F323076

General Info

Members Datasets Scaffolds Average Seq Length
212 169 142 267

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0116768|Ga0395899_0116768_825_1733
Length 302
Sequence MSQRRVDLPPESSSYTSANAPSEGRLPLFILVQLWRFGWQEALSCLFPAAIFAALLLLRIAPIPHVPAYDAMLVVCIVLQWVMVRTKLETLDELKVICVFHLIGLALELYKVHMGSWTYPQDAYTKIGGVPLYSGFMYASVASYLCQAWRRLDVALLHWPRSYWTVPLGAAIYLNFMTHHYIPDLRWWLTALLFVVFFRTVVTFRVGDARYRMPLTLGFLLIGFFVWIAENIGTFLGAWRYPNQEHAWNLVSIGKISSWFLLVIVSFIIVAQLKHVKQGRKQAPGTDAGRSSEASYPRDMGG

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
8 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
9 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
10 2643221731 Bacillus sp. Root147 Isolate Unclassified
11 2643221732 Bacillus sp. Root239 Isolate Unclassified
12 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
13 2671180694 Paenibacillus sp. A3 Isolate Unclassified
14 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
15 2738543010 Bacillus sp. YR335 Isolate Unclassified
16 2738543017 Bacillus sp. OV186 Isolate Unclassified
17 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
18 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
19 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
20 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
21 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
22 2818991441 Niallia circulans 3243 Isolate Rhizosphere
23 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
24 2842682962 Bacillus sp. R-72492 Isolate Unclassified
25 2842882022 Bacillus sp. R-71893 Isolate Unclassified
26 2849139964 Bacillus sp. R-71875 Isolate Unclassified
27 2857581216 Bacillus sp. R-71922 Isolate Unclassified
28 2857586860 Bacillus sp. R-71935 Isolate Unclassified
29 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
30 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
31 2860837431 Bacillus sp. WR11 Isolate Unclassified
32 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
33 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
34 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
35 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
36 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
37 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
38 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
39 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
40 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
41 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
42 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
43 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
44 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
45 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
46 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
47 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
48 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
49 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
50 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
51 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
52 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
53 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
54 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
55 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
56 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
57 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
58 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
59 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 8022653035 Bacillus sp. Rc4 Isolate Unclassified
