_0030801 Ga0495651_0030801_3159_3872 221
76 3300046472 Ga0495580_0219295 Ga0495580_0219295_311_1024 221
77 3300046492 Ga0495585_0156202 Ga0495585_0156202_37_750 221
78 3300046506 Ga0495583_0157755 Ga0495583_0157755_140_853 221
79 3300046511 Ga0495608_0064683 Ga0495608_0064683_97_810 221
80 3300046514 Ga0495618_0055187 Ga0495618_0055187_1319_2032 221
81 3300046515 Ga0495620_0083260 Ga0495620_0083260_301_1014 221
82 3300046516 Ga0495628_0169583 Ga0495628_0169583_202_915 221
83 3300046516 Ga0495628_0206531 Ga0495628_0206531_72_785 221
84 3300046522 Ga0495643_0005293 Ga0495643_0005293_653_1366 221
85 3300046524 Ga0495648_0140037 Ga0495648_0140037_261_974 221
86 3300046533 Ga0495640_0022236 Ga0495640_0022236_817_1530 221
87 3300046642 Ga0495634_0279374 Ga0495634_0279374_155_868 221
88 3300046678 Ga0495599_0151553 Ga0495599_0151553_511_1224 221
89 3300046680 Ga0495646_0015021 Ga0495646_0015021_3761_4474 221
90 3300046689 Ga0495613_0105545 Ga0495613_0105545_404_1117 221
91 3300046690 Ga0495624_0029814 Ga0495624_0029814_35_748 221
92 3300046690 Ga0495624_0249906 Ga0495624_0249906_93_806 221
93 3300046694 Ga0495649_0074258 Ga0495649_0074258_578_1291 221
94 3300046794 Ga0495589_0157513 Ga0495589_0157513_129_842 221
95 3300046810 Ga0495660_0156618 Ga0495660_0156618_273_986 221
96 3300047318 Ga0495636_0004615 Ga0495636_0004615_529_1245 221
97 3300047319 Ga0495674_0030398 Ga0495674_0030398_4096_4809 221
98 3300047320 Ga0495672_0029267 Ga0495672_0029267_1744_2457 221
99 3300047322 Ga0495680_0166087 Ga0495680_0166087_289_1002 221
100 3300047443 Ga0495687_008019 Ga0495687_008019_2214_2930 221
101 3300047443 Ga0495687_064976 Ga0495687_064976_494_1207 221
102 3300047447 Ga0495685_040431 Ga0495685_040431_33_746 221
103 3300048089 Ga0495614_0104357 Ga0495614_0104357_435_1148 221
104 3300049568 Ga0501031_0111094 Ga0501031_0111094_112_825 221
105 3300049571 Ga0501034_0246789 Ga0501034_0246789_198_911 221
106 3300049574 Ga0501038_0014466 Ga0501038_0014466_3507_4220 221
107 3300049579 Ga0501043_0070358 Ga0501043_0070358_1630_2343 221
108 3300049581 Ga0501047_0023473 Ga0501047_0023473_365_1078 221
109 3300049742 Ga0501080_0203130 Ga0501080_0203130_957_1670 221
110 3300049822 Ga0501035_0040233 Ga0501035_0040233_1827_2540 221
111 3300049823 Ga0501044_0155021 Ga0501044_0155021_406_1119 221
112 3300041404 Ga0439436_0000670 Ga0439436_0000670_1609_2316 222
113 3300042007 Ga0439449_0029831 Ga0439449_0029831_1039_1746 222
114 3300042014 Ga0439457_005204 Ga0439457_005204_1667_2374 222
115 3300044694 Ga0466963_0034068 Ga0466963_0034068_1209_1928 222
116 3300046455 Ga0495603_0012364 Ga0495603_0012364_1323_2048 222
117 3300046499 Ga0495594_0108694 Ga0495594_0108694_711_1436 222
118 3300046648 Ga0495611_0042220 Ga0495611_0042220_317_1042 222
119 3300046794 Ga0495589_0060231 Ga0495589_0060231_306_1031 222
120 iso_pu_bacteria 2808606375 2808919056 222
121 iso_pu_bacteria 2811994879 2812359706 222
122 iso_pu_bacteria 2852635781 2852638315 222
123 iso_pu_bacteria 2862281513 2862288817 222
124 iso_pu_bacteria 2863404153 2863406321 222
125 iso_pu_bacteria 2946064051 2946066204 222
126 iso_pu_bacteria 2954002825 2954004473 222
127 iso_pu_bacteria 2582581314 2585314215 223
128 iso_pu_bacteria 2947224130 2947231169 223
129 3300044658 Ga0466972_0004856 Ga0466972_0004856_4224_4937 224
130 3300046523 Ga0495644_0049228 Ga0495644_0049228_25_741 224
131 iso_pu_bacteria 2990059506 2990061840 224
132 iso_pu_bacteria 2997451912 2997458658 224
133 3300030521 Ga0307511_10006903 Ga0307511_100069036 225
134 3300031507 Ga0307509_10059779 Ga0307509_100597795 225
135 3300046453 Ga0495627_030305 Ga0495627_030305_71_784 225
136 3300046455 Ga0495603_0010991 Ga0495603_0010991_3823_4551 225
137 3300046455 Ga0495603_0136480 Ga0495603_0136480_437_1150 225
138 3300046499 Ga0495594_0048905 Ga0495594_0048905_808_1536 225
139 3300046557 Ga0495622_0063137 Ga0495622_0063137_226_954 225
140 3300046558 Ga0495633_0043120 Ga0495633_0043120_1239_1952 225
141 3300046648 Ga0495611_0047229 Ga0495611_0047229_474_1187 225
142 3300046674 Ga0495588_0003495 Ga0495588_0003495_3616_4344 225
143 3300046810 Ga0495660_0081925 Ga0495660_0081925_437_1150 225
144 3300047443 Ga0495687_003207 Ga0495687_003207_3309_4028 225
