F323075

General Info

Members Datasets Scaffolds Average Seq Length
212 108 201 386

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0036361|Ga0395899_0036361_1016_2251
Length 411
Sequence MRYTKPELTNLKEFYFNQLMADTLPFWFPKSIDKEFGGYLLMRGKTGDLIDDDKAVWIQGRFSWLLSTLYSTVEQKEEWLEAAKSGVNFLLKHCFDVDGRMFFHVTRDGKPIRKRRYFFSETFAVMAFAAYSKASGDQEFALKARELYGQCIYYAQNPQLFPAKYTETRKFKGFSIPMMMVVVSQQMRDSIGDNRCDNVIAQYISEIERDFVKDDIRCVMEQVGSNGKIINHIEGRTLNPGHAIEGAWFILYEGMQKSNQHYVELGCRMLDYMWERGWDDEYGGIIYFKDVFNNPVQEYWHDMKFWWPQNEAIIATLLAYLLTGNEKYATWHQMVHKYAYNNFLDKENGEWFGYLHRNGTVANPTKGNMFKGPFHLPRQEWICWHMLNLFLDSGDAVMKKKSEFHSNSTQQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
9 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
10 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
11 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
12 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
108 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 0
Rhizosphere 89.15
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3952261 2162886007 Bacteria 34047
2 JGI24740J21852_10022040 3300001979 Bacteria 2199
3 rootH1_10079167 3300003323 Bacteria 4873
4 rootH1_10079168 3300003323 Bacteria 6369
5 rootH1_10079181 3300003323 Bacteria 2427
6 Ga0055536_1000049 3300003781 Bacteria 113328
7 Ga0055536_1010962 3300003781 Bacteria 3531
8 Ga0065165_1000043 3300005262 Bacteria 203850
9 Ga0065714_10002765 3300005288 Bacteria 65513
10 Ga0065714_10064461 3300005288 Bacteria 66149
11 Ga0065714_10071579 3300005288 Bacteria 3543
12 Ga0065714_10072479 3300005288 Bacteria 3357
13 Ga0065704_10070264 3300005289 Bacteria 44804
14 Ga0065704_10079640 3300005289 Bacteria 4111
15 Ga0065715_10138155 3300005293 Bacteria 1880
16 Ga0070658_10047175 3300005327 Bacteria 3486
17 Ga0070658_10079194 3300005327 Bacteria 2698
18 Ga0068869_100316833 3300005334 Bacteria 1264
19 Ga0070680_100036160 3300005336 Bacteria 3989
20 Ga0070680_100038543 3300005336 Bacteria 3865
21 Ga0070682_100077492 3300005337 Bacteria 2142
22 Ga0070660_100012108 3300005339 Bacteria 6158
23 Ga0070660_100017659 3300005339 Bacteria 5202
24 Ga0070660_100105042 3300005339 Bacteria 2241
25 Ga0070660_100129190 3300005339 Bacteria 2021
26 Ga0070660_100182989 3300005339 Bacteria 1696
27 Ga0070659_100023701 3300005366 Bacteria 4700
28 Ga0070659_100192111 3300005366 Bacteria 1678
29 Ga0070663_100001300 3300005455 Bacteria 13661
30 Ga0070663_100037757 3300005455 Bacteria 3365
31 Ga0070662_100000454 3300005457 Bacteria 24209
32 Ga0070681_10039561 3300005458 Bacteria 4726
33 Ga0068867_100013030 3300005459 Bacteria 5884
34 Ga0070679_100000414 3300005530 Bacteria 36356
35 Ga0070679_100003459 3300005530 Bacteria 14461
36 Ga0070679_100093905 3300005530 Bacteria 2987
37 Ga0070684_100024454 3300005535 Bacteria 5068
38 Ga0068853_100063938 3300005539 Bacteria 3189
39 Ga0068853_100091926 3300005539 Bacteria 2669
40 Ga0068853_100274345 3300005539 Unclassified 1553
41 Ga0068855_100000133 3300005563 Bacteria 94906
42 Ga0068855_100004847 3300005563 Bacteria 16422
43 Ga0068855_100007169 3300005563 Bacteria 13525
44 Ga0068855_100277144 3300005563 Bacteria 1863