163 8022792930 Bacillus sp. Xin Isolate Rhizosphere
164 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
165 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
166 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
167 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
168 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
169 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.98
Metatranscriptomes 0
Isolates 33.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.62
Nodule 0.47
Rhizoplane 8.02
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 25.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023063 3300001989 Bacteria 2202
2 JGI24739J22299_10024176 3300001989 Bacteria 2144
3 JGI24737J22298_10000984 3300001990 Bacteria 10125
4 JGI24735J21928_10000004 3300002067 Bacteria 381713
5 JGI25162J39368_1000089 3300002737 Bacteria 104054
6 JGI25162J39368_1000614 3300002737 Bacteria 25616
7 JGI25151J46595_10002839 3300003187 Bacteria 9978
8 JGI25151J46595_10004504 3300003187 Bacteria 7362
9 JGI25151J46595_10027142 3300003187 Bacteria 2301
10 JGI25151J46595_10029484 3300003187 Bacteria 2172
11 JGI25165J46597_1002726 3300003214 Bacteria 5214
12 rootH1_10047779 3300003316 Bacteria 4816
13 rootH2_10323693 3300003320 Bacteria 2757
14 rootL2_10087581 3300003322 Bacteria 2686
15 Ga0055532_1000126 3300003758 Bacteria 76489
16 Ga0055532_1001188 3300003758 Bacteria 7826
17 Ga0055532_1003499 3300003758 Bacteria 2662
18 Ga0055535_1005377 3300003761 Bacteria 2825
19 Ga0055541_1000226 3300003841 Bacteria 21639
20 Ga0070658_10000956 3300005327 Bacteria 24688
21 Ga0070660_100196288 3300005339 Unclassified 1636
22 Ga0070663_100000310 3300005455 Bacteria 25165
23 Ga0068853_100000022 3300005539 Bacteria 142647
24 Ga0068857_100149779 3300005577 Bacteria 2113
25 Ga0068854_100012299 3300005578 Bacteria 5601
26 Ga0068856_100028642 3300005614 Bacteria 5441
27 Ga0068860_100144510 3300005843 Unclassified 2288
28 Ga0105244_10095657 3300009036 Bacteria 1457
29 Ga0105240_10364585 3300009093 Bacteria 1635
30 Ga0105237_10001497 3300009545 Bacteria 30756
31 Ga0105237_10009703 3300009545 Bacteria 10299
32 Ga0105239_10000999 3300010375 Bacteria 39639
33 Ga0157371_10002190 3300013102 Bacteria 18963
34 Ga0157371_10019909 3300013102 Bacteria 4944
35 Ga0157369_10000393 3300013105 Bacteria 58167
36 Ga0157374_10464663 3300013296 Bacteria 1267
37 Ga0157372_10000034 3300013307 Bacteria 174784
38 Ga0157372_10010741 3300013307 Bacteria 9747
39 Ga0157372_10016679 3300013307 Bacteria 7884
40 Ga0157377_10078463 3300014745 Bacteria 1925
41 Ga0157379_10019083 3300014968 Bacteria 6055
42 Ga0163161_10025903 3300017792 Bacteria 4153
43 Ga0209566_100035 3300025225 Bacteria 314893
44 Ga0209147_100042 3300025229 Bacteria 301263
45 Ga0209147_100182 3300025229 Bacteria 76541
46 Ga0209147_101079 3300025229 Bacteria 11475
47 Ga0207427_100103 3300025231 Bacteria 119618
48 Ga0209437_100101 3300025233 Bacteria 226668
49 Ga0209437_100221 3300025233 Bacteria 104135
50 Ga0209258_106561 3300025242 Bacteria 1811
51 Ga0209233_1000124 3300025261 Bacteria 226743
52 Ga0209673_1014765 3300025273 Bacteria 3007
53 Ga0209025_1003012 3300025294 Bacteria 16658
54 Ga0209025_1006283 3300025294 Bacteria 9290
55 Ga0209025_1006685 3300025294 Bacteria 8853
56 Ga0209025_1011774 3300025294 Bacteria 5705
57 Ga0209025_1013788 3300025294 Bacteria 5044
58 Ga0209025_1041071 3300025294 Bacteria 1988
59 Ga0207655_1008935 3300025728 Bacteria 6288
60 Ga0207713_1009677 3300025735 Bacteria 5404