145 3300049460 Ga0495682_0005566 Ga0495682_0005566_1891_2604 225
146 3300028786 Ga0307517_10004661 Ga0307517_1000466112 226
147 3300028794 Ga0307515_10008399 Ga0307515_1000839913 226
148 3300031649 Ga0307514_10156028 Ga0307514_101560282 226
149 3300033179 Ga0307507_10029004 Ga0307507_100290043 226
150 3300041404 Ga0439436_0003098 Ga0439436_0003098_138_854 226
151 3300041406 Ga0439439_0010476 Ga0439439_0010476_645_1361 226
152 3300041999 Ga0439433_0007562 Ga0439433_0007562_321_1037 226
153 3300042002 Ga0439442_018832 Ga0439442_018832_552_1268 226
154 3300042014 Ga0439457_000095 Ga0439457_000095_10153_10869 226
155 3300042131 Ga0450894_001863 Ga0450894_001863_1011_1730 226
156 3300046459 Ga0495629_0014844 Ga0495629_0014844_908_1624 226
157 3300046459 Ga0495629_0041709 Ga0495629_0041709_266_997 226
158 3300046459 Ga0495629_0068956 Ga0495629_0068956_395_1108 226
159 3300046474 Ga0495605_0017637 Ga0495605_0017637_1607_2320 226
160 3300046499 Ga0495594_0086156 Ga0495594_0086156_437_1150 226
161 3300046501 Ga0495607_0004800 Ga0495607_0004800_1164_1877 226
162 3300046507 Ga0495606_0048375 Ga0495606_0048375_1851_2564 226
163 3300046512 Ga0495610_0036901 Ga0495610_0036901_199_912 226
164 3300046513 Ga0495616_0020840 Ga0495616_0020840_71_784 226
165 3300046515 Ga0495620_0123797 Ga0495620_0123797_234_947 226
166 3300046518 Ga0495631_0002506 Ga0495631_0002506_1678_2391 226
167 3300046524 Ga0495648_0190382 Ga0495648_0190382_89_802 226
168 3300046557 Ga0495622_0023090 Ga0495622_0023090_228_941 226
169 3300046660 Ga0495625_0012343 Ga0495625_0012343_1954_2670 226
170 3300046692 Ga0495671_0003017 Ga0495671_0003017_4205_4921 226
171 3300046692 Ga0495671_0111516 Ga0495671_0111516_139_852 226
172 3300046794 Ga0495589_0167189 Ga0495589_0167189_192_905 226
173 3300047321 Ga0495676_0044022 Ga0495676_0044022_447_1160 226
174 3300047323 Ga0495683_0182439 Ga0495683_0182439_140_853 226
175 3300047443 Ga0495687_106732 Ga0495687_106732_159_872 226
176 3300047447 Ga0495685_033774 Ga0495685_033774_952_1665 226
177 3300047470 Ga0495681_0009883 Ga0495681_0009883_977_1693 226
178 3300048089 Ga0495614_0134358 Ga0495614_0134358_75_788 226
179 3300048091 Ga0495626_0055764 Ga0495626_0055764_277_990 226
180 iso_pu_bacteria 2912715099 2912721755 226
181 iso_pu_bacteria 2935390628 2935395562 226
182 3300014497 Ga0182008_10007297 Ga0182008_100072973 227
183 3300015262 Ga0182007_10010356 Ga0182007_100103565 227
184 3300015265 Ga0182005_1056074 Ga0182005_10560741 227
185 3300030522 Ga0307512_10025992 Ga0307512_100259923 227
186 3300031456 Ga0307513_10054765 Ga0307513_100547654 227
187 3300031616 Ga0307508_10103896 Ga0307508_101038962 227
188 3300033179 Ga0307507_10026673 Ga0307507_100266732 227
189 3300046454 Ga0495592_0019923 Ga0495592_0019923_3932_4651 227
190 3300046476 Ga0495662_0010614 Ga0495662_0010614_450_1169 227
191 3300046477 Ga0495664_0001685 Ga0495664_0001685_4110_4829 227
192 3300046517 Ga0495630_0043404 Ga0495630_0043404_2240_2959 227
193 3300046529 Ga0495652_0096039 Ga0495652_0096039_1333_2052 227
194 3300046543 Ga0495645_0263367 Ga0495645_0263367_292_1011 227
195 3300046642 Ga0495634_0013918 Ga0495634_0013918_151_870 227
196 3300046663 Ga0495635_0002533 Ga0495635_0002533_11651_12370 227
197 3300046675 Ga0495657_0009254 Ga0495657_0009254_180_899 227
198 3300046678 Ga0495599_0106017 Ga0495599_0106017_697_1416 227
199 3300046680 Ga0495646_0031890 Ga0495646_0031890_1742_2461 227
200 3300046794 Ga0495589_0124933 Ga0495589_0124933_94_831 227
201 3300046809 Ga0495600_0064691 Ga0495600_0064691_727_1446 227
202 3300047317 Ga0495604_0000463 Ga0495604_0000463_855_1574 227
203 3300047318 Ga0495636_0049670 Ga0495636_0049670_598_1335 227
204 3300047321 Ga0495676_0001882 Ga0495676_0001882_7376_8095 227
205 3300047447 Ga0495685_064079 Ga0495685_064079_64_801 227
206 3300047673 Ga0495593_0018894 Ga0495593_0018894_2606_3325 227
207 3300048088 Ga0495602_0004050 Ga0495602_0004050_12672_13391 227
208 3300048089 Ga0495614_0047870 Ga0495614_0047870_611_1330 227
209 iso_pu_bacteria 2616644814 2616694159 227
210 3300005577 Ga0068857_100406989 Ga0068857_1004069892 229
211 3300011119 Ga0105246_10005332 Ga0105246_100053321 229
212 3300031838 Ga0307518_10128028 Ga0307518_101280282 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

