F323340

General Info

Members Datasets Scaffolds Average Seq Length
212 146 207 446

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0021812|Ga0501046_0021812_2180_3793
Length 537
Sequence MKNSSTIMTKRRSLGEEAEELMDSIQGRGAVLRGDAGRREAEVCAEESPAIQPEDLRSGILPGCPRRAGAPIMRRVKPPLTCSHLSRRQFAKTLGAAALTAPFIARNLRAAPPSTVLRHASFGASGQAWNDIQAICSNPFVKLVAVADVDLGKVANVKATFPDVKIYQDWRELLDQEGNHLDSVNVSTPDHMHAPIALSAMQLGKHCYCEKPLAHDLHEVRVMTDYARGKKLVTQMGIQIHSQKVYRQAVAIVHSGVIGKVKEVHTWSNKKWGAAGAPPVSTDPVPEGFNWDLWTGRCAERPFVGHGYYHPGNWRKRLDFGTGTFGDMGCHIFDPVFESLALTAPLSLRSEGPAPDAWNWAINANIRYVFPGTKYTAGPTVEVTWHDGDSRPPAEIQALIAVPAPADETPAAKKRAASLLEQGSIIIGTEGVLHVPHIATPRLFPVEKYRDYKLPEVVGTHHWSDWAEACVGGPGKPTAGFDYSGPLTEAVLLGSVAVRFPETTLEWDSAKLAFTNEKAANAFVRSAYRKGWGVAGL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
3 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
4 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
5 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
6 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
79 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.55
Nodule 0
Rhizoplane 0.47
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3406522 2162886007 Bacteria 12647
2 rootH2_10202343 3300003320 Bacteria 5203
3 rootH1_10366203 3300003323 Bacteria 5394
4 Ga0065714_10002527 3300005288 Bacteria 43361
5 Ga0065704_10000217 3300005289 Bacteria 101781
6 Ga0065707_10101957 3300005295 Unclassified 2835
7 Ga0070689_100148079 3300005340 Bacteria 1892
8 Ga0070689_100187226 3300005340 Bacteria 1684
9 Ga0070668_100044584 3300005347 Bacteria 3402
10 Ga0070674_100001110 3300005356 Bacteria 14109
11 Ga0070663_100066131 3300005455 Bacteria 2619
12 Ga0070685_10125222 3300005466 Bacteria 1600
13 Ga0070698_100117944 3300005471 Bacteria 2616
14 Ga0070679_100183384 3300005530 Bacteria 2065
15 Ga0068853_100000005 3300005539 Bacteria 366404
16 Ga0068853_100095364 3300005539 Bacteria 2623
17 Ga0070672_100123845 3300005543 Bacteria 2119
18 Ga0070686_100020966 3300005544 Bacteria 3877
19 Ga0070665_100072743 3300005548 Unclassified 3445
20 Ga0070665_100260214 3300005548 Bacteria 1736
21 Ga0068855_100116117 3300005563 Unclassified 3068
22 Ga0068857_100002379 3300005577 Bacteria 15340
23 Ga0068856_100066600 3300005614 Bacteria 3559
24 Ga0068859_100125164 3300005617 Bacteria 2639
25 Ga0068863_100141072 3300005841 Bacteria 2303
26 Ga0075364_10011627 3300006051 Bacteria 5351
27 Ga0075367_10005695 3300006178 Bacteria 6222
28 Ga0075367_10075487 3300006178 Bacteria 2033
29 Ga0075366_10017989 3300006195 Bacteria 4077
30 Ga0097621_100041021 3300006237 Bacteria 3723
31 Ga0075370_10037693 3300006353 Bacteria 2718
32 Ga0075370_10059431 3300006353 Bacteria 2175
33 Ga0068871_100147772 3300006358 Bacteria 2003
34 Ga0075428_100005700 3300006844 Bacteria 13846
35 Ga0075428_100022191 3300006844 Bacteria 7028
36 Ga0075428_100045190 3300006844 Bacteria 4839
37 Ga0075431_100004908 3300006847 Bacteria 13173
38 Ga0075431_100023866 3300006847 Bacteria 6261
39 Ga0075433_10020553 3300006852 Bacteria 5523
40 Ga0075429_100019553 3300006880 Bacteria 5869
41 Ga0097620_100125163 3300006931 Bacteria 2639
42 Ga0105240_10000508 3300009093 Bacteria 71878
43 Ga0105240_10005960 3300009093 Bacteria 18032