61 Ga0207685_10242786 3300025905 Bacteria 867
62 Ga0207705_10002841 3300025909 Bacteria 13243
63 Ga0207695_10270225 3300025913 Bacteria 1596
64 Ga0207671_10002034 3300025914 Bacteria 22208
65 Ga0207671_10005705 3300025914 Bacteria 11371
66 Ga0207671_10006458 3300025914 Bacteria 10439
67 Ga0207667_10017757 3300025949 Bacteria 8002
68 Ga0207640_10054901 3300025981 Bacteria 2607
69 Ga0207639_10000002 3300026041 Bacteria 903066
70 Ga0207702_10227966 3300026078 Bacteria 1739
71 Ga0207674_10169782 3300026116 Bacteria 2135
72 Ga0268264_10190166 3300028381 Unclassified 1871
73 Ga0307517_10043849 3300028786 Bacteria 4750
74 Ga0307408_100000542 3300031548 Bacteria 32556
75 Ga0307408_100373649 3300031548 Bacteria 1216
76 Ga0307405_10562195 3300031731 Bacteria 925
77 Ga0307416_100042727 3300032002 Bacteria 3542
78 Ga0307416_100200021 3300032002 Bacteria 1895
79 Ga0307416_100481751 3300032002 Bacteria 1301
80 Ga0307510_10029794 3300033180 Bacteria 6203
81 Ga0395899_0000182 3300037312 Bacteria 92470
82 Ga0395899_0101075 3300037312 Bacteria 2081
83 Ga0395899_0116768 3300037312 Bacteria 1914
84 Ga0395900_0199606 3300037418 Bacteria 2025
85 Ga0439449_0081636 3300042007 Bacteria 1192
86 Ga0466969_0003049 3300044656 Bacteria 8931
87 Ga0466966_0011419 3300044684 Bacteria 5891
88 Ga0466961_0018532 3300044693 Bacteria 4479
89 Ga0466959_0015655 3300045049 Bacteria 5529
90 Ga0495650_0000132 3300046471 Bacteria 174226
91 Ga0495583_0042257 3300046506 Bacteria 2130
92 Ga0495606_0000100 3300046507 Bacteria 147592
93 Ga0495606_0004289 3300046507 Bacteria 14369
94 Ga0495610_0001613 3300046512 Bacteria 19831
95 Ga0495610_0015285 3300046512 Bacteria 4467
96 Ga0495616_0004320 3300046513 Bacteria 8974
97 Ga0495631_0091566 3300046518 Bacteria 1309
98 Ga0495632_0079611 3300046519 Bacteria 1564
99 Ga0495633_0008919 3300046558 Bacteria 5591
100 Ga0495668_0056520 3300046616 Bacteria 2166
101 Ga0495625_0000036 3300046660 Bacteria 221680
102 Ga0495625_0027565 3300046660 Bacteria 4274
103 Ga0495625_0261314 3300046660 Bacteria 1120
104 Ga0495669_0164792 3300046684 Bacteria 1053
105 Ga0495671_0082107 3300046692 Bacteria 1579
106 Ga0495649_0000017 3300046694 Bacteria 221685
107 Ga0495683_0052236 3300047323 Bacteria 2041
108 Ga0495683_0149602 3300047323 Bacteria 1088
109 Ga0495687_001261 3300047443 Bacteria 23987
110 Ga0496100_0029946 3300048903 Bacteria 3371
111 Ga0496102_0109023 3300048905 Bacteria 2579
112 Ga0496103_0045097 3300048906 Bacteria 2719
113 Ga0496104_0070430 3300048907 Bacteria 3324
114 Ga0496104_0216284 3300048907 Bacteria 1828
115 Ga0496105_0001971 3300048908 Bacteria 14768
116 Ga0496106_0004898 3300048909 Bacteria 9913
117 Ga0496107_0008218 3300048910 Bacteria 7218
118 Ga0496108_0001083 3300048911 Bacteria 21241
119 Ga0496109_0042809 3300048912 Bacteria 4103
120 Ga0496110_0019076 3300048913 Bacteria 5765
121 Ga0496110_0040388 3300048913 Bacteria 4066
122 Ga0496111_0000453 3300048914 Bacteria 20871
123 Ga0496111_0054561 3300048914 Bacteria 2889
124 Ga0496112_0029620 3300048915 Bacteria 5294
125 Ga0496118_0076267 3300048921 Bacteria 2385
126 Ga0496119_0009419 3300048922 Bacteria 8386
127 Ga0496119_0011249 3300048922 Bacteria 7443
128 Ga0496120_0000644 3300048923 Bacteria 51437
129 Ga0496122_0007692 3300048925 Bacteria 11879
130 Ga0496122_0060615 3300048925 Bacteria 2785
131 Ga0496123_0123341 3300048926 Bacteria 1452
132 Ga0496123_0174082 3300048926 Bacteria 1132
133 Ga0496124_0000062 3300048927 Bacteria 232676
134 Ga0496124_0138276 3300048927 Bacteria 1926