45 Ga0068857_100005425 3300005577 Bacteria 10872
46 Ga0068854_100004997 3300005578 Bacteria 8363
47 Ga0068854_100027693 3300005578 Bacteria 3909
48 Ga0068856_100018095 3300005614 Bacteria 6831
49 Ga0068856_100075897 3300005614 Bacteria 3330
50 Ga0068852_100000379 3300005616 Bacteria 29959
51 Ga0068852_100034036 3300005616 Bacteria 4237
52 Ga0068852_100252058 3300005616 Bacteria 1691
53 Ga0068861_100142500 3300005719 Bacteria 1958
54 Ga0097621_100007503 3300006237 Bacteria 7808
55 Ga0068871_100006537 3300006358 Bacteria 8258
56 Ga0105240_10000398 3300009093 Bacteria 81045
57 Ga0105240_10003613 3300009093 Bacteria 23948
58 Ga0105240_10063764 3300009093 Bacteria 4582
59 Ga0105240_10068439 3300009093 Bacteria 4396
60 Ga0105240_10123253 3300009093 Bacteria 3118
61 Ga0105241_10045909 3300009174 Bacteria 3316
62 Ga0105242_10048343 3300009176 Bacteria 3458
63 Ga0105242_10310001 3300009176 Bacteria 1444
64 Ga0105237_10002634 3300009545 Bacteria 22084
65 Ga0105238_10001145 3300009551 Bacteria 26746
66 Ga0157373_10000043 3300013100 Bacteria 113422
67 Ga0157373_10006503 3300013100 Bacteria 8718
68 Ga0157373_10042498 3300013100 Bacteria 3248
69 Ga0157373_10063756 3300013100 Bacteria 2609
70 Ga0157373_10095900 3300013100 Bacteria 2088
71 Ga0157373_10105572 3300013100 Bacteria 1981
72 Ga0157371_10000416 3300013102 Bacteria 52659
73 Ga0157371_10000669 3300013102 Bacteria 40629
74 Ga0157371_10001859 3300013102 Bacteria 21187
75 Ga0157371_10002197 3300013102 Bacteria 18937
76 Ga0157371_10002638 3300013102 Bacteria 17015
77 Ga0157371_10014526 3300013102 Bacteria 5939
78 Ga0157371_10018067 3300013102 Bacteria 5221
79 Ga0157371_10070349 3300013102 Bacteria 2477
80 Ga0157370_10000333 3300013104 Bacteria 59235
81 Ga0157370_10000457 3300013104 Bacteria 51070
82 Ga0157370_10014508 3300013104 Bacteria 8055
83 Ga0157370_10032045 3300013104 Bacteria 5136
84 Ga0157370_10049073 3300013104 Bacteria 4042
85 Ga0157370_10053723 3300013104 Bacteria 3841
86 Ga0157370_10118078 3300013104 Bacteria 2478
87 Ga0157370_10313228 3300013104 Bacteria 1448
88 Ga0157369_10001812 3300013105 Bacteria 25861
89 Ga0157369_10035319 3300013105 Bacteria 5483
90 Ga0157369_10035713 3300013105 Bacteria 5448
91 Ga0157369_10059914 3300013105 Bacteria 4106
92 Ga0157369_10071140 3300013105 Bacteria 3735
93 Ga0157369_10077973 3300013105 Bacteria 3550
94 Ga0157369_10129948 3300013105 Bacteria 2670
95 Ga0157369_10146430 3300013105 Bacteria 2497
96 Ga0157374_10065390 3300013296 Bacteria 3415
97 Ga0157378_10010654 3300013297 Bacteria 8034
98 Ga0157378_10020261 3300013297 Bacteria 5849
99 Ga0163162_10005689 3300013306 Bacteria 12043
100 Ga0157372_10000001 3300013307 Bacteria 791349
101 Ga0157372_10000231 3300013307 Bacteria 62248
102 Ga0157372_10003098 3300013307 Bacteria 17907
103 Ga0157372_10008673 3300013307 Bacteria 10799
104 Ga0157372_10010765 3300013307 Bacteria 9737
105 Ga0157375_10359264 3300013308 Bacteria 1622
106 Ga0182008_10074193 3300014497 Bacteria 1674
107 Ga0157376_10011009 3300014969 Bacteria 6646
108 Ga0182007_10006171 3300015262 Bacteria 5171
109 Ga0182007_10018380 3300015262 Bacteria 2532
110 Ga0163161_10000391 3300017792 Bacteria 36781