44 Ga0105240_10016729 3300009093 Bacteria 9921
45 Ga0105240_10025172 3300009093 Bacteria 7827
46 Ga0105240_10045180 3300009093 Bacteria 5590
47 Ga0111539_10000996 3300009094 Bacteria 37109
48 Ga0111539_10039862 3300009094 Bacteria 5657
49 Ga0105245_10032666 3300009098 Bacteria 4608
50 Ga0114129_10000102 3300009147 Bacteria 84059
51 Ga0114129_10173844 3300009147 Bacteria 2934
52 Ga0114129_10188190 3300009147 Bacteria 2805
53 Ga0105238_10064655 3300009551 Bacteria 3658
54 Ga0157373_10000041 3300013100 Bacteria 113871
55 Ga0157371_10044469 3300013102 Bacteria 3162
56 Ga0157370_10041448 3300013104 Bacteria 4441
57 Ga0157370_10044656 3300013104 Bacteria 4257
58 Ga0157369_10038129 3300013105 Bacteria 5257
59 Ga0157369_10108687 3300013105 Unclassified 2949
60 Ga0157375_10000421 3300013308 Bacteria 38383
61 Ga0157375_10051519 3300013308 Bacteria 4043
62 Ga0163163_10000064 3300014325 Bacteria 117551
63 Ga0163163_10089913 3300014325 Bacteria 3083
64 Ga0182006_1004494 3300015261 Bacteria 6867
65 Ga0213876_10041664 3300021384 Bacteria 2426
66 Ga0209050_1002221 3300025298 Bacteria 17413
67 Ga0207695_10001082 3300025913 Bacteria 47597
68 Ga0207695_10022950 3300025913 Bacteria 7067
69 Ga0207695_10147018 3300025913 Bacteria 2300
70 Ga0207695_10236414 3300025913 Bacteria 1729
71 Ga0207694_10040281 3300025924 Bacteria 3596
72 Ga0207706_10093492 3300025933 Bacteria 2644
73 Ga0207670_10089635 3300025936 Bacteria 2171
74 Ga0207669_10002664 3300025937 Bacteria 7644
75 Ga0207691_10105388 3300025940 Bacteria 2512
76 Ga0207667_10127471 3300025949 Unclassified 2622
77 Ga0207639_10000010 3300026041 Bacteria 415264
78 Ga0207639_10075022 3300026041 Bacteria 2658
79 Ga0207678_10054535 3300026067 Bacteria 3443
80 Ga0207678_10062252 3300026067 Bacteria 3208
81 Ga0207641_10054276 3300026088 Bacteria 3400
82 Ga0207676_10019961 3300026095 Bacteria 4896
83 Ga0207674_10040181 3300026116 Bacteria 4848
84 Ga0207675_100104960 3300026118 Bacteria 2663
85 Ga0207428_10005077 3300027907 Bacteria 12359
86 Ga0265337_1010126 3300028556 Bacteria 3319
87 Ga0265318_10003665 3300028577 Bacteria 7669
88 Ga0265320_10006117 3300031240 Bacteria 7624
89 Ga0265327_10001447 3300031251 Bacteria 29880
90 Ga0265327_10002009 3300031251 Bacteria 22969
91 Ga0265327_10034797 3300031251 Bacteria 2791
92 Ga0265327_10095121 3300031251 Bacteria 1447
93 Ga0307408_100012573 3300031548 Bacteria 5610
94 Ga0265313_10007446 3300031595 Bacteria 7480
95 Ga0307412_10000033 3300031911 Bacteria 206649
96 Ga0307416_100048846 3300032002 Bacteria 3360
97 Ga0307416_100273914 3300032002 Bacteria 1659
98 Ga0307414_10002262 3300032004 Bacteria 10063
99 Ga0307414_10002564 3300032004 Bacteria 9554
100 Ga0373930_0008698 3300034816 Unclassified 1781
101 Ga0373926_0007366 3300035083 Bacteria 3666
102 Ga0373926_0015256 3300035083 Bacteria 2618
103 Ga0373928_0000391 3300035084 Bacteria 8717
104 Ga0373929_0000594 3300035085 Bacteria 7006
105 Ga0373932_0000001 3300035112 Bacteria 1459067
106 Ga0373946_0053984 3300035171 Bacteria 1690
107 Ga0373962_0002883 3300035242 Unclassified 4119
108 Ga0373931_0000004 3300035691 Bacteria 535140
109 Ga0373935_0011844 3300035692 Bacteria 5240
110 Ga0373935_0014248 3300035692 Bacteria 4799
111 Ga0373935_0133381 3300035692 Bacteria 1671
