F323980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 162 | 213 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10333450|Ga0105240_103334502 |
| Length | 281 |
| Sequence | MTRFGDACSNAVDKGPLAPLAKFVGTRQIGTMVKKELRLFLIMSAIFLSQVDAAEINVFAAASLTDALQELGKRFESQTSDRVIFNFAASSLLARQISEHAPADIFFAADETKMDALEKAGLIVSETRKDLLSNSLVIVVPADSTLSIQSPAELEAKATKIAVADPRAVPAGIYTRKYLSRLGLWTTLESKIVPTENVRAALAAVESGNVEAGFVYKTDANISKKVKIAFSVPTDQGPVIRYPIAILKDATNKSGAESFLRFLESADSKKVFERYGFMVKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 161 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 162 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 92.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000026 | 3300000545 | Bacteria | 30702 |
| 2 | rootH2_10017229 | 3300003320 | Bacteria | 26925 |
| 3 | rootH2_10097523 | 3300003320 | Bacteria | 1688 |
| 4 | rootL2_10166686 | 3300003322 | Bacteria | 6028 |
| 5 | Ga0065704_10075529 | 3300005289 | Bacteria | 5549 |
| 6 | Ga0065715_10037433 | 3300005293 | Unclassified | 1399 |
| 7 | Ga0065707_10132156 | 3300005295 | Bacteria | 1902 |
| 8 | Ga0070658_10044918 | 3300005327 | Bacteria | 3571 |
| 9 | Ga0070676_10045433 | 3300005328 | Bacteria | 2558 |
| 10 | Ga0070690_100206860 | 3300005330 | Unclassified | 1368 |
| 11 | Ga0070670_100134863 | 3300005331 | Bacteria | 2133 |
| 12 | Ga0068869_100010417 | 3300005334 | Bacteria | 6063 |
| 13 | Ga0068869_100432843 | 3300005334 | Unclassified | 1087 |
| 14 | Ga0070666_10008109 | 3300005335 | Bacteria | 6506 |
| 15 | Ga0070666_10030338 | 3300005335 | Bacteria | 3561 |
| 16 | Ga0070666_10036868 | 3300005335 | Bacteria | 3248 |
| 17 | Ga0070666_10228979 | 3300005335 | Bacteria | 1312 |
| 18 | Ga0070680_100255442 | 3300005336 | Unclassified | 1482 |
| 19 | Ga0070661_100295291 | 3300005344 | Bacteria | 1260 |
| 20 | Ga0070668_100027672 | 3300005347 | Bacteria | 4304 |
| 21 | Ga0070668_100313756 | 3300005347 | Unclassified | 1318 |
| 22 | Ga0070669_100049804 | 3300005353 | Bacteria | 3059 |
| 23 | Ga0070671_100124406 | 3300005355 | Bacteria | 2171 |
| 24 | Ga0070671_100203523 | 3300005355 | Bacteria | 1679 |
| 25 | Ga0070674_100179473 | 3300005356 | Bacteria | 1621 |
| 26 | Ga0070673_100068632 | 3300005364 | Bacteria | 2839 |
| 27 | Ga0070667_100012742 | 3300005367 | Bacteria | 6952 |
| 28 | Ga0070714_100013671 | 3300005435 | Bacteria | 6510 |
| 29 | Ga0070713_100058844 | 3300005436 | Bacteria | 3206 |
| 30 | Ga0070710_10410633 | 3300005437 | Unclassified | 910 |
| 31 | Ga0070700_100000014 | 3300005441 | Bacteria | 156712 |
| 32 | Ga0070708_100006420 | 3300005445 | Bacteria | 9362 |
| 33 | Ga0070662_100051140 | 3300005457 | Bacteria | 2983 |
| 34 | Ga0070681_10385442 | 3300005458 | Bacteria | 1312 |
| 35 | Ga0068867_100423460 | 3300005459 | Unclassified | 1128 |
| 36 | Ga0070685_10302003 | 3300005466 | Unclassified | 1079 |
| 37 | Ga0070707_100026270 | 3300005468 | Bacteria | 5527 |
| 38 | Ga0070707_100080388 | 3300005468 | Bacteria | 3146 |
| 39 | Ga0070698_100145437 | 3300005471 | Bacteria | 2320 |
| 40 | Ga0070699_100097600 | 3300005518 | Bacteria | 2574 |
| 41 | Ga0070699_100204065 | 3300005518 | Bacteria | 1758 |
| 42 | Ga0070672_100585209 | 3300005543 | Unclassified | 971 |
| 43 | Ga0070695_100165516 | 3300005545 | Bacteria | 1556 |
| 44 | Ga0070665_100000035 | 3300005548 | Bacteria | 315093 |
| 45 | Ga0070665_100203079 | 3300005548 | Bacteria | 1982 |
| 46 | Ga0070665_100356692 | 3300005548 | Unclassified | 1468 |
| 47 | Ga0070704_100425300 | 3300005549 | Unclassified | 1138 |
| 48 | Ga0068855_100130706 | 3300005563 | Bacteria | 2868 |
| 49 | Ga0070664_100406937 | 3300005564 | Bacteria | 1245 |
| 50 | Ga0068854_100072714 | 3300005578 | Bacteria | 2518 |
| 51 | Ga0068863_100001013 | 3300005841 | Bacteria | 28120 |
| 52 | Ga0068863_100439634 | 3300005841 | Bacteria | 1279 |
| 53 | Ga0068858_100269767 | 3300005842 | Bacteria | 1619 |