111 Ga0209676_1000001 3300025292 Bacteria 1852142
112 Ga0209676_1000589 3300025292 Bacteria 54194
113 Ga0209050_1000258 3300025298 Bacteria 113741
114 Ga0209050_1018784 3300025298 Bacteria 2664
115 Ga0207647_10001904 3300025904 Bacteria 16001
116 Ga0207705_10039495 3300025909 Bacteria 3383
117 Ga0207705_10049290 3300025909 Bacteria 3031
118 Ga0207705_10057549 3300025909 Bacteria 2804
119 Ga0207695_10000076 3300025913 Bacteria 307969
120 Ga0207695_10000090 3300025913 Bacteria 272143
121 Ga0207695_10030974 3300025913 Bacteria 5880
122 Ga0207671_10016919 3300025914 Bacteria 5644
123 Ga0207660_10066216 3300025917 Bacteria 2613
124 Ga0207657_10005273 3300025919 Bacteria 13546
125 Ga0207657_10022626 3300025919 Bacteria 5876
126 Ga0207657_10049785 3300025919 Bacteria 3648
127 Ga0207657_10106902 3300025919 Bacteria 2315
128 Ga0207652_10000027 3300025921 Bacteria 151000
129 Ga0207652_10000074 3300025921 Bacteria 108397
130 Ga0207652_10001161 3300025921 Bacteria 23656
131 Ga0207652_10103836 3300025921 Bacteria 2513
132 Ga0207652_10228687 3300025921 Bacteria 1676
133 Ga0207706_10001185 3300025933 Bacteria 26338
134 Ga0207667_10000100 3300025949 Bacteria 138482
135 Ga0207667_10000453 3300025949 Bacteria 54929
136 Ga0207667_10023551 3300025949 Bacteria 6779
137 Ga0207667_10035891 3300025949 Bacteria 5317
138 Ga0207667_10054883 3300025949 Bacteria 4190
139 Ga0207640_10003587 3300025981 Bacteria 8365
140 Ga0207639_10071442 3300026041 Bacteria 2715
141 Ga0207639_10073879 3300026041 Bacteria 2675
142 Ga0207639_10361061 3300026041 Bacteria 1300
143 Ga0207678_10053817 3300026067 Bacteria 3468
144 Ga0207678_10127674 3300026067 Bacteria 2169
145 Ga0207702_10040415 3300026078 Bacteria 3910
146 Ga0207702_10089527 3300026078 Bacteria 2691
147 Ga0207648_10002281 3300026089 Bacteria 20722
148 Ga0207674_10009127 3300026116 Bacteria 11378
149 Ga0207698_10008522 3300026142 Bacteria 6494
150 Ga0207698_10008601 3300026142 Bacteria 6468
151 Ga0307515_10000493 3300028794 Bacteria 94441
152 Ga0265327_10000207 3300031251 Bacteria 123193
153 Ga0307509_10103055 3300031507 Bacteria 2883
154 Ga0307412_10000075 3300031911 Bacteria 97612
155 Ga0307414_10000509 3300032004 Bacteria 20246
156 Ga0307414_10032744 3300032004 Bacteria 3427
157 Ga0307414_10359202 3300032004 Bacteria 1253
158 Ga0395899_0000011 3300037312 Bacteria 521331
159 Ga0395899_0005074 3300037312 Bacteria 10244
160 Ga0395899_0006247 3300037312 Bacteria 9229
161 Ga0395899_0012099 3300037312 Bacteria 6607
162 Ga0395899_0019606 3300037312 Bacteria 5134
163 Ga0395899_0036361 3300037312 Bacteria 3694
164 Ga0395900_0000420 3300037418 Bacteria 61258
165 Ga0395900_0003428 3300037418 Bacteria 17141
166 Ga0395900_0017431 3300037418 Bacteria 7331
167 Ga0395900_0123008 3300037418 Bacteria 2661
168 Ga0395900_0268682 3300037418 Bacteria 1701
169 Ga0395898_0001381 3300037466 Bacteria 34756
170 Ga0395898_0002699 3300037466 Bacteria 20525
171 Ga0395898_0016292 3300037466 Bacteria 7607
172 Ga0395898_0190185 3300037466 Bacteria 1961
173 Ga0395898_0297941 3300037466 Bacteria 1538
174 Ga0395905_0164001 3300037471 Bacteria 2088
175 Ga0395901_0015806 3300038443 Bacteria 7691