112 Ga0373927_0000848 3300035695 Bacteria 23328
113 Ga0373947_0005143 3300035725 Bacteria 7662
114 Ga0373925_0002040 3300037068 Bacteria 16664
115 Ga0373925_0008223 3300037068 Bacteria 7594
116 Ga0373925_0027372 3300037068 Unclassified 4173
117 Ga0395905_0072592 3300037471 Bacteria 3227
118 Ga0436365_1091509 3300039437 Bacteria 3903
119 Ga0451837_1196195 3300041494 Bacteria 3873
120 Ga0439464_0028545 3300042439 Bacteria 1555
121 Ga0451577_0000545 3300042876 Bacteria 61714
122 Ga0451577_0007436 3300042876 Bacteria 10757
123 Ga0451577_0030295 3300042876 Bacteria 4889
124 Ga0451577_0048323 3300042876 Bacteria 3801
125 Ga0451577_0121396 3300042876 Bacteria 2341
126 Ga0453684_0000093 3300044712 Bacteria 384050
127 Ga0453684_0012378 3300044712 Bacteria 14083
128 Ga0453684_0024476 3300044712 Bacteria 8822
129 Ga0453684_0050205 3300044712 Bacteria 5491
130 Ga0453684_0083244 3300044712 Bacteria 3983
131 Ga0453684_0109967 3300044712 Bacteria 3351
132 Ga0451576_0000146 3300045051 Bacteria 179707
133 Ga0451576_0001033 3300045051 Bacteria 51422
134 Ga0451576_0059704 3300045051 Bacteria 3981
135 Ga0451576_0096795 3300045051 Bacteria 3070
136 Ga0451576_0186500 3300045051 Bacteria 2166
137 Ga0495592_0100612 3300046454 Bacteria 2061
138 Ga0495639_0032930 3300046475 Bacteria 2313
139 Ga0495608_0005513 3300046511 Bacteria 9036
140 Ga0495618_0007571 3300046514 Bacteria 6573
141 Ga0495628_0056601 3300046516 Bacteria 3086
142 Ga0495630_0000135 3300046517 Bacteria 58009
143 Ga0495630_0000137 3300046517 Bacteria 57459
144 Ga0495630_0003164 3300046517 Bacteria 11426
145 Ga0495630_0036542 3300046517 Unclassified 3672
146 Ga0495666_0004427 3300046526 Bacteria 7099
147 Ga0495666_0022537 3300046526 Bacteria 3119
148 Ga0495586_0000033 3300046535 Bacteria 89808
149 Ga0495586_0001470 3300046535 Bacteria 12989
150 Ga0495586_0002193 3300046535 Bacteria 10602
151 Ga0495667_0023650 3300046559 Bacteria 4138
152 Ga0495634_0018634 3300046642 Bacteria 4938
153 Ga0495634_0019665 3300046642 Unclassified 4796
154 Ga0495658_0009974 3300046683 Bacteria 4740
155 Ga0495658_0020955 3300046683 Unclassified 3440
156 Ga0495658_0087807 3300046683 Bacteria 1837
157 Ga0495613_0010010 3300046689 Bacteria 7042
158 Ga0495613_0045627 3300046689 Unclassified 3241
159 Ga0495604_0178210 3300047317 Bacteria 1488
160 Ga0495674_0006026 3300047319 Bacteria 11648
161 Ga0495674_0168759 3300047319 Bacteria 1827
162 Ga0495672_0043092 3300047320 Bacteria 2716
163 Ga0495676_0091363 3300047321 Unclassified 2276
164 Ga0495680_0145888 3300047322 Bacteria 1729
165 Ga0496107_0130511 3300048910 Bacteria 1855
166 Ga0501031_0000052 3300049568 Bacteria 63006
167 Ga0501032_0007332 3300049569 Bacteria 8064
168 Ga0501033_0003164 3300049570 Bacteria 13678
169 Ga0501034_0010102 3300049571 Bacteria 9848
170 Ga0501041_0065007 3300049577 Bacteria 2234
171 Ga0501046_0021812 3300049580 Bacteria 5280
172 Ga0501046_0224923 3300049580 Bacteria 1388
173 Ga0501047_0029681 3300049581 Bacteria 5272
174 Ga0501047_0044123 3300049581 Bacteria 4307
175 Ga0501070_0189107 3300049586 Bacteria 1693
176 Ga0501071_0116689 3300049587 Bacteria 1976
177 Ga0501072_0047543 3300049588 Bacteria 3379
178 Ga0501075_0004554 3300049591 Bacteria 9396