| 54 | Ga0081455_10207485 | 3300005937 | Unclassified | 1462 |
| 55 | Ga0081538_10119484 | 3300005981 | Unclassified | 1270 |
| 56 | Ga0081540_1022454 | 3300005983 | Bacteria | 3727 |
| 57 | Ga0081539_10085538 | 3300005985 | Unclassified | 1644 |
| 58 | Ga0070717_10173259 | 3300006028 | Unclassified | 1878 |
| 59 | Ga0075428_100000473 | 3300006844 | Bacteria | 40394 |
| 60 | Ga0075430_100022156 | 3300006846 | Bacteria | 5401 |
| 61 | Ga0075431_100169495 | 3300006847 | Bacteria | 2244 |
| 62 | Ga0075431_100337103 | 3300006847 | Bacteria | 1518 |
| 63 | Ga0075436_100008478 | 3300006914 | Bacteria | 7028 |
| 64 | Ga0105240_10005149 | 3300009093 | Bacteria | 19564 |
| 65 | Ga0105240_10024493 | 3300009093 | Bacteria | 7952 |
| 66 | Ga0105240_10046973 | 3300009093 | Bacteria | 5465 |
| 67 | Ga0105240_10333450 | 3300009093 | Bacteria | 1725 |
| 68 | Ga0111539_10000536 | 3300009094 | Bacteria | 48260 |
| 69 | Ga0114129_10166487 | 3300009147 | Bacteria | 3008 |
| 70 | Ga0114129_10464093 | 3300009147 | Bacteria | 1659 |
| 71 | Ga0105248_10302463 | 3300009177 | Unclassified | 1801 |
| 72 | Ga0105238_10000005 | 3300009551 | Bacteria | 372840 |
| 73 | Ga0157374_10000006 | 3300013296 | Bacteria | 640284 |
| 74 | Ga0157374_10090104 | 3300013296 | Bacteria | 2923 |
| 75 | Ga0157374_10170520 | 3300013296 | Bacteria | 2123 |
| 76 | Ga0157378_10001063 | 3300013297 | Bacteria | 25133 |
| 77 | Ga0157378_10001230 | 3300013297 | Bacteria | 23153 |
| 78 | Ga0157378_10045126 | 3300013297 | Bacteria | 3916 |
| 79 | Ga0157378_10103630 | 3300013297 | Bacteria | 2600 |
| 80 | Ga0157378_10737640 | 3300013297 | Unclassified | 1007 |
| 81 | Ga0163162_10064490 | 3300013306 | Bacteria | 3708 |
| 82 | Ga0157372_10116262 | 3300013307 | Bacteria | 3067 |
| 83 | Ga0157372_10696558 | 3300013307 | Unclassified | 1182 |
| 84 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 85 | Ga0157375_10344130 | 3300013308 | Bacteria | 1656 |
| 86 | Ga0157377_10000003 | 3300014745 | Bacteria | 435133 |
| 87 | Ga0157376_10353471 | 3300014969 | Bacteria | 1407 |
| 88 | Ga0213873_10006930 | 3300021358 | Bacteria | 2249 |
| 89 | Ga0213876_10000517 | 3300021384 | Bacteria | 29674 |
| 90 | Ga0213876_10007649 | 3300021384 | Bacteria | 5867 |
| 91 | Ga0213876_10018301 | 3300021384 | Bacteria | 3699 |
| 92 | Ga0209050_1003987 | 3300025298 | Bacteria | 10412 |
| 93 | Ga0207697_10009071 | 3300025315 | Unclassified | 4311 |
| 94 | Ga0207697_10028311 | 3300025315 | Bacteria | 2292 |
| 95 | Ga0207692_10114713 | 3300025898 | Unclassified | 1499 |
| 96 | Ga0207688_10085637 | 3300025901 | Bacteria | 1805 |
| 97 | Ga0207680_10044102 | 3300025903 | Bacteria | 2620 |
| 98 | Ga0207680_10050662 | 3300025903 | Bacteria | 2479 |
| 99 | Ga0207699_10406642 | 3300025906 | Unclassified | 970 |
| 100 | Ga0207645_10017424 | 3300025907 | Bacteria | 4741 |
| 101 | Ga0207645_10141573 | 3300025907 | Bacteria | 1567 |
| 102 | Ga0207705_10028635 | 3300025909 | Bacteria | 3971 |
| 103 | Ga0207695_10037057 | 3300025913 | Bacteria | 5264 |
| 104 | Ga0207695_10063374 | 3300025913 | Bacteria | 3812 |
| 105 | Ga0207693_10015974 | 3300025915 | Bacteria | 6010 |
| 106 | Ga0207693_10241036 | 3300025915 | Bacteria | 1419 |
| 107 | Ga0207693_10301424 | 3300025915 | Unclassified | 1255 |
| 108 | Ga0207663_10094628 | 3300025916 | Bacteria | 1991 |
| 109 | Ga0207646_10316481 | 3300025922 | Bacteria | 1410 |
| 110 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 111 | Ga0207650_10414162 | 3300025925 | Bacteria | 1117 |
| 112 | Ga0207659_10021957 | 3300025926 | Bacteria | 4244 |
| 113 | Ga0207700_10073976 | 3300025928 | Unclassified | 2634 |
| 114 | Ga0207664_10010540 | 3300025929 | Bacteria | 6530 |
| 115 | Ga0207664_10461967 | 3300025929 | Unclassified | 1134 |
| 116 | Ga0207706_10068733 | 3300025933 | Bacteria | 3116 |