176 Ga0395901_0016163 3300038443 Bacteria 7601
177 Ga0495627_036627 3300046453 Bacteria 1524
178 Ga0495650_0000110 3300046471 Bacteria 198355
179 Ga0495583_0011045 3300046506 Bacteria 5207
180 Ga0495606_0000003 3300046507 Bacteria 449402
181 Ga0495610_0000160 3300046512 Bacteria 74776
182 Ga0495610_0000273 3300046512 Bacteria 53916
183 Ga0495610_0000986 3300046512 Bacteria 26264
184 Ga0495616_0027202 3300046513 Bacteria 3037
185 Ga0495643_0008939 3300046522 Bacteria 6295
186 Ga0495633_0031124 3300046558 Bacteria 2589
187 Ga0495633_0057246 3300046558 Bacteria 1831
188 Ga0495625_0000013 3300046660 Bacteria 345151
189 Ga0495661_0003193 3300046665 Bacteria 12255
190 Ga0495649_0000010 3300046694 Bacteria 430552
191 Ga0496116_0004895 3300048919 Bacteria 12625
192 Ga0496117_0013924 3300048920 Bacteria 6972
193 Ga0501034_0103844 3300049571 Bacteria 2835
194 Ga0501036_0092373 3300049572 Bacteria 2557
195 Ga0501038_0057097 3300049574 Bacteria 3352
196 Ga0501047_0186404 3300049581 Bacteria 1940
197 Ga0501202_003070 3300049652 Bacteria 2842
198 Ga0501044_0022879 3300049823 Bacteria 6656
199 Ga0500651_0000625 3300053093 Bacteria 17617
200 Ga0500608_023424 3300053122 Bacteria 2874
201 Ga0500624_000959 3300053157 Bacteria 5941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10018067 Ga0157371_100180673 333
2 3300005577 Ga0068857_100005425 Ga0068857_1000054258 346
3 3300005578 Ga0068854_100004997 Ga0068854_1000049972 346
4 3300005616 Ga0068852_100000379 Ga0068852_10000037916 346
5 3300009093 Ga0105240_10003613 Ga0105240_1000361312 346
6 3300009551 Ga0105238_10001145 Ga0105238_1000114521 346
7 3300013100 Ga0157373_10095900 Ga0157373_100959002 346
8 3300013104 Ga0157370_10032045 Ga0157370_100320452 346
9 3300013105 Ga0157369_10035319 Ga0157369_100353193 346
10 3300013307 Ga0157372_10000231 Ga0157372_1000023156 346
11 3300025913 Ga0207695_10030974 Ga0207695_100309744 346
12 3300025949 Ga0207667_10000100 Ga0207667_1000010058 346
13 3300025981 Ga0207640_10003587 Ga0207640_100035872 346
14 3300026116 Ga0207674_10009127 Ga0207674_100091272 346
15 3300026142 Ga0207698_10008522 Ga0207698_100085222 346
16 3300049572 Ga0501036_0092373 Ga0501036_0092373_892_2067 347
17 3300049581 Ga0501047_0186404 Ga0501047_0186404_163_1338 347
18 3300009545 Ga0105237_10002634 Ga0105237_1000263412 355
19 3300025914 Ga0207671_10016919 Ga0207671_100169193 355
20 3300031251 Ga0265327_10000207 Ga0265327_10000207141 360
21 3300028794 Ga0307515_10000493 Ga0307515_1000049342 361
22 3300005563 Ga0068855_100277144 Ga0068855_1002771442 363
23 3300005535 Ga0070684_100024454 Ga0070684_1000244543 364
24 3300009176 Ga0105242_10310001 Ga0105242_103100012 364
25 3300025913 Ga0207695_10000076 Ga0207695_1000007690 364
26 3300025913 Ga0207695_10000090 Ga0207695_1000009089 364
27 3300025949 Ga0207667_10000453 Ga0207667_100004535 364
28 3300037418 Ga0395900_0268682 Ga0395900_0268682_332_1558 364
29 3300049571 Ga0501034_0103844 Ga0501034_0103844_1142_2317 365
30 3300013297 Ga0157378_10010654 Ga0157378_100106546 366
31 3300031507 Ga0307509_10103055 Ga0307509_101030553 367
32 3300005366 Ga0070659_100023701 Ga0070659_1000237012 369