179 Ga0501075_0080402 3300049591 Bacteria 2467
180 Ga0501216_004626 3300049660 Bacteria 2046
181 Ga0501217_013925 3300049661 Bacteria 1810
182 Ga0501235_025175 3300049669 Bacteria 1331
183 Ga0501079_0029164 3300049741 Unclassified 4235
184 Ga0501081_0018328 3300049743 Bacteria 4647
185 Ga0501035_0017640 3300049822 Bacteria 6584
186 Ga0501044_0002335 3300049823 Bacteria 21627
187 nmdc:mga0k408_8367_c1 3300050493 Bacteria 3270
188 nmdc:mga06z11_107029_c1 3300050494 Bacteria 1543
189 nmdc:mga06z11_19352_c1 3300050494 Bacteria 3128
190 nmdc:mga05p37_4440_c1 3300050507 Bacteria 16395
191 nmdc:mga09592_230466_c1 3300050508 Bacteria 1605
192 nmdc:mga0qj67_9422_c1 3300050509 Bacteria 7266
193 nmdc:mga06r32_18477_c1 3300050510 Bacteria 6383
194 nmdc:mga06r32_19267_c1 3300050510 Bacteria 6261
195 nmdc:mga08y16_214772_c1 3300050511 Bacteria 1992
196 nmdc:mga08y16_3556_c1 3300050511 Bacteria 16174
197 nmdc:mga0a205_105943_c1 3300050515 Bacteria 2710
198 Ga0495601_0001151 3300053077 Bacteria 14449
199 Ga0495612_0025161 3300053078 Bacteria 2390
200 Ga0495619_0001004 3300053085 Bacteria 18463
201 Ga0495619_0060276 3300053085 Bacteria 2522
202 Ga0500651_0001588 3300053093 Bacteria 11535
203 Ga0500555_001471 3300053103 Bacteria 7178
204 Ga0500568_0004513 3300053139 Bacteria 7416
205 Ga0500616_0000833 3300053153 Bacteria 34656
206 Ga0500616_0007425 3300053153 Bacteria 6969
207 Ga0500645_000279 3300053730 Bacteria 36588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0178210 Ga0495604_0178210_409_1476 352
2 3300035171 Ga0373946_0053984 Ga0373946_0053984_527_1642 365
3 3300046475 Ga0495639_0032930 Ga0495639_0032930_1169_2302 371
4 3300049580 Ga0501046_0224923 Ga0501046_0224923_25_1206 390
5 3300028556 Ga0265337_1010126 Ga0265337_10101263 393
6 3300044712 Ga0453684_0024476 Ga0453684_0024476_4678_6021 399
7 3300045051 Ga0451576_0059704 Ga0451576_0059704_1161_2390 403
8 3300009094 Ga0111539_10000996 Ga0111539_100009966 405
9 3300049660 Ga0501216_004626 Ga0501216_004626_737_1972 405
10 3300050507 nmdc:mga05p37_4440_c1 nmdc:mga05p37_4440_c1_4667_5902 405
11 3300050509 nmdc:mga0qj67_9422_c1 nmdc:mga0qj67_9422_c1_1303_2538 405
12 3300050510 nmdc:mga06r32_18477_c1 nmdc:mga06r32_18477_c1_2701_3936 405
13 3300050511 nmdc:mga08y16_3556_c1 nmdc:mga08y16_3556_c1_7569_8804 405
14 3300026088 Ga0207641_10054276 Ga0207641_100542762 408
15 3300026095 Ga0207676_10019961 Ga0207676_100199611 408
16 3300049586 Ga0501070_0189107 Ga0501070_0189107_428_1681 411
17 3300049669 Ga0501235_025175 Ga0501235_025175_54_1316 414
18 3300009147 Ga0114129_10173844 Ga0114129_101738442 419
19 3300050508 nmdc:mga09592_230466_c1 nmdc:mga09592_230466_c1_37_1326 419
20 3300009093 Ga0105240_10016729 Ga0105240_100167296 421
21 3300013105 Ga0157369_10038129 Ga0157369_100381292 423
22 3300003320 rootH2_10202343 rootH2_102023433 425
23 3300014325 Ga0163163_10089913 Ga0163163_100899131 429
24 3300049577 Ga0501041_0065007 Ga0501041_0065007_759_2087 430
25 3300049587 Ga0501071_0116689 Ga0501071_0116689_531_1859 430
26 3300049588 Ga0501072_0047543 Ga0501072_0047543_1450_2748 430
27 3300049591 Ga0501075_0004554 Ga0501075_0004554_2229_3527 430
28 3300049591 Ga0501075_0080402 Ga0501075_0080402_18_1346 430
29 3300049741 Ga0501079_0029164 Ga0501079_0029164_2134_3432 430
30 3300049743 Ga0501081_0018328 Ga0501081_0018328_2622_3920 430
31 iso_pu_bacteria 2671180531 2673165692 430
32 3300025933 Ga0207706_10093492 Ga0207706_100934923 431
33 3300035692 Ga0373935_0133381 Ga0373935_0133381_202_1623 431
34 3300005563 Ga0068855_100116117 Ga0068855_1001161172 432
35 3300006844 Ga0075428_100022191 Ga0075428_1000221915 432
36 3300006844 Ga0075428_100045190 Ga0075428_1000451903 432
37 3300006847 Ga0075431_100004908 Ga0075431_1000049086 432
38 3300006852 Ga0075433_10020553 Ga0075433_100205532 432
39 3300006880 Ga0075429_100019553 Ga0075429_1000195534 432
40 3300009094 Ga0111539_10039862 Ga0111539_100398624 432
41 3300009147 Ga0114129_10000102 Ga0114129_1000010271 432
42 3300009147 Ga0114129_10188190 Ga0114129_101881903 432
43 3300013105 Ga0157369_10108687 Ga0157369_101086872 432
44 3300021384 Ga0213876_10041664 Ga0213876_100416641 432
45 3300025949 Ga0207667_10127471 Ga0207667_101274712 432
46 3300027907 Ga0207428_10005077 Ga0207428_100050775 432
47 3300031548 Ga0307408_100012573 Ga0307408_1000125734 432
48 3300032002 Ga0307416_100048846 Ga0307416_1000488462 432
49 3300032002 Ga0307416_100273914 Ga0307416_1002739141 432
50 3300039437 Ga0436365_1091509 Ga0436365_1091509_35_1339 432
51 3300046454 Ga0495592_0100612 Ga0495592_0100612_41_1345 432
52 3300046514 Ga0495618_0007571 Ga0495618_0007571_535_1839 432
53 3300046683 Ga0495658_0087807 Ga0495658_0087807_42_1346 432
54 3300049661 Ga0501217_013925 Ga0501217_013925_275_1591 432
55 3300050511 nmdc:mga08y16_214772_c1 nmdc:mga08y16_214772_c1_227_1555 432
56 3300050515 nmdc:mga0a205_105943_c1 nmdc:mga0a205_105943_c1_513_1829 432
57 3300009093 Ga0105240_10000508 Ga0105240_1000050818 433
58 3300025913 Ga0207695_10001082 Ga0207695_1000108219 433
59 iso_pu_bacteria 2889415604 2889417828 433
60 iso_pu_bacteria 2920107658 2920109642 433
61 3300005356 Ga0070674_100001110 Ga0070674_1000011109 434
62 3300005841 Ga0068863_100141072 Ga0068863_1001410721 434
63 3300006051 Ga0075364_10011627 Ga0075364_100116273 434
64 3300025937 Ga0207669_10002664 Ga0207669_100026646 434
65 3300026067 Ga0207678_10054535 Ga0207678_100545353 434
66 3300042876 Ga0451577_0030295 Ga0451577_0030295_1379_2698 434
67 3300045051 Ga0451576_0001033 Ga0451576_0001033_44524_45933 434
68 3300046642 Ga0495634_0019665 Ga0495634_0019665_3415_4770 434
69 3300047320 Ga0495672_0043092 Ga0495672_0043092_24_1361 434
70 3300053139 Ga0500568_0004513 Ga0500568_0004513_681_2018 434
71 iso_pu_bacteria 2687453257 2688070162 434
72 3300005471 Ga0070698_100117944 Ga0070698_1001179442 435
73 3300005539 Ga0068853_100000005 Ga0068853_100000005230 435
74 3300026041 Ga0207639_10000010 Ga0207639_1000001069 435
75 3300042876 Ga0451577_0000545 Ga0451577_0000545_2593_3957 435
76 3300044712 Ga0453684_0083244 Ga0453684_0083244_862_2226 435
77 3300049581 Ga0501047_0029681 Ga0501047_0029681_477_1793 435
78 3300005347 Ga0070668_100044584 Ga0070668_1000445844 436
79 3300005455 Ga0070663_100066131 Ga0070663_1000661312 436
80 3300005543 Ga0070672_100123845 Ga0070672_1001238451 436
81 3300005548 Ga0070665_100260214 Ga0070665_1002602142 436
82 3300005614 Ga0068856_100066600 Ga0068856_1000666002 436