| 117 | Ga0207670_10103120 | 3300025936 | Bacteria | 2041 |
| 118 | Ga0207670_10187702 | 3300025936 | Bacteria | 1562 |
| 119 | Ga0207691_10046011 | 3300025940 | Bacteria | 4012 |
| 120 | Ga0207711_10130941 | 3300025941 | Bacteria | 2249 |
| 121 | Ga0207689_10008877 | 3300025942 | Bacteria | 8721 |
| 122 | Ga0207661_10318446 | 3300025944 | Bacteria | 1398 |
| 123 | Ga0207679_10514729 | 3300025945 | Bacteria | 1069 |
| 124 | Ga0207667_10037368 | 3300025949 | Bacteria | 5191 |
| 125 | Ga0207651_10013021 | 3300025960 | Bacteria | 4739 |
| 126 | Ga0207668_10011336 | 3300025972 | Bacteria | 5413 |
| 127 | Ga0207703_10299619 | 3300026035 | Bacteria | 1466 |
| 128 | Ga0207678_10182178 | 3300026067 | Bacteria | 1794 |
| 129 | Ga0207641_10002278 | 3300026088 | Bacteria | 17896 |
| 130 | Ga0207641_10260392 | 3300026088 | Bacteria | 1624 |
| 131 | Ga0207648_10358022 | 3300026089 | Bacteria | 1316 |
| 132 | Ga0207428_10000031 | 3300027907 | Bacteria | 235245 |
| 133 | Ga0268266_10000044 | 3300028379 | Bacteria | 315137 |
| 134 | Ga0268266_10011419 | 3300028379 | Bacteria | 7724 |
| 135 | Ga0265319_1015098 | 3300028563 | Bacteria | 3006 |
| 136 | Ga0265334_10086544 | 3300028573 | Bacteria | 1148 |
| 137 | Ga0265336_10004625 | 3300028666 | Bacteria | 5166 |
| 138 | Ga0265336_10049112 | 3300028666 | Bacteria | 1278 |
| 139 | Ga0265338_10000030 | 3300028800 | Bacteria | 260974 |
| 140 | Ga0265338_10011576 | 3300028800 | Bacteria | 10170 |
| 141 | Ga0265338_10014425 | 3300028800 | Bacteria | 8796 |
| 142 | Ga0265338_10074261 | 3300028800 | Bacteria | 2893 |
| 143 | Ga0265324_10018617 | 3300029957 | Unclassified | 2509 |
| 144 | Ga0265339_10003574 | 3300031249 | Bacteria | 10866 |
| 145 | Ga0265339_10064357 | 3300031249 | Unclassified | 1968 |
| 146 | Ga0307513_10050013 | 3300031456 | Bacteria | 4523 |
| 147 | Ga0265314_10180100 | 3300031711 | Bacteria | 1267 |
| 148 | Ga0373934_0064512 | 3300035086 | Bacteria | 1462 |
| 149 | Ga0373932_0000432 | 3300035112 | Bacteria | 12781 |
| 150 | Ga0373953_0033206 | 3300035117 | Bacteria | 2017 |
| 151 | Ga0373957_0060610 | 3300035120 | Unclassified | 1465 |
| 152 | Ga0373931_0133580 | 3300035691 | Bacteria | 1431 |
| 153 | Ga0373931_0329199 | 3300035691 | Bacteria | 951 |
| 154 | Ga0373947_0059112 | 3300035725 | Bacteria | 2324 |
| 155 | Ga0373937_0183818 | 3300036401 | Unclassified | 1963 |
| 156 | Ga0436365_0103659 | 3300039437 | Bacteria | 3484 |
| 157 | Ga0436365_1007086 | 3300039437 | Bacteria | 30486 |
| 158 | Ga0436362_0952873 | 3300039453 | Bacteria | 11630 |
| 159 | Ga0495592_0008600 | 3300046454 | Bacteria | 7660 |
| 160 | Ga0495629_0289297 | 3300046459 | Bacteria | 1123 |
| 161 | Ga0495629_0371913 | 3300046459 | Bacteria | 973 |
| 162 | Ga0495651_0227444 | 3300046462 | Unclassified | 1287 |
| 163 | Ga0495653_0173118 | 3300046463 | Unclassified | 1488 |
| 164 | Ga0495580_0000273 | 3300046472 | Bacteria | 41539 |
| 165 | Ga0495582_0156727 | 3300046473 | Bacteria | 1294 |
| 166 | Ga0495639_0079699 | 3300046475 | Bacteria | 1523 |
| 167 | Ga0495628_0005211 | 3300046516 | Bacteria | 11412 |
| 168 | Ga0495630_0000031 | 3300046517 | Bacteria | 135085 |
| 169 | Ga0495666_0012312 | 3300046526 | Bacteria | 4266 |
| 170 | Ga0495652_0055426 | 3300046529 | Bacteria | 3371 |
| 171 | Ga0495640_0031608 | 3300046533 | Bacteria | 3776 |
| 172 | Ga0495586_0000016 | 3300046535 | Bacteria | 126380 |
| 173 | Ga0495586_0037343 | 3300046535 | Bacteria | 2608 |
| 174 | Ga0495645_0030681 | 3300046543 | Bacteria | 3916 |
| 175 | Ga0495634_0014133 | 3300046642 | Bacteria | 5764 |
| 176 | Ga0495634_0059430 | 3300046642 | Bacteria | 2546 |
| 177 | Ga0495657_0157142 | 3300046675 | Bacteria | 1409 |
| 178 | Ga0495599_0004657 | 3300046678 | Bacteria | 8132 |
| 179 | Ga0495623_0014666 | 3300046679 | Bacteria | 5068 |
| 180 | Ga0495646_0011424 | 3300046680 | Bacteria | 5639 |