135 Ga0496125_0071578 3300048928 Bacteria 2707
136 Ga0496126_0000250 3300048929 Bacteria 116245
137 Ga0496126_0001176 3300048929 Bacteria 43034
138 Ga0496126_0032756 3300048929 Bacteria 4893
139 Ga0495678_014355 3300049459 Bacteria 3685
140 nmdc:mga0k408_17942_c1 3300050493 Bacteria 3945
141 Ga0500635_0028687 3300053080 Bacteria 1780
142 Ga0500608_000829 3300053122 Bacteria 11186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100000022 Ga0068853_10000002247 234
2 3300026041 Ga0207639_10000002 Ga0207639_10000002239 234
3 3300046519 Ga0495632_0079611 Ga0495632_0079611_338_1162 234
4 iso_pu_bacteria 2857591370 2857591524 238
5 3300037312 Ga0395899_0101075 Ga0395899_0101075_1099_1869 239
6 iso_pu_bacteria 2925326138 2925329848 247
7 iso_pu_bacteria 3006973921 3006977537 248
8 iso_pu_bacteria 2576861424 2578334699 249
9 iso_pu_bacteria 2971511577 2971513675 249
10 iso_pu_bacteria 2971511577 2971513686 249
11 iso_pu_bacteria 8022948649 8022950462 249
12 iso_pu_bacteria 2571042588 2573038952 250
13 iso_pu_bacteria 2579778775 2580934772 250
14 iso_pu_bacteria 2619619294 2621272726 250
15 iso_pu_bacteria 2980176882 2980178516 250
16 iso_pu_bacteria 2643221731 2644717886 251
17 iso_pu_bacteria 2643221732 2644724788 251
18 iso_pu_bacteria 2818991441 2819571633 251
19 iso_pu_bacteria 2818991465 2819707048 251
20 iso_pu_bacteria 2842882022 2842882641 251
21 iso_pu_bacteria 2904524088 2904526693 251
22 iso_pu_bacteria 2919143609 2919144713 251
23 iso_pu_bacteria 2928093941 2928095205 251
24 iso_pu_bacteria 2960319331 2960324234 251
25 iso_pu_bacteria 2960375949 2960377589 251
26 iso_pu_bacteria 8022893055 8022897366 251
27 iso_pu_bacteria 8022914991 8022919108 251
28 3300005843 Ga0068860_100144510 Ga0068860_1001445102 252
29 3300028381 Ga0268264_10190166 Ga0268264_101901662 252
30 3300009036 Ga0105244_10095657 Ga0105244_100956571 253
31 iso_pu_bacteria 2671180694 2673823616 253
32 iso_pu_bacteria 2738541299 2738840073 253
33 iso_pu_bacteria 2738543010 2739230962 253
34 iso_pu_bacteria 2808606399 2809056842 253
35 iso_pu_bacteria 2842882022 2842888140 253
36 iso_pu_bacteria 2860837431 2860839474 253
37 iso_pu_bacteria 2956897341 2956901387 253
38 iso_pu_bacteria 2969136845 2969138857 253
39 iso_pu_bacteria 2969765954 2969766910 253
40 iso_pu_bacteria 2969770375 2969774632 253
41 iso_pu_bacteria 2980176882 2980178528 253
42 iso_pu_bacteria 2980492589 2980494659 253
43 iso_pu_bacteria 3006826541 3006828083 253
44 iso_pu_bacteria 3006879489 3006881274 253
45 iso_pu_bacteria 8022653035 8022654061 253
46 iso_pu_bacteria 8022792930 8022796047 253
47 iso_pu_bacteria 8057582654 8057583818 253
48 3300003758 Ga0055532_1000126 Ga0055532_100012666 254
49 3300005577 Ga0068857_100149779 Ga0068857_1001497792 254
50 3300005614 Ga0068856_100028642 Ga0068856_1000286426 254
51 3300013102 Ga0157371_10019909 Ga0157371_100199096 254
52 3300025229 Ga0209147_100182 Ga0209147_10018212 254
53 3300026078 Ga0207702_10227966 Ga0207702_102279661 254
54 3300026116 Ga0207674_10169782 Ga0207674_101697822 254
55 3300046616 Ga0495668_0056520 Ga0495668_0056520_522_1289 254
56 3300053080 Ga0500635_0028687 Ga0500635_0028687_617_1381 254
57 iso_pu_bacteria 2510917027 2511179768 254
58 iso_pu_bacteria 2512564013 2512639110 254
59 iso_pu_bacteria 2775507177 2777763419 254
60 iso_pu_bacteria 2816332295 2817479624 254
61 iso_pu_bacteria 2915597211 2915600848 254
62 iso_pu_bacteria 2915606848 2915607007 254
63 iso_pu_bacteria 2929183550 2929185986 254
64 iso_pu_bacteria 2936340661 2936343428 254