83 3300006178 Ga0075367_10005695 Ga0075367_100056955 436
84 3300006178 Ga0075367_10075487 Ga0075367_100754871 436
85 3300006195 Ga0075366_10017989 Ga0075366_100179892 436
86 3300006353 Ga0075370_10037693 Ga0075370_100376932 436
87 3300006353 Ga0075370_10059431 Ga0075370_100594312 436
88 3300025298 Ga0209050_1002221 Ga0209050_10022216 436
89 3300025940 Ga0207691_10105388 Ga0207691_101053882 436
90 3300026067 Ga0207678_10062252 Ga0207678_100622523 436
91 3300026118 Ga0207675_100104960 Ga0207675_1001049602 436
92 3300031251 Ga0265327_10034797 Ga0265327_100347972 436
93 3300037471 Ga0395905_0072592 Ga0395905_0072592_705_2057 436
94 3300042439 Ga0439464_0028545 Ga0439464_0028545_30_1373 436
95 3300045051 Ga0451576_0000146 Ga0451576_0000146_98445_99854 436
96 3300046511 Ga0495608_0005513 Ga0495608_0005513_2095_3420 436
97 3300046516 Ga0495628_0056601 Ga0495628_0056601_1104_2420 436
98 3300046559 Ga0495667_0023650 Ga0495667_0023650_1847_3172 436
99 3300050493 nmdc:mga0k408_8367_c1 nmdc:mga0k408_8367_c1_924_2249 436
100 3300050494 nmdc:mga06z11_107029_c1 nmdc:mga06z11_107029_c1_130_1455 436
101 3300050494 nmdc:mga06z11_19352_c1 nmdc:mga06z11_19352_c1_1001_2326 436
102 3300053077 Ga0495601_0001151 Ga0495601_0001151_7990_9315 436
103 3300053078 Ga0495612_0025161 Ga0495612_0025161_889_2205 436
104 3300053085 Ga0495619_0001004 Ga0495619_0001004_3503_4828 436
105 3300053085 Ga0495619_0060276 Ga0495619_0060276_758_2083 436
106 3300053153 Ga0500616_0007425 Ga0500616_0007425_4483_5823 436
107 iso_pu_bacteria 2687453341 2688393995 436
108 3300005340 Ga0070689_100187226 Ga0070689_1001872262 437
109 3300028577 Ga0265318_10003665 Ga0265318_100036654 437
110 3300031240 Ga0265320_10006117 Ga0265320_100061175 437
111 3300031595 Ga0265313_10007446 Ga0265313_100074463 437
112 3300035083 Ga0373926_0007366 Ga0373926_0007366_1658_2998 437
113 3300035692 Ga0373935_0011844 Ga0373935_0011844_1829_3169 437
114 3300037068 Ga0373925_0008223 Ga0373925_0008223_5217_6557 437
115 3300042876 Ga0451577_0048323 Ga0451577_0048323_1505_2830 437
116 3300044712 Ga0453684_0050205 Ga0453684_0050205_350_1675 437
117 3300044712 Ga0453684_0109967 Ga0453684_0109967_105_1430 437
118 3300046517 Ga0495630_0036542 Ga0495630_0036542_2233_3573 437
119 3300006847 Ga0075431_100023866 Ga0075431_1000238661 438
120 3300013104 Ga0157370_10044656 Ga0157370_100446563 438
121 3300013308 Ga0157375_10051519 Ga0157375_100515194 438
122 3300050510 nmdc:mga06r32_19267_c1 nmdc:mga06r32_19267_c1_4872_6203 438
123 3300053153 Ga0500616_0000833 Ga0500616_0000833_24674_26047 438
124 3300005340 Ga0070689_100148079 Ga0070689_1001480792 439
125 3300005466 Ga0070685_10125222 Ga0070685_101252222 439
126 3300005530 Ga0070679_100183384 Ga0070679_1001833841 439
127 3300005539 Ga0068853_100095364 Ga0068853_1000953642 439
128 3300005544 Ga0070686_100020966 Ga0070686_1000209663 439
129 3300005577 Ga0068857_100002379 Ga0068857_1000023793 439
130 3300005617 Ga0068859_100125164 Ga0068859_1001251642 439
131 3300006237 Ga0097621_100041021 Ga0097621_1000410214 439
132 3300006358 Ga0068871_100147772 Ga0068871_1001477722 439
133 3300006931 Ga0097620_100125163 Ga0097620_1001251632 439
134 3300009093 Ga0105240_10005960 Ga0105240_100059609 439
135 3300009093 Ga0105240_10025172 Ga0105240_100251724 439
136 3300009098 Ga0105245_10032666 Ga0105245_100326664 439
137 3300009551 Ga0105238_10064655 Ga0105238_100646552 439
138 3300013308 Ga0157375_10000421 Ga0157375_100004216 439
139 3300014325 Ga0163163_10000064 Ga0163163_1000006491 439
140 3300025913 Ga0207695_10147018 Ga0207695_101470182 439
141 3300025913 Ga0207695_10236414 Ga0207695_102364142 439
142 3300025924 Ga0207694_10040281 Ga0207694_100402812 439
143 3300026041 Ga0207639_10075022 Ga0207639_100750222 439
144 3300026116 Ga0207674_10040181 Ga0207674_100401812 439
145 3300031251 Ga0265327_10001447 Ga0265327_100014473 439
146 3300031251 Ga0265327_10095121 Ga0265327_100951211 439
147 3300034816 Ga0373930_0008698 Ga0373930_0008698_125_1459 439
148 3300035083 Ga0373926_0015256 Ga0373926_0015256_985_2328 439
149 3300035084 Ga0373928_0000391 Ga0373928_0000391_1985_3319 439
150 3300035085 Ga0373929_0000594 Ga0373929_0000594_3276_4610 439
151 3300035112 Ga0373932_0000001 Ga0373932_0000001_18338_19672 439
152 3300035242 Ga0373962_0002883 Ga0373962_0002883_2398_3732 439
153 3300035691 Ga0373931_0000004 Ga0373931_0000004_18347_19681 439
154 3300035692 Ga0373935_0014248 Ga0373935_0014248_1717_3060 439
155 3300035695 Ga0373927_0000848 Ga0373927_0000848_6170_7513 439
156 3300035725 Ga0373947_0005143 Ga0373947_0005143_5574_6917 439
157 3300037068 Ga0373925_0002040 Ga0373925_0002040_7418_8761 439
158 3300042876 Ga0451577_0121396 Ga0451577_0121396_577_1977 439
159 3300045051 Ga0451576_0096795 Ga0451576_0096795_1166_2500 439
160 3300046517 Ga0495630_0000137 Ga0495630_0000137_4212_5555 439
161 3300046517 Ga0495630_0003164 Ga0495630_0003164_4435_5778 439
162 3300046526 Ga0495666_0022537 Ga0495666_0022537_1559_2902 439
163 3300046535 Ga0495586_0001470 Ga0495586_0001470_5041_6384 439
164 3300046535 Ga0495586_0002193 Ga0495586_0002193_2683_4266 439
165 3300046642 Ga0495634_0018634 Ga0495634_0018634_1754_3337 439
166 3300046683 Ga0495658_0009974 Ga0495658_0009974_3342_4676 439
167 3300046689 Ga0495613_0010010 Ga0495613_0010010_1151_2734 439
168 3300047319 Ga0495674_0168759 Ga0495674_0168759_206_1549 439
169 3300047321 Ga0495676_0091363 Ga0495676_0091363_203_1546 439
170 3300049568 Ga0501031_0000052 Ga0501031_0000052_6134_7471 439
171 3300049569 Ga0501032_0007332 Ga0501032_0007332_18_1355 439
172 3300049570 Ga0501033_0003164 Ga0501033_0003164_3597_4934 439
173 3300049571 Ga0501034_0010102 Ga0501034_0010102_2453_3799 439
174 3300049580 Ga0501046_0021812 Ga0501046_0021812_2180_3793 439
175 3300049581 Ga0501047_0044123 Ga0501047_0044123_29_1579 439
176 3300049822 Ga0501035_0017640 Ga0501035_0017640_3721_5055 439
177 3300049823 Ga0501044_0002335 Ga0501044_0002335_5822_7159 439
178 3300053103 Ga0500555_001471 Ga0500555_001471_3393_4769 439
179 3300053730 Ga0500645_000279 Ga0500645_000279_15200_16576 439
180 3300005295 Ga0065707_10101957 Ga0065707_101019572 440
181 3300006844 Ga0075428_100005700 Ga0075428_1000057002 440
182 3300005548 Ga0070665_100072743 Ga0070665_1000727432 441
183 3300046517 Ga0495630_0000135 Ga0495630_0000135_26686_28164 446
184 3300046526 Ga0495666_0004427 Ga0495666_0004427_5297_6775 446
185 3300046535 Ga0495586_0000033 Ga0495586_0000033_56486_57964 446