| 181 | Ga0495647_0006130 | 3300046681 | Bacteria | 3965 |
| 182 | Ga0495613_0037645 | 3300046689 | Bacteria | 3586 |
| 183 | Ga0495604_0045689 | 3300047317 | Unclassified | 3417 |
| 184 | Ga0495674_0000794 | 3300047319 | Bacteria | 29966 |
| 185 | Ga0495674_0049550 | 3300047319 | Bacteria | 3711 |
| 186 | Ga0495674_0099244 | 3300047319 | Bacteria | 2479 |
| 187 | Ga0495676_0244707 | 3300047321 | Bacteria | 1226 |
| 188 | Ga0495675_0004185 | 3300047444 | Bacteria | 8732 |
| 189 | Ga0495679_012526 | 3300047446 | Bacteria | 3222 |
| 190 | Ga0495684_0016163 | 3300047471 | Bacteria | 5747 |
| 191 | Ga0495602_0036347 | 3300048088 | Unclassified | 4585 |
| 192 | Ga0496106_0234063 | 3300048909 | Unclassified | 1467 |
| 193 | Ga0496113_0203836 | 3300048916 | Unclassified | 1573 |
| 194 | Ga0496115_0071393 | 3300048918 | Unclassified | 2816 |
| 195 | Ga0501034_0192735 | 3300049571 | Bacteria | 2000 |
| 196 | Ga0501038_0000614 | 3300049574 | Bacteria | 31784 |
| 197 | Ga0501048_0102039 | 3300049582 | Bacteria | 2024 |
| 198 | Ga0501067_0036045 | 3300049583 | Bacteria | 2747 |
| 199 | Ga0501081_0442696 | 3300049743 | Unclassified | 965 |
| 200 | Ga0501083_0006938 | 3300049744 | Bacteria | 8040 |
| 201 | nmdc:mga05p37_130272_c1 | 3300050507 | Bacteria | 3086 |
| 202 | nmdc:mga0qj67_47339_c1 | 3300050509 | Bacteria | 3397 |
| 203 | nmdc:mga06r32_214463_c1 | 3300050510 | Bacteria | 1913 |
| 204 | nmdc:mga06r32_321121_c1 | 3300050510 | Bacteria | 1534 |
| 205 | nmdc:mga08y16_22_c1 | 3300050511 | Bacteria | 250162 |
| 206 | Ga0495601_0000932 | 3300053077 | Bacteria | 15877 |
| 207 | Ga0495612_0041018 | 3300053078 | Bacteria | 1887 |
| 208 | Ga0495619_0249377 | 3300053085 | Bacteria | 1230 |
| 209 | Ga0495619_0431341 | 3300053085 | Unclassified | 909 |
| 210 | Ga0500618_046876 | 3300053125 | Bacteria | 984 |
| 211 | Ga0500559_0004596 | 3300053136 | Bacteria | 6522 |
| 212 | Ga0500573_0193731 | 3300053140 | Unclassified | 1084 |
| 213 | Ga0500616_0004242 | 3300053153 | Bacteria | 10310 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100179473 | Ga0070674_1001794733 | 198 |
| 2 | 3300049743 | Ga0501081_0442696 | Ga0501081_0442696_188_922 | 208 |
| 3 | 3300050509 | nmdc:mga0qj67_47339_c1 | nmdc:mga0qj67_47339_c1_1631_2326 | 210 |
| 4 | 3300050510 | nmdc:mga06r32_321121_c1 | nmdc:mga06r32_321121_c1_427_1122 | 210 |
| 5 | 3300005347 | Ga0070668_100313756 | Ga0070668_1003137562 | 211 |
| 6 | 3300005458 | Ga0070681_10385442 | Ga0070681_103854423 | 211 |
| 7 | 3300005545 | Ga0070695_100165516 | Ga0070695_1001655162 | 211 |
| 8 | 3300005441 | Ga0070700_100000014 | Ga0070700_10000001434 | 212 |
| 9 | 3300005518 | Ga0070699_100097600 | Ga0070699_1000976004 | 212 |
| 10 | 3300005334 | Ga0068869_100010417 | Ga0068869_1000104173 | 213 |
| 11 | 3300005445 | Ga0070708_100006420 | Ga0070708_1000064206 | 213 |
| 12 | 3300005468 | Ga0070707_100026270 | Ga0070707_1000262703 | 213 |
| 13 | 3300005518 | Ga0070699_100204065 | Ga0070699_1002040653 | 213 |
| 14 | 3300025922 | Ga0207646_10316481 | Ga0207646_103164812 | 213 |
| 15 | 3300005466 | Ga0070685_10302003 | Ga0070685_103020032 | 215 |
| 16 | 3300005335 | Ga0070666_10008109 | Ga0070666_100081095 | 216 |
| 17 | 3300025907 | Ga0207645_10141573 | Ga0207645_101415732 | 218 |
| 18 | 3300046459 | Ga0495629_0289297 | Ga0495629_0289297_77_850 | 218 |
| 19 | 3300046473 | Ga0495582_0156727 | Ga0495582_0156727_369_1142 | 218 |
| 20 | 3300046475 | Ga0495639_0079699 | Ga0495639_0079699_104_877 | 218 |
| 21 | 3300046517 | Ga0495630_0000031 | Ga0495630_0000031_46395_47168 | 218 |
| 22 | 3300046526 | Ga0495666_0012312 | Ga0495666_0012312_2023_2796 | 218 |
| 23 | 3300046533 | Ga0495640_0031608 | Ga0495640_0031608_2010_2783 | 218 |
| 24 | 3300046535 | Ga0495586_0000016 | Ga0495586_0000016_87893_88666 | 218 |
| 25 | 3300046642 | Ga0495634_0014133 | Ga0495634_0014133_2441_3214 | 218 |