65 iso_pu_bacteria 2964375228 2964379617 254
66 iso_pu_bacteria 3006858327 3006859955 254
67 iso_pu_bacteria 8055632911 8055632971 254
68 3300003322 rootL2_10087581 rootL2_100875813 255
69 3300003758 Ga0055532_1003499 Ga0055532_10034993 255
70 3300013296 Ga0157374_10464663 Ga0157374_104646631 255
71 3300014745 Ga0157377_10078463 Ga0157377_100784632 255
72 3300025229 Ga0209147_101079 Ga0209147_10107913 255
73 3300025273 Ga0209673_1014765 Ga0209673_10147652 255
74 3300025294 Ga0209025_1011774 Ga0209025_10117744 255
75 3300025294 Ga0209025_1041071 Ga0209025_10410711 255
76 3300025728 Ga0207655_1008935 Ga0207655_10089356 255
77 3300025735 Ga0207713_1009677 Ga0207713_10096773 255
78 3300025905 Ga0207685_10242786 Ga0207685_102427861 255
79 3300032002 Ga0307416_100481751 Ga0307416_1004817511 255
80 3300042007 Ga0439449_0081636 Ga0439449_0081636_252_1106 255
81 3300048903 Ga0496100_0029946 Ga0496100_0029946_1918_2724 255
82 3300048905 Ga0496102_0109023 Ga0496102_0109023_1582_2388 255
83 3300048906 Ga0496103_0045097 Ga0496103_0045097_1722_2528 255
84 3300048907 Ga0496104_0070430 Ga0496104_0070430_687_1493 255
85 3300048908 Ga0496105_0001971 Ga0496105_0001971_979_1785 255
86 3300048909 Ga0496106_0004898 Ga0496106_0004898_2311_3117 255
87 3300048910 Ga0496107_0008218 Ga0496107_0008218_4527_5333 255
88 3300048911 Ga0496108_0001083 Ga0496108_0001083_5032_5838 255
89 3300048912 Ga0496109_0042809 Ga0496109_0042809_2530_3336 255
90 3300048913 Ga0496110_0040388 Ga0496110_0040388_3069_3875 255
91 3300048914 Ga0496111_0000453 Ga0496111_0000453_1795_2601 255
92 3300048915 Ga0496112_0029620 Ga0496112_0029620_2690_3496 255
93 3300048921 Ga0496118_0076267 Ga0496118_0076267_1364_2170 255
94 3300048922 Ga0496119_0009419 Ga0496119_0009419_2915_3721 255
95 3300048922 Ga0496119_0011249 Ga0496119_0011249_2826_3650 255
96 3300048923 Ga0496120_0000644 Ga0496120_0000644_10670_11494 255
97 3300048925 Ga0496122_0007692 Ga0496122_0007692_3312_4136 255
98 3300048925 Ga0496122_0060615 Ga0496122_0060615_238_1008 255
99 3300048926 Ga0496123_0123341 Ga0496123_0123341_169_993 255
100 3300048926 Ga0496123_0174082 Ga0496123_0174082_14_784 255
101 3300048927 Ga0496124_0000062 Ga0496124_0000062_123444_124268 255
102 3300048927 Ga0496124_0138276 Ga0496124_0138276_657_1463 255
103 3300048928 Ga0496125_0071578 Ga0496125_0071578_127_933 255
104 3300048929 Ga0496126_0000250 Ga0496126_0000250_83393_84217 255
105 3300048929 Ga0496126_0001176 Ga0496126_0001176_638_1408 255
106 3300048929 Ga0496126_0032756 Ga0496126_0032756_1493_2299 255
107 iso_pu_bacteria 2738543017 2739269099 255
108 iso_pu_bacteria 2757320391 2757565141 255
109 iso_pu_bacteria 2857586860 2857588046 255
110 iso_pu_bacteria 2857604169 2857608447 255
111 iso_pu_bacteria 8057733483 8057736158 255
112 3300003187 JGI25151J46595_10027142 JGI25151J46595_100271422 256
113 3300003187 JGI25151J46595_10029484 JGI25151J46595_100294842 256
114 3300003761 Ga0055535_1005377 Ga0055535_10053772 256
115 3300003841 Ga0055541_1000226 Ga0055541_100022620 256
116 3300005327 Ga0070658_10000956 Ga0070658_100009568 256
117 3300005339 Ga0070660_100196288 Ga0070660_1001962881 256
118 3300025225 Ga0209566_100035 Ga0209566_1000351 256
119 3300025242 Ga0209258_106561 Ga0209258_1065612 256
120 3300025294 Ga0209025_1006685 Ga0209025_10066859 256
121 3300025294 Ga0209025_1013788 Ga0209025_10137882 256
122 3300025909 Ga0207705_10002841 Ga0207705_100028411 256
123 iso_pu_bacteria 2898907183 2898910051 256
124 3300003187 JGI25151J46595_10002839 JGI25151J46595_100028398 257
125 3300003187 JGI25151J46595_10004504 JGI25151J46595_100045047 257
126 3300014968 Ga0157379_10019083 Ga0157379_100190832 257
127 3300025294 Ga0209025_1003012 Ga0209025_10030127 257
128 3300025294 Ga0209025_1006283 Ga0209025_10062832 257
129 3300031548 Ga0307408_100000542 Ga0307408_10000054212 257
130 3300031548 Ga0307408_100373649 Ga0307408_1003736491 257
131 3300031731 Ga0307405_10562195 Ga0307405_105621951 257
132 3300032002 Ga0307416_100042727 Ga0307416_1000427274 257
133 3300032002 Ga0307416_100200021 Ga0307416_1002000212 257
134 3300048907 Ga0496104_0216284 Ga0496104_0216284_527_1417 257
135 3300048913 Ga0496110_0019076 Ga0496110_0019076_3921_4811 257
136 3300048914 Ga0496111_0054561 Ga0496111_0054561_1142_2032 257
137 iso_pu_bacteria 2599185184 2599478374 257
138 iso_pu_bacteria 2671180330 2672337523 257
139 iso_pu_bacteria 2816332186 2816862066 257
140 iso_pu_bacteria 2842682962 2842686646 257
141 iso_pu_bacteria 2849139964 2849141593 257
142 iso_pu_bacteria 2857581216 2857583964 257
143 iso_pu_bacteria 2928078545 2928080575 257
144 iso_pu_bacteria 2928147474 2928150800 257
145 iso_pu_bacteria 2929206907 2929207965 257
146 iso_pu_bacteria 2932082852 2932083043 257
147 3300002737 JGI25162J39368_1000089 JGI25162J39368_100008937 258
148 3300003758 Ga0055532_1001188 Ga0055532_10011882 258
149 3300005578 Ga0068854_100012299 Ga0068854_1000122995 258
150 3300009545 Ga0105237_10009703 Ga0105237_100097036 258
151 3300010375 Ga0105239_10000999 Ga0105239_1000099917 258
152 3300017792 Ga0163161_10025903 Ga0163161_100259036 258
153 3300025229 Ga0209147_100042 Ga0209147_100042242 258
154 3300025233 Ga0209437_100221 Ga0209437_10022171 258
155 3300025914 Ga0207671_10002034 Ga0207671_1000203410 258
156 3300025914 Ga0207671_10005705 Ga0207671_100057053 258
157 3300025949 Ga0207667_10017757 Ga0207667_100177573 258
158 3300025981 Ga0207640_10054901 Ga0207640_100549013 258
159 3300028786 Ga0307517_10043849 Ga0307517_100438496 258
160 3300033180 Ga0307510_10029794 Ga0307510_100297947 258
161 3300044656 Ga0466969_0003049 Ga0466969_0003049_3855_4700 258
162 3300045049 Ga0466959_0015655 Ga0466959_0015655_1442_2287 258
163 3300046518 Ga0495631_0091566 Ga0495631_0091566_369_1193 258
164 3300046684 Ga0495669_0164792 Ga0495669_0164792_192_1016 258
165 3300047323 Ga0495683_0149602 Ga0495683_0149602_116_940 258
166 3300053122 Ga0500608_000829 Ga0500608_000829_3715_4548 258
167 iso_pu_bacteria 2524023129 2524189736 258
168 iso_pu_bacteria 2864997549 2864998401 258
169 3300037312 Ga0395899_0116768 Ga0395899_0116768_825_1733 259
170 3300046507 Ga0495606_0004289 Ga0495606_0004289_5409_6188 259
171 iso_pu_bacteria 2593339131 2595089384 259
172 3300001989 JGI24739J22299_10023063 JGI24739J22299_100230632 261
173 3300001989 JGI24739J22299_10024176 JGI24739J22299_100241762 261
174 3300001990 JGI24737J22298_10000984 JGI24737J22298_100009845 261
175 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000459 261
176 3300002737 JGI25162J39368_1000614 JGI25162J39368_100061414 261
177 3300003214 JGI25165J46597_1002726 JGI25165J46597_10027266 261
178 3300003316 rootH1_10047779 rootH1_100477792 261
179 3300003320 rootH2_10323693 rootH2_103236934 261
180 3300005455 Ga0070663_100000310 Ga0070663_10000031014 261
181 3300009093 Ga0105240_10364585 Ga0105240_103645852 261
182 3300009545 Ga0105237_10001497 Ga0105237_100014976 261
183 3300013102 Ga0157371_10002190 Ga0157371_1000219016 261
184 3300013105 Ga0157369_10000393 Ga0157369_1000039312 261
185 3300013307 Ga0157372_10000034 Ga0157372_10000034110 261