33 3300005539 Ga0068853_100063938 Ga0068853_1000639382 369
34 3300005616 Ga0068852_100034036 Ga0068852_1000340363 369
35 3300013102 Ga0157371_10002638 Ga0157371_100026388 369
36 3300013105 Ga0157369_10035713 Ga0157369_100357133 369
37 3300013105 Ga0157369_10077973 Ga0157369_100779733 369
38 3300013307 Ga0157372_10008673 Ga0157372_100086737 369
39 3300025904 Ga0207647_10001904 Ga0207647_100019043 369
40 3300049652 Ga0501202_003070 Ga0501202_003070_1331_2530 369
41 3300005539 Ga0068853_100091926 Ga0068853_1000919262 374
42 3300005563 Ga0068855_100000133 Ga0068855_10000013353 374
43 3300009093 Ga0105240_10000398 Ga0105240_1000039817 374
44 3300013100 Ga0157373_10063756 Ga0157373_100637562 374
45 3300013105 Ga0157369_10001812 Ga0157369_1000181217 374
46 3300013105 Ga0157369_10071140 Ga0157369_100711403 374
47 3300013307 Ga0157372_10003098 Ga0157372_100030987 374
48 3300026041 Ga0207639_10073879 Ga0207639_100738792 374
49 3300037312 Ga0395899_0012099 Ga0395899_0012099_1179_2372 374
50 3300005336 Ga0070680_100038543 Ga0070680_1000385434 375
51 3300005337 Ga0070682_100077492 Ga0070682_1000774922 375
52 3300005339 Ga0070660_100129190 Ga0070660_1001291901 375
53 3300005530 Ga0070679_100003459 Ga0070679_10000345911 375
54 3300005616 Ga0068852_100252058 Ga0068852_1002520582 375
55 3300025917 Ga0207660_10066216 Ga0207660_100662162 375
56 3300025919 Ga0207657_10022626 Ga0207657_100226264 375
57 3300025921 Ga0207652_10001161 Ga0207652_1000116111 375
58 3300026041 Ga0207639_10071442 Ga0207639_100714422 375
59 3300026142 Ga0207698_10008601 Ga0207698_100086015 375
60 3300001979 JGI24740J21852_10022040 JGI24740J21852_100220402 376
61 3300005455 Ga0070663_100001300 Ga0070663_1000013004 376
62 3300013102 Ga0157371_10070349 Ga0157371_100703492 376
63 3300013307 Ga0157372_10000001 Ga0157372_1000000111 376
64 3300025909 Ga0207705_10039495 Ga0207705_100394953 376
65 3300026067 Ga0207678_10127674 Ga0207678_101276742 376
66 3300009093 Ga0105240_10068439 Ga0105240_100684393 377
67 3300013105 Ga0157369_10059914 Ga0157369_100599142 377
68 3300048919 Ga0496116_0004895 Ga0496116_0004895_4651_5871 377
69 3300048920 Ga0496117_0013924 Ga0496117_0013924_981_2201 377
70 3300005334 Ga0068869_100316833 Ga0068869_1003168331 378
71 3300006237 Ga0097621_100007503 Ga0097621_1000075036 378
72 3300006358 Ga0068871_100006537 Ga0068871_1000065372 378
73 3300013104 Ga0157370_10049073 Ga0157370_100490732 378
74 3300013104 Ga0157370_10053723 Ga0157370_100537233 378
75 3300013297 Ga0157378_10020261 Ga0157378_100202613 378
76 3300014969 Ga0157376_10011009 Ga0157376_100110093 378
77 3300037312 Ga0395899_0005074 Ga0395899_0005074_911_2086 378
78 3300037418 Ga0395900_0017431 Ga0395900_0017431_3134_4309 378
79 3300037466 Ga0395898_0001381 Ga0395898_0001381_24277_25452 378
80 3300046453 Ga0495627_036627 Ga0495627_036627_26_1207 378
81 3300046558 Ga0495633_0057246 Ga0495633_0057246_571_1752 378
82 3300013100 Ga0157373_10006503 Ga0157373_100065032 379
83 3300046512 Ga0495610_0000986 Ga0495610_0000986_18481_19674 379
84 3300003323 rootH1_10079167 rootH1_100791673 380
85 3300013100 Ga0157373_10105572 Ga0157373_101055722 380