| 26 | 3300046681 | Ga0495647_0006130 | Ga0495647_0006130_18_791 | 218 |
| 27 | 3300046689 | Ga0495613_0037645 | Ga0495613_0037645_50_823 | 218 |
| 28 | 3300047319 | Ga0495674_0000794 | Ga0495674_0000794_5163_5936 | 218 |
| 29 | 3300047321 | Ga0495676_0244707 | Ga0495676_0244707_263_1036 | 218 |
| 30 | 3300005471 | Ga0070698_100145437 | Ga0070698_1001454372 | 219 |
| 31 | 3300009147 | Ga0114129_10166487 | Ga0114129_101664872 | 219 |
| 32 | 3300050507 | nmdc:mga05p37_130272_c1 | nmdc:mga05p37_130272_c1_2121_2831 | 219 |
| 33 | 3300048916 | Ga0496113_0203836 | Ga0496113_0203836_837_1550 | 220 |
| 34 | 3300031711 | Ga0265314_10180100 | Ga0265314_101801001 | 221 |
| 35 | 3300006914 | Ga0075436_100008478 | Ga0075436_1000084785 | 222 |
| 36 | 3300005331 | Ga0070670_100134863 | Ga0070670_1001348632 | 223 |
| 37 | 3300005985 | Ga0081539_10085538 | Ga0081539_100855381 | 223 |
| 38 | 3300035112 | Ga0373932_0000432 | Ga0373932_0000432_4449_5180 | 223 |
| 39 | 3300005334 | Ga0068869_100432843 | Ga0068869_1004328432 | 224 |
| 40 | 3300009177 | Ga0105248_10302463 | Ga0105248_103024632 | 224 |
| 41 | 3300025941 | Ga0207711_10130941 | Ga0207711_101309412 | 224 |
| 42 | 3300028800 | Ga0265338_10011576 | Ga0265338_100115768 | 224 |
| 43 | 3300005842 | Ga0068858_100269767 | Ga0068858_1002697672 | 225 |
| 44 | 3300026035 | Ga0207703_10299619 | Ga0207703_102996192 | 225 |
| 45 | 3300028563 | Ga0265319_1015098 | Ga0265319_10150984 | 225 |
| 46 | 3300028800 | Ga0265338_10074261 | Ga0265338_100742611 | 225 |
| 47 | 3300005355 | Ga0070671_100203523 | Ga0070671_1002035233 | 226 |
| 48 | 3300005543 | Ga0070672_100585209 | Ga0070672_1005852092 | 226 |
| 49 | 3300003320 | rootH2_10017229 | rootH2_100172294 | 227 |
| 50 | 3300003322 | rootL2_10166686 | rootL2_101666864 | 227 |
| 51 | 3300005437 | Ga0070710_10410633 | Ga0070710_104106331 | 227 |
| 52 | 3300006847 | Ga0075431_100169495 | Ga0075431_1001694952 | 227 |
| 53 | 3300021384 | Ga0213876_10018301 | Ga0213876_100183014 | 227 |
| 54 | 3300025898 | Ga0207692_10114713 | Ga0207692_101147133 | 227 |
| 55 | 3300025915 | Ga0207693_10241036 | Ga0207693_102410362 | 227 |
| 56 | 3300025928 | Ga0207700_10073976 | Ga0207700_100739763 | 227 |
| 57 | 3300025929 | Ga0207664_10461967 | Ga0207664_104619671 | 227 |
| 58 | 3300035086 | Ga0373934_0064512 | Ga0373934_0064512_189_932 | 227 |
| 59 | 3300035117 | Ga0373953_0033206 | Ga0373953_0033206_580_1323 | 227 |
| 60 | 3300035120 | Ga0373957_0060610 | Ga0373957_0060610_90_833 | 227 |
| 61 | 3300035725 | Ga0373947_0059112 | Ga0373947_0059112_1531_2274 | 227 |
| 62 | 3300036401 | Ga0373937_0183818 | Ga0373937_0183818_611_1354 | 227 |
| 63 | 3300039437 | Ga0436365_0103659 | Ga0436365_0103659_2583_3380 | 227 |
| 64 | 3300046454 | Ga0495592_0008600 | Ga0495592_0008600_2387_3130 | 227 |
| 65 | 3300046459 | Ga0495629_0371913 | Ga0495629_0371913_147_890 | 227 |
| 66 | 3300046462 | Ga0495651_0227444 | Ga0495651_0227444_294_1037 | 227 |
| 67 | 3300046463 | Ga0495653_0173118 | Ga0495653_0173118_280_1023 | 227 |
| 68 | 3300046516 | Ga0495628_0005211 | Ga0495628_0005211_8816_9559 | 227 |
| 69 | 3300046529 | Ga0495652_0055426 | Ga0495652_0055426_2348_3091 | 227 |
| 70 | 3300046535 | Ga0495586_0037343 | Ga0495586_0037343_1321_2064 | 227 |
| 71 | 3300046543 | Ga0495645_0030681 | Ga0495645_0030681_2503_3246 | 227 |
| 72 | 3300046642 | Ga0495634_0059430 | Ga0495634_0059430_23_766 | 227 |
| 73 | 3300046675 | Ga0495657_0157142 | Ga0495657_0157142_335_1078 | 227 |
| 74 | 3300046678 | Ga0495599_0004657 | Ga0495599_0004657_2586_3329 | 227 |
| 75 | 3300046679 | Ga0495623_0014666 | Ga0495623_0014666_3334_4077 | 227 |
| 76 | 3300046680 | Ga0495646_0011424 | Ga0495646_0011424_1085_1828 | 227 |
| 77 | 3300047317 | Ga0495604_0045689 | Ga0495604_0045689_1194_1937 | 227 |
| 78 | 3300047319 | Ga0495674_0049550 | Ga0495674_0049550_789_1532 | 227 |