41

251

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4v-assembly1.cif.gz_A glnk1 from methanothermococcus thermolithotrophicus with dadp at a resolution of 1.94 a 0.6044 37 134
2j9d-assembly2.cif.gz_F structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.5984 36 146
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.5945 39 142
8fmw-assembly1.cif.gz_F the structure of a hibernating ribosome in the lyme disease pathogen 0.5855 37 145
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.5746 39 142
ID Description Score Start End Superfamily
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7838 37 132 3.30.70.2970
af_P0ADS6_28_138_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7758 21 123 3.30.70.2970
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7551 35 141 3.30.70.2970
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7488 37 132 3.30.70.2970
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7191 35 141 3.30.70.2970
ID Description Score Start End GO Terms
AF-K2CUP3-F1-model_v4 DUF541 domain-containing protein 0.7687 6 144 GO:0006974
AF-A0A2V8PY39-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.766 6 114 GO:0006974
GO:0016020
AF-A0A139CKM8-F1-model_v4 DUF541 domain-containing protein 0.7557 12 139 GO:0006974
GO:0016020
AF-A0A2A2TBI3-F1-model_v4 SIMPL domain-containing protein 0.7482 33 163 GO:0006974
AF-A0A819BKL9-F1-model_v4 Autotransporter domain-containing protein 0.7473 33 163 GO:0019867

Feature Viewer

pLDDT pTM Quality
65.95 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map