86 3300032004 Ga0307414_10359202 Ga0307414_103592021 383
87 3300013104 Ga0157370_10313228 Ga0157370_103132281 385
88 3300003781 Ga0055536_1010962 Ga0055536_10109623 386
89 3300005262 Ga0065165_1000043 Ga0065165_100004352 386
90 3300025292 Ga0209676_1000589 Ga0209676_100058950 386
91 3300025298 Ga0209050_1018784 Ga0209050_10187842 386
92 3300013104 Ga0157370_10118078 Ga0157370_101180782 387
93 iso_pu_bacteria 3003233435 3003235889 388
94 3300005339 Ga0070660_100105042 Ga0070660_1001050422 389
95 3300013102 Ga0157371_10014526 Ga0157371_100145262 389
96 3300013307 Ga0157372_10010765 Ga0157372_100107655 389
97 3300025919 Ga0207657_10106902 Ga0207657_101069022 389
98 iso_pu_bacteria 2739367651 2739590430 389
99 iso_pu_bacteria 2738541284 2738761130 390
100 iso_pu_bacteria 2775506987 2776613343 390
101 iso_pu_bacteria 2840677318 2840678379 390
102 iso_pu_bacteria 2883068021 2883071015 390
103 iso_pu_bacteria 2890737413 2890739281 390
104 iso_pu_bacteria 2896085136 2896086196 390
105 iso_pu_bacteria 2958458903 2958459182 390
106 3300005339 Ga0070660_100017659 Ga0070660_1000176593 391
107 3300005455 Ga0070663_100037757 Ga0070663_1000377573 391
108 3300005457 Ga0070662_100000454 Ga0070662_1000004544 391
109 3300009093 Ga0105240_10123253 Ga0105240_101232533 391
110 3300013100 Ga0157373_10042498 Ga0157373_100424983 391
111 3300025909 Ga0207705_10057549 Ga0207705_100575492 391
112 3300025919 Ga0207657_10049785 Ga0207657_100497852 391
113 3300025933 Ga0207706_10001185 Ga0207706_100011852 391
114 3300026067 Ga0207678_10053817 Ga0207678_100538172 391
115 3300037312 Ga0395899_0006247 Ga0395899_0006247_3659_4834 391
116 3300037418 Ga0395900_0003428 Ga0395900_0003428_10068_11243 391
117 3300037466 Ga0395898_0016292 Ga0395898_0016292_2621_3796 391
118 3300037471 Ga0395905_0164001 Ga0395905_0164001_769_1944 391
119 3300003323 rootH1_10079168 rootH1_100791682 392
120 3300013306 Ga0163162_10005689 Ga0163162_100056897 392
121 3300013308 Ga0157375_10359264 Ga0157375_103592642 392
122 3300046471 Ga0495650_0000110 Ga0495650_0000110_57733_58947 392
123 3300046506 Ga0495583_0011045 Ga0495583_0011045_3554_4768 392
124 3300046507 Ga0495606_0000003 Ga0495606_0000003_301410_302588 392
125 3300046512 Ga0495610_0000273 Ga0495610_0000273_19106_20284 392
126 3300046513 Ga0495616_0027202 Ga0495616_0027202_341_1555 392
127 3300046558 Ga0495633_0031124 Ga0495633_0031124_645_1823 392
128 3300046660 Ga0495625_0000013 Ga0495625_0000013_136285_137499 392
129 3300046665 Ga0495661_0003193 Ga0495661_0003193_7875_9053 392
130 3300046694 Ga0495649_0000010 Ga0495649_0000010_207567_208781 392
131 3300053122 Ga0500608_023424 Ga0500608_023424_115_1293 392
132 3300053157 Ga0500624_000959 Ga0500624_000959_1302_2480 392
133 3300003781 Ga0055536_1000049 Ga0055536_100004921 393
134 3300005288 Ga0065714_10064461 Ga0065714_100644617 393
135 3300005327 Ga0070658_10079194 Ga0070658_100791943 393
136 3300005530 Ga0070679_100000414 Ga0070679_10000041421 393
137 3300005539 Ga0068853_100274345 Ga0068853_1002743451 393
138 3300013102 Ga0157371_10000669 Ga0157371_1000066924 393
139 3300025292 Ga0209676_1000001 Ga0209676_100000177 393