| 79 | 3300047319 | Ga0495674_0099244 | Ga0495674_0099244_1472_2215 | 227 |
| 80 | 3300047444 | Ga0495675_0004185 | Ga0495675_0004185_4535_5278 | 227 |
| 81 | 3300047471 | Ga0495684_0016163 | Ga0495684_0016163_1602_2345 | 227 |
| 82 | 3300048088 | Ga0495602_0036347 | Ga0495602_0036347_1908_2651 | 227 |
| 83 | 3300048918 | Ga0496115_0071393 | Ga0496115_0071393_668_1411 | 227 |
| 84 | 3300049574 | Ga0501038_0000614 | Ga0501038_0000614_18045_18791 | 227 |
| 85 | 3300049582 | Ga0501048_0102039 | Ga0501048_0102039_1192_1938 | 227 |
| 86 | 3300049583 | Ga0501067_0036045 | Ga0501067_0036045_741_1487 | 227 |
| 87 | 3300053077 | Ga0495601_0000932 | Ga0495601_0000932_12389_13132 | 227 |
| 88 | 3300053078 | Ga0495612_0041018 | Ga0495612_0041018_945_1688 | 227 |
| 89 | 3300053085 | Ga0495619_0249377 | Ga0495619_0249377_200_943 | 227 |
| 90 | 3300053085 | Ga0495619_0431341 | Ga0495619_0431341_146_889 | 227 |
| 91 | 3300053125 | Ga0500618_046876 | Ga0500618_046876_63_806 | 227 |
| 92 | 3300053136 | Ga0500559_0004596 | Ga0500559_0004596_805_1575 | 227 |
| 93 | 3300005328 | Ga0070676_10045433 | Ga0070676_100454333 | 228 |
| 94 | 3300005335 | Ga0070666_10030338 | Ga0070666_100303384 | 228 |
| 95 | 3300005336 | Ga0070680_100255442 | Ga0070680_1002554421 | 228 |
| 96 | 3300005344 | Ga0070661_100295291 | Ga0070661_1002952912 | 228 |
| 97 | 3300005347 | Ga0070668_100027672 | Ga0070668_1000276723 | 228 |
| 98 | 3300005353 | Ga0070669_100049804 | Ga0070669_1000498042 | 228 |
| 99 | 3300005355 | Ga0070671_100124406 | Ga0070671_1001244062 | 228 |
| 100 | 3300005364 | Ga0070673_100068632 | Ga0070673_1000686324 | 228 |
| 101 | 3300005367 | Ga0070667_100012742 | Ga0070667_10001274211 | 228 |
| 102 | 3300005457 | Ga0070662_100051140 | Ga0070662_1000511401 | 228 |
| 103 | 3300005548 | Ga0070665_100203079 | Ga0070665_1002030794 | 228 |
| 104 | 3300005548 | Ga0070665_100356692 | Ga0070665_1003566921 | 228 |
| 105 | 3300005564 | Ga0070664_100406937 | Ga0070664_1004069373 | 228 |
| 106 | 3300005841 | Ga0068863_100439634 | Ga0068863_1004396343 | 228 |
| 107 | 3300005981 | Ga0081538_10119484 | Ga0081538_101194842 | 228 |
| 108 | 3300005983 | Ga0081540_1022454 | Ga0081540_10224542 | 228 |
| 109 | 3300009093 | Ga0105240_10046973 | Ga0105240_100469734 | 228 |
| 110 | 3300009147 | Ga0114129_10464093 | Ga0114129_104640932 | 228 |
| 111 | 3300013296 | Ga0157374_10090104 | Ga0157374_100901041 | 228 |
| 112 | 3300013297 | Ga0157378_10001230 | Ga0157378_1000123013 | 228 |
| 113 | 3300013297 | Ga0157378_10045126 | Ga0157378_100451263 | 228 |
| 114 | 3300013306 | Ga0163162_10064490 | Ga0163162_100644905 | 228 |
| 115 | 3300013308 | Ga0157375_10344130 | Ga0157375_103441301 | 228 |
| 116 | 3300014969 | Ga0157376_10353471 | Ga0157376_103534712 | 228 |
| 117 | 3300021358 | Ga0213873_10006930 | Ga0213873_100069303 | 228 |
| 118 | 3300021384 | Ga0213876_10000517 | Ga0213876_1000051713 | 228 |
| 119 | 3300025315 | Ga0207697_10028311 | Ga0207697_100283113 | 228 |
| 120 | 3300025901 | Ga0207688_10085637 | Ga0207688_100856371 | 228 |
| 121 | 3300025903 | Ga0207680_10050662 | Ga0207680_100506624 | 228 |
| 122 | 3300025907 | Ga0207645_10017424 | Ga0207645_100174245 | 228 |
| 123 | 3300025913 | Ga0207695_10063374 | Ga0207695_100633746 | 228 |
| 124 | 3300025925 | Ga0207650_10414162 | Ga0207650_104141622 | 228 |
| 125 | 3300025926 | Ga0207659_10021957 | Ga0207659_100219572 | 228 |
| 126 | 3300025933 | Ga0207706_10068733 | Ga0207706_100687334 | 228 |
| 127 | 3300025936 | Ga0207670_10187702 | Ga0207670_101877022 | 228 |
| 128 | 3300025940 | Ga0207691_10046011 | Ga0207691_100460116 | 228 |
| 129 | 3300025944 | Ga0207661_10318446 | Ga0207661_103184462 | 228 |
| 130 | 3300025945 | Ga0207679_10514729 | Ga0207679_105147292 | 228 |
| 131 | 3300025960 | Ga0207651_10013021 | Ga0207651_100130216 | 228 |