186 3300013307 Ga0157372_10010741 Ga0157372_1001074113 261
187 3300013307 Ga0157372_10016679 Ga0157372_100166792 261
188 3300025231 Ga0207427_100103 Ga0207427_100103104 261
189 3300025233 Ga0209437_100101 Ga0209437_100101125 261
190 3300025261 Ga0209233_1000124 Ga0209233_1000124112 261
191 3300025913 Ga0207695_10270225 Ga0207695_102702252 261
192 3300025914 Ga0207671_10006458 Ga0207671_100064587 261
193 3300037312 Ga0395899_0000182 Ga0395899_0000182_35833_36663 261
194 3300037418 Ga0395900_0199606 Ga0395900_0199606_1133_1963 261
195 3300044684 Ga0466966_0011419 Ga0466966_0011419_3621_4445 261
196 3300044693 Ga0466961_0018532 Ga0466961_0018532_1184_2008 261
197 3300046471 Ga0495650_0000132 Ga0495650_0000132_152203_152988 261
198 3300046506 Ga0495583_0042257 Ga0495583_0042257_753_1538 261
199 3300046507 Ga0495606_0000100 Ga0495606_0000100_131953_132738 261
200 3300046512 Ga0495610_0001613 Ga0495610_0001613_18894_19679 261
201 3300046512 Ga0495610_0015285 Ga0495610_0015285_527_1312 261
202 3300046513 Ga0495616_0004320 Ga0495616_0004320_5652_6473 261
203 3300046558 Ga0495633_0008919 Ga0495633_0008919_3221_4006 261
204 3300046660 Ga0495625_0000036 Ga0495625_0000036_44796_45617 261
205 3300046660 Ga0495625_0027565 Ga0495625_0027565_3111_3917 261
206 3300046660 Ga0495625_0261314 Ga0495625_0261314_48_884 261
207 3300046692 Ga0495671_0082107 Ga0495671_0082107_577_1398 261
208 3300046694 Ga0495649_0000017 Ga0495649_0000017_176071_176856 261
209 3300047323 Ga0495683_0052236 Ga0495683_0052236_584_1369 261
210 3300047443 Ga0495687_001261 Ga0495687_001261_18642_19427 261
211 3300049459 Ga0495678_014355 Ga0495678_014355_620_1426 261
212 3300050493 nmdc:mga0k408_17942_c1 nmdc:mga0k408_17942_c1_3043_3828 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05675

DUF817

Protein of unknown function (DUF817)

33

267

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xu4-assembly1.cif.gz_A crystal structure of a mycobacterial insig homolog mvins from mycobacterium vanbaalenii at 1.9a resolution 0.6375 62 241
4xu6-assembly1.cif.gz_A crystal structure of cross-linked mvins r77c trimer at 1.9a resolution 0.6326 62 255
4xu6-assembly1.cif.gz_A crystal structure of cross-linked mvins r77c trimer at 1.9a resolution 0.6176 62 255
4xu4-assembly1.cif.gz_A crystal structure of a mycobacterial insig homolog mvins from mycobacterium vanbaalenii at 1.9a resolution 0.5977 62 241
6m49-assembly1.cif.gz_A cryo-em structure of scap/insig complex in the present of 25-hydroxyl cholesterol. 0.5427 66 249
ID Description Score Start End Superfamily
af_K7U7E9_3_149_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.3854 172 253 3.30.420.40
af_Q4DSP7_48_153_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.3744 173 252 3.30.1520.10
af_Q9VK31_400_520_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.3465 173 245 3.30.1520.10
af_Q7XQV1_191_309_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.3338 173 261 3.30.200.20
3rklD00 Special;Helix non-globular;Helix Hairpins; 0.3304 176 247 6.10.140.1640
ID Description Score Start End GO Terms
AF-A0A4U3C2V6-F1-model_v4 deleted 0.9809 3 124
AF-A0A1N6V297-F1-model_v4 DUF817 domain-containing protein 0.9715 6 130 GO:0016020
AF-A0A358H288-F1-model_v4 deleted 0.9542 127 245
AF-A0A519JDZ4-F1-model_v4 DUF817 family protein 0.9506 116 247 GO:0016020
AF-A0A2N3D459-F1-model_v4 DUF817 domain-containing protein 0.9488 77 247 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.97 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map