186 3300046683 Ga0495658_0020955 Ga0495658_0020955_1411_2889 446
187 3300046689 Ga0495613_0045627 Ga0495613_0045627_921_2399 446
188 3300047319 Ga0495674_0006026 Ga0495674_0006026_6196_7674 446
189 3300009093 Ga0105240_10045180 Ga0105240_100451803 447
190 3300013104 Ga0157370_10041448 Ga0157370_100414482 447
191 3300031251 Ga0265327_10002009 Ga0265327_1000200924 447
192 3300048910 Ga0496107_0130511 Ga0496107_0130511_464_1816 447
193 3300044712 Ga0453684_0000093 Ga0453684_0000093_152705_154093 449
194 3300032004 Ga0307414_10002564 Ga0307414_100025645 450
195 3300041494 Ga0451837_1196195 Ga0451837_1196195_698_2059 450
196 3300025936 Ga0207670_10089635 Ga0207670_100896352 453
197 3300042876 Ga0451577_0007436 Ga0451577_0007436_9092_10510 455
198 3300044712 Ga0453684_0012378 Ga0453684_0012378_12645_14063 455
199 3300045051 Ga0451576_0186500 Ga0451576_0186500_268_1716 456
200 3300025913 Ga0207695_10022950 Ga0207695_100229503 457
201 3300037068 Ga0373925_0027372 Ga0373925_0027372_147_1694 457
202 3300047322 Ga0495680_0145888 Ga0495680_0145888_195_1628 457
203 3300003323 rootH1_10366203 rootH1_103662034 458
204 2162886007 SwRhRL2b_contig_3406522 SwRhRL2b_0475.00006680 459
205 3300005288 Ga0065714_10002527 Ga0065714_1000252710 459
206 3300005289 Ga0065704_10000217 Ga0065704_1000021748 459
207 3300013100 Ga0157373_10000041 Ga0157373_1000004128 459
208 3300013102 Ga0157371_10044469 Ga0157371_100444692 459
209 3300015261 Ga0182006_1004494 Ga0182006_10044944 459
210 3300031911 Ga0307412_10000033 Ga0307412_1000003380 459
211 3300032004 Ga0307414_10002262 Ga0307414_100022627 459
212 3300053093 Ga0500651_0001588 Ga0500651_0001588_9845_11224 459

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

117

238

0.89

PF19051

GFO_IDH_MocA_C2

Oxidoreductase family, C-terminal alpha/beta domain

243

377

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2k-assembly1.cif.gz_B crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8054 43 429
3q2k-assembly2.cif.gz_L crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8052 43 429
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8041 43 429
3q2k-assembly1.cif.gz_F crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8015 43 429
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.7991 45 427
ID Description Score Start End Superfamily
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9245 43 164 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9219 43 164 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9212 44 164 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.921 44 164 3.40.50.720
6jnkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9197 43 161 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A151BEY2-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9259 42 188 GO:0000166
AF-A0A351FSL8-F1-model_v4 Dehydrogenase 0.905 30 457 GO:0000166
AF-A0A7W8DND1-F1-model_v4 Putative dehydrogenase 0.9023 12 457 GO:0000166
AF-A0A4Q3YGC5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.902 43 163 GO:0000166
AF-A0A351FSL8-F1-model_v4 Dehydrogenase 0.9009 30 457 GO:0000166

Feature Viewer

pLDDT pTM Quality
88.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map