| 132 | 3300025972 | Ga0207668_10011336 | Ga0207668_100113367 | 228 |
| 133 | 3300026067 | Ga0207678_10182178 | Ga0207678_101821783 | 228 |
| 134 | 3300026088 | Ga0207641_10260392 | Ga0207641_102603923 | 228 |
| 135 | 3300028379 | Ga0268266_10011419 | Ga0268266_100114198 | 228 |
| 136 | 3300028666 | Ga0265336_10004625 | Ga0265336_100046255 | 228 |
| 137 | 3300028666 | Ga0265336_10049112 | Ga0265336_100491122 | 228 |
| 138 | 3300028800 | Ga0265338_10000030 | Ga0265338_1000003091 | 228 |
| 139 | 3300029957 | Ga0265324_10018617 | Ga0265324_100186173 | 228 |
| 140 | 3300031249 | Ga0265339_10064357 | Ga0265339_100643573 | 228 |
| 141 | 3300035691 | Ga0373931_0133580 | Ga0373931_0133580_463_1206 | 228 |
| 142 | 3300039453 | Ga0436362_0952873 | Ga0436362_0952873_5042_5788 | 228 |
| 143 | 3300046472 | Ga0495580_0000273 | Ga0495580_0000273_9183_9944 | 228 |
| 144 | 3300049571 | Ga0501034_0192735 | Ga0501034_0192735_421_1182 | 228 |
| 145 | 3300005289 | Ga0065704_10075529 | Ga0065704_100755292 | 229 |
| 146 | 3300005293 | Ga0065715_10037433 | Ga0065715_100374332 | 229 |
| 147 | 3300005327 | Ga0070658_10044918 | Ga0070658_100449184 | 229 |
| 148 | 3300005335 | Ga0070666_10228979 | Ga0070666_102289792 | 229 |
| 149 | 3300005436 | Ga0070713_100058844 | Ga0070713_1000588442 | 229 |
| 150 | 3300005549 | Ga0070704_100425300 | Ga0070704_1004253002 | 229 |
| 151 | 3300005578 | Ga0068854_100072714 | Ga0068854_1000727143 | 229 |
| 152 | 3300006028 | Ga0070717_10173259 | Ga0070717_101732593 | 229 |
| 153 | 3300009093 | Ga0105240_10024493 | Ga0105240_100244935 | 229 |
| 154 | 3300009093 | Ga0105240_10333450 | Ga0105240_103334502 | 229 |
| 155 | 3300009551 | Ga0105238_10000005 | Ga0105238_10000005292 | 229 |
| 156 | 3300013296 | Ga0157374_10000006 | Ga0157374_10000006530 | 229 |
| 157 | 3300013296 | Ga0157374_10170520 | Ga0157374_101705202 | 229 |
| 158 | 3300013297 | Ga0157378_10001063 | Ga0157378_1000106313 | 229 |
| 159 | 3300013297 | Ga0157378_10103630 | Ga0157378_101036303 | 229 |
| 160 | 3300013307 | Ga0157372_10116262 | Ga0157372_101162624 | 229 |
| 161 | 3300013308 | Ga0157375_10000009 | Ga0157375_1000000989 | 229 |
| 162 | 3300014745 | Ga0157377_10000003 | Ga0157377_1000000346 | 229 |
| 163 | 3300025315 | Ga0207697_10009071 | Ga0207697_100090714 | 229 |
| 164 | 3300025906 | Ga0207699_10406642 | Ga0207699_104066422 | 229 |
| 165 | 3300025909 | Ga0207705_10028635 | Ga0207705_100286353 | 229 |
| 166 | 3300025915 | Ga0207693_10015974 | Ga0207693_100159742 | 229 |
| 167 | 3300025915 | Ga0207693_10301424 | Ga0207693_103014242 | 229 |
| 168 | 3300025916 | Ga0207663_10094628 | Ga0207663_100946282 | 229 |
| 169 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012864 | 229 |
| 170 | 3300025942 | Ga0207689_10008877 | Ga0207689_100088775 | 229 |
| 171 | 3300047446 | Ga0495679_012526 | Ga0495679_012526_2295_3044 | 229 |
| 172 | 3300048909 | Ga0496106_0234063 | Ga0496106_0234063_302_1051 | 229 |
| 173 | 3300053140 | Ga0500573_0193731 | Ga0500573_0193731_74_841 | 229 |
| 174 | 3300053153 | Ga0500616_0004242 | Ga0500616_0004242_5253_6032 | 229 |
| 175 | 3300005295 | Ga0065707_10132156 | Ga0065707_101321561 | 230 |
| 176 | 3300005468 | Ga0070707_100080388 | Ga0070707_1000803882 | 230 |
| 177 | 3300005548 | Ga0070665_100000035 | Ga0070665_100000035198 | 230 |
| 178 | 3300005841 | Ga0068863_100001013 | Ga0068863_10000101313 | 230 |
| 179 | 3300009093 | Ga0105240_10005149 | Ga0105240_1000514924 | 230 |
| 180 | 3300009094 | Ga0111539_10000536 | Ga0111539_100005366 | 230 |
| 181 | 3300021384 | Ga0213876_10007649 | Ga0213876_100076498 | 230 |
| 182 | 3300025298 | Ga0209050_1003987 | Ga0209050_10039879 | 230 |
| 183 | 3300025913 | Ga0207695_10037057 | Ga0207695_100370572 | 230 |
| 184 | 3300026088 | Ga0207641_10002278 | Ga0207641_1000227813 | 230 |
| 185 | 3300027907 | Ga0207428_10000031 | Ga0207428_10000031163 | 230 |