140 3300025298 Ga0209050_1000258 Ga0209050_100025822 393
141 3300025921 Ga0207652_10000027 Ga0207652_10000027103 393
142 3300037312 Ga0395899_0036361 Ga0395899_0036361_1016_2251 393
143 3300037418 Ga0395900_0000420 Ga0395900_0000420_27367_28602 393
144 3300037466 Ga0395898_0002699 Ga0395898_0002699_16870_18105 393
145 3300037466 Ga0395898_0297941 Ga0395898_0297941_41_1222 393
146 3300038443 Ga0395901_0015806 Ga0395901_0015806_5728_6963 393
147 3300046512 Ga0495610_0000160 Ga0495610_0000160_50912_52093 393
148 3300046522 Ga0495643_0008939 Ga0495643_0008939_2546_3727 393
149 iso_pu_bacteria 2898713307 2898715412 393
150 2162886007 SwRhRL2b_contig_3952261 SwRhRL2b_0141.00000220 394
151 3300003323 rootH1_10079181 rootH1_100791813 394
152 3300005288 Ga0065714_10002765 Ga0065714_1000276534 394
153 3300005288 Ga0065714_10071579 Ga0065714_100715792 394
154 3300005288 Ga0065714_10072479 Ga0065714_100724792 394
155 3300005289 Ga0065704_10070264 Ga0065704_1007026431 394
156 3300005289 Ga0065704_10079640 Ga0065704_100796403 394
157 3300005293 Ga0065715_10138155 Ga0065715_101381552 394
158 3300005327 Ga0070658_10047175 Ga0070658_100471752 394
159 3300005336 Ga0070680_100036160 Ga0070680_1000361601 394
160 3300005339 Ga0070660_100012108 Ga0070660_1000121082 394
161 3300005339 Ga0070660_100182989 Ga0070660_1001829892 394
162 3300005366 Ga0070659_100192111 Ga0070659_1001921111 394
163 3300005458 Ga0070681_10039561 Ga0070681_100395614 394
164 3300005459 Ga0068867_100013030 Ga0068867_1000130302 394
165 3300005530 Ga0070679_100093905 Ga0070679_1000939053 394
166 3300005563 Ga0068855_100004847 Ga0068855_1000048477 394
167 3300005563 Ga0068855_100007169 Ga0068855_1000071695 394
168 3300005578 Ga0068854_100027693 Ga0068854_1000276932 394
169 3300005614 Ga0068856_100018095 Ga0068856_1000180953 394
170 3300005614 Ga0068856_100075897 Ga0068856_1000758972 394
171 3300005719 Ga0068861_100142500 Ga0068861_1001425002 394
172 3300009093 Ga0105240_10063764 Ga0105240_100637643 394
173 3300009174 Ga0105241_10045909 Ga0105241_100459093 394
174 3300009176 Ga0105242_10048343 Ga0105242_100483433 394
175 3300013100 Ga0157373_10000043 Ga0157373_1000004339 394
176 3300013102 Ga0157371_10000416 Ga0157371_100004165 394
177 3300013102 Ga0157371_10001859 Ga0157371_100018599 394
178 3300013102 Ga0157371_10002197 Ga0157371_1000219711 394
179 3300013104 Ga0157370_10000333 Ga0157370_100003336 394
180 3300013104 Ga0157370_10000457 Ga0157370_1000045734 394
181 3300013104 Ga0157370_10014508 Ga0157370_100145084 394
182 3300013105 Ga0157369_10129948 Ga0157369_101299481 394
183 3300013105 Ga0157369_10146430 Ga0157369_101464302 394
184 3300013296 Ga0157374_10065390 Ga0157374_100653902 394
185 3300014497 Ga0182008_10074193 Ga0182008_100741932 394
186 3300015262 Ga0182007_10006171 Ga0182007_100061713 394
187 3300015262 Ga0182007_10018380 Ga0182007_100183802 394
188 3300017792 Ga0163161_10000391 Ga0163161_100003919 394
189 3300025909 Ga0207705_10049290 Ga0207705_100492902 394
190 3300025919 Ga0207657_10005273 Ga0207657_100052732 394
191 3300025921 Ga0207652_10000074 Ga0207652_1000007413 394
192 3300025921 Ga0207652_10103836 Ga0207652_101038362 394
193 3300025921 Ga0207652_10228687 Ga0207652_102286871 394
194 3300025949 Ga0207667_10023551 Ga0207667_100235512 394
195 3300025949 Ga0207667_10035891 Ga0207667_100358915 394
196 3300025949 Ga0207667_10054883 Ga0207667_100548832 394
197 3300026041 Ga0207639_10361061 Ga0207639_103610611 394
198 3300026078 Ga0207702_10040415 Ga0207702_100404152 394
199 3300026078 Ga0207702_10089527 Ga0207702_100895272 394
200 3300026089 Ga0207648_10002281 Ga0207648_1000228111 394
201 3300031911 Ga0307412_10000075 Ga0307412_1000007544 394
202 3300032004 Ga0307414_10000509 Ga0307414_1000050910 394
203 3300032004 Ga0307414_10032744 Ga0307414_100327442 394
204 3300037312 Ga0395899_0000011 Ga0395899_0000011_327296_328480 394
205 3300037312 Ga0395899_0019606 Ga0395899_0019606_3914_5098 394
206 3300037418 Ga0395900_0123008 Ga0395900_0123008_818_2002 394
207 3300037466 Ga0395898_0190185 Ga0395898_0190185_616_1800 394
208 3300038443 Ga0395901_0016163 Ga0395901_0016163_776_1960 394
209 3300049574 Ga0501038_0057097 Ga0501038_0057097_1125_2321 394
210 3300049823 Ga0501044_0022879 Ga0501044_0022879_2426_3622 394
211 3300053093 Ga0500651_0000625 Ga0500651_0000625_13106_14290 394
212 iso_pu_bacteria 2721755487 2722726725 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07221

GlcNAc_2-epim

N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)

37

371

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bs0-assembly1.cif.gz_A room-temperature structure of pedobacter heparinus n-acetylglucosamine 2-epimerase at 80 mpa helium gas pressure in a sapphire capillary 0.9866 3 393
8bs0-assembly1.cif.gz_A room-temperature structure of pedobacter heparinus n-acetylglucosamine 2-epimerase at 80 mpa helium gas pressure in a sapphire capillary 0.9765 3 393
6f04-assembly1.cif.gz_A-2 n-acetylglucosamine-2-epimerase 0.9551 7 389
2gz6-assembly1.cif.gz_A crystal structure of anabaena sp. ch1 n-acetyl-d-glucosamine 2-epimerase at 2.0 a 0.9424 7 394
2gz6-assembly1.cif.gz_B crystal structure of anabaena sp. ch1 n-acetyl-d-glucosamine 2-epimerase at 2.0 a 0.9421 8 394
ID Description Score Start End Superfamily
6f04A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9551 7 389 1.50.10.10
6f04A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9357 7 389 1.50.10.10
1fp3A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9345 4 393 1.50.10.10
1fp3A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9231 4 393 1.50.10.10
3wkiA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8592 1 393 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A353F4G4-F1-model_v4 N-acylglucosamine 2-epimerase 0.9915 28 155 GO:0005975
GO:0016853
AF-A0A3C0Z6V1-F1-model_v4 N-acylglucosamine 2-epimerase 0.99 5 107 GO:0005975
GO:0016853
AF-A0A4R3VVW7-F1-model_v4 N-acylglucosamine 2-epimerase 0.9875 3 393 GO:0005975
GO:0016853
AF-A0A7V4MIN5-F1-model_v4 N-acylglucosamine 2-epimerase 0.9825 3 390 GO:0005975
GO:0016853
AF-X1R6I7-F1-model_v4 N-acylglucosamine 2-epimerase 0.9813 3 113 GO:0005975
GO:0016853

Feature Viewer

pLDDT pTM Quality
90.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map