| 186 | 3300028379 | Ga0268266_10000044 | Ga0268266_10000044127 | 230 |
| 187 | 3300028800 | Ga0265338_10014425 | Ga0265338_100144255 | 230 |
| 188 | 3300031249 | Ga0265339_10003574 | Ga0265339_100035746 | 230 |
| 189 | 3300039437 | Ga0436365_1007086 | Ga0436365_1007086_14211_14963 | 230 |
| 190 | 3300050510 | nmdc:mga06r32_214463_c1 | nmdc:mga06r32_214463_c1_260_1027 | 230 |
| 191 | 3300050511 | nmdc:mga08y16_22_c1 | nmdc:mga08y16_22_c1_208721_209473 | 230 |
| 192 | 3300005435 | Ga0070714_100013671 | Ga0070714_1000136712 | 231 |
| 193 | 3300005459 | Ga0068867_100423460 | Ga0068867_1004234601 | 231 |
| 194 | 3300005563 | Ga0068855_100130706 | Ga0068855_1001307063 | 231 |
| 195 | 3300005937 | Ga0081455_10207485 | Ga0081455_102074852 | 231 |
| 196 | 3300013297 | Ga0157378_10737640 | Ga0157378_107376401 | 231 |
| 197 | 3300013307 | Ga0157372_10696558 | Ga0157372_106965582 | 231 |
| 198 | 3300025929 | Ga0207664_10010540 | Ga0207664_100105409 | 231 |
| 199 | 3300025936 | Ga0207670_10103120 | Ga0207670_101031203 | 231 |
| 200 | 3300025949 | Ga0207667_10037368 | Ga0207667_100373682 | 231 |
| 201 | 3300026089 | Ga0207648_10358022 | Ga0207648_103580222 | 231 |
| 202 | 3300035691 | Ga0373931_0329199 | Ga0373931_0329199_59_820 | 231 |
| 203 | 3300000545 | CNXas_1000026 | CNXas_100002617 | 232 |
| 204 | 3300003320 | rootH2_10097523 | rootH2_100975231 | 232 |
| 205 | 3300005330 | Ga0070690_100206860 | Ga0070690_1002068601 | 232 |
| 206 | 3300005335 | Ga0070666_10036868 | Ga0070666_100368685 | 232 |
| 207 | 3300006844 | Ga0075428_100000473 | Ga0075428_10000047341 | 232 |
| 208 | 3300006846 | Ga0075430_100022156 | Ga0075430_1000221562 | 232 |
| 209 | 3300006847 | Ga0075431_100337103 | Ga0075431_1003371032 | 232 |
| 210 | 3300025903 | Ga0207680_10044102 | Ga0207680_100441024 | 232 |
| 211 | 3300028573 | Ga0265334_10086544 | Ga0265334_100865442 | 232 |
| 212 | 3300031456 | Ga0307513_10050013 | Ga0307513_100500134 | 232 |
| 213 | 3300049744 | Ga0501083_0006938 | Ga0501083_0006938_4658_5425 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF12974
Phosphonate-bd
ABC transporter, phosphonate, periplasmic substrate-binding protein
54
279
0.82
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pc3-assembly1.cif.gz_A | crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. | 0.8299 | 19 | 68 |
| 5wpz-assembly3.cif.gz_C | crystal structure of mnda pyd with mbp tag | 0.8254 | 22 | 66 |
| 6dtu-assembly1.cif.gz_A | maltotetraose bound t. maritima male1 | 0.8204 | 20 | 73 |
| 6lce-assembly1.cif.gz_A | crystal structure of beta-l-arabinobiose binding protein - selenomethionine derivative | 0.8194 | 20 | 68 |
| 4h1x-assembly1.cif.gz_A | crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution | 0.8113 | 20 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGU3_42_110_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9775 | 25 | 91 | 3.40.190.10 |
| 1atgA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9736 | 23 | 93 | 3.40.190.10 |
| 2h5yB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9648 | 20 | 92 | 3.40.190.10 |
| af_P37329_30_103_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9645 | 25 | 94 | 3.40.190.10 |
| af_Q2FVX4_42_108_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9633 | 23 | 88 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1AX47-F1-model_v4 | deleted | 0.9934 | 22 | 94 |
|
| AF-P44205-F1-model_v4 | Uncharacterized protein HI_1469 | 0.9751 | 21 | 92 |
GO:0015689
GO:0030288 GO:0030973 |
| AF-A0A1H1K1C0-F1-model_v4 | Extracellular solute-binding protein | 0.9737 | 18 | 91 |
GO:0015689
GO:0030973 |
| AF-A0A377KBX2-F1-model_v4 | Molybdate transporter periplasmic protein | 0.9672 | 21 | 94 |
GO:0015689
GO:0030288 GO:0030973 |
| AF-A0A2E3ZK34-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9618 | 20 | 92 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar