F323980

General Info

Members Datasets Scaffolds Average Seq Length
213 162 213 248

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10333450|Ga0105240_103334502
Length 281
Sequence MTRFGDACSNAVDKGPLAPLAKFVGTRQIGTMVKKELRLFLIMSAIFLSQVDAAEINVFAAASLTDALQELGKRFESQTSDRVIFNFAASSLLARQISEHAPADIFFAADETKMDALEKAGLIVSETRKDLLSNSLVIVVPADSTLSIQSPAELEAKATKIAVADPRAVPAGIYTRKYLSRLGLWTTLESKIVPTENVRAALAAVESGNVEAGFVYKTDANISKKVKIAFSVPTDQGPVIRYPIAILKDATNKSGAESFLRFLESADSKKVFERYGFMVKS

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 1.41
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000026 3300000545 Bacteria 30702
2 rootH2_10017229 3300003320 Bacteria 26925
3 rootH2_10097523 3300003320 Bacteria 1688
4 rootL2_10166686 3300003322 Bacteria 6028
5 Ga0065704_10075529 3300005289 Bacteria 5549
6 Ga0065715_10037433 3300005293 Unclassified 1399
7 Ga0065707_10132156 3300005295 Bacteria 1902
8 Ga0070658_10044918 3300005327 Bacteria 3571
9 Ga0070676_10045433 3300005328 Bacteria 2558
10 Ga0070690_100206860 3300005330 Unclassified 1368
11 Ga0070670_100134863 3300005331 Bacteria 2133
12 Ga0068869_100010417 3300005334 Bacteria 6063
13 Ga0068869_100432843 3300005334 Unclassified 1087
14 Ga0070666_10008109 3300005335 Bacteria 6506
15 Ga0070666_10030338 3300005335 Bacteria 3561
16 Ga0070666_10036868 3300005335 Bacteria 3248
17 Ga0070666_10228979 3300005335 Bacteria 1312
18 Ga0070680_100255442 3300005336 Unclassified 1482
19 Ga0070661_100295291 3300005344 Bacteria 1260
20 Ga0070668_100027672 3300005347 Bacteria 4304
21 Ga0070668_100313756 3300005347 Unclassified 1318
22 Ga0070669_100049804 3300005353 Bacteria 3059
23 Ga0070671_100124406 3300005355 Bacteria 2171
24 Ga0070671_100203523 3300005355 Bacteria 1679
25 Ga0070674_100179473 3300005356 Bacteria 1621
26 Ga0070673_100068632 3300005364 Bacteria 2839
27 Ga0070667_100012742 3300005367 Bacteria 6952
28 Ga0070714_100013671 3300005435 Bacteria 6510
29 Ga0070713_100058844 3300005436 Bacteria 3206
30 Ga0070710_10410633 3300005437 Unclassified 910
31 Ga0070700_100000014 3300005441 Bacteria 156712
32 Ga0070708_100006420 3300005445 Bacteria 9362
33 Ga0070662_100051140 3300005457 Bacteria 2983
34 Ga0070681_10385442 3300005458 Bacteria 1312
35 Ga0068867_100423460 3300005459 Unclassified 1128
36 Ga0070685_10302003 3300005466 Unclassified 1079
37 Ga0070707_100026270 3300005468 Bacteria 5527
38 Ga0070707_100080388 3300005468 Bacteria 3146
39 Ga0070698_100145437 3300005471 Bacteria 2320
40 Ga0070699_100097600 3300005518 Bacteria 2574
41 Ga0070699_100204065 3300005518 Bacteria 1758
42 Ga0070672_100585209 3300005543 Unclassified 971
43 Ga0070695_100165516 3300005545 Bacteria 1556
44 Ga0070665_100000035 3300005548 Bacteria 315093
45 Ga0070665_100203079 3300005548 Bacteria 1982
46 Ga0070665_100356692 3300005548 Unclassified 1468
47 Ga0070704_100425300 3300005549 Unclassified 1138
48 Ga0068855_100130706 3300005563 Bacteria 2868
49 Ga0070664_100406937 3300005564 Bacteria 1245
50 Ga0068854_100072714 3300005578 Bacteria 2518
51 Ga0068863_100001013 3300005841 Bacteria 28120
52 Ga0068863_100439634 3300005841 Bacteria 1279
53 Ga0068858_100269767 3300005842 Bacteria 1619
54 Ga0081455_10207485 3300005937 Unclassified 1462
55 Ga0081538_10119484 3300005981 Unclassified 1270
56 Ga0081540_1022454 3300005983 Bacteria 3727
57 Ga0081539_10085538 3300005985 Unclassified 1644
58 Ga0070717_10173259 3300006028 Unclassified 1878
59 Ga0075428_100000473 3300006844 Bacteria 40394
60 Ga0075430_100022156 3300006846 Bacteria 5401
61 Ga0075431_100169495 3300006847 Bacteria 2244
62 Ga0075431_100337103 3300006847 Bacteria 1518
63 Ga0075436_100008478 3300006914 Bacteria 7028
64 Ga0105240_10005149 3300009093 Bacteria 19564
65 Ga0105240_10024493 3300009093 Bacteria 7952
66 Ga0105240_10046973 3300009093 Bacteria 5465
67 Ga0105240_10333450 3300009093 Bacteria 1725
68 Ga0111539_10000536 3300009094 Bacteria 48260
69 Ga0114129_10166487 3300009147 Bacteria 3008
70 Ga0114129_10464093 3300009147 Bacteria 1659
71 Ga0105248_10302463 3300009177 Unclassified 1801
72 Ga0105238_10000005 3300009551 Bacteria 372840
73 Ga0157374_10000006 3300013296 Bacteria 640284
74 Ga0157374_10090104 3300013296 Bacteria 2923
75 Ga0157374_10170520 3300013296 Bacteria 2123
76 Ga0157378_10001063 3300013297 Bacteria 25133
77 Ga0157378_10001230 3300013297 Bacteria 23153
78 Ga0157378_10045126 3300013297 Bacteria 3916
79 Ga0157378_10103630 3300013297 Bacteria 2600
80 Ga0157378_10737640 3300013297 Unclassified 1007
81 Ga0163162_10064490 3300013306 Bacteria 3708
82 Ga0157372_10116262 3300013307 Bacteria 3067
83 Ga0157372_10696558 3300013307 Unclassified 1182
84 Ga0157375_10000009 3300013308 Bacteria 366440
85 Ga0157375_10344130 3300013308 Bacteria 1656
86 Ga0157377_10000003 3300014745 Bacteria 435133
87 Ga0157376_10353471 3300014969 Bacteria 1407
88 Ga0213873_10006930 3300021358 Bacteria 2249
89 Ga0213876_10000517 3300021384 Bacteria 29674
90 Ga0213876_10007649 3300021384 Bacteria 5867
91 Ga0213876_10018301 3300021384 Bacteria 3699
92 Ga0209050_1003987 3300025298 Bacteria 10412
93 Ga0207697_10009071 3300025315 Unclassified 4311
94 Ga0207697_10028311 3300025315 Bacteria 2292
95 Ga0207692_10114713 3300025898 Unclassified 1499
96 Ga0207688_10085637 3300025901 Bacteria 1805
97 Ga0207680_10044102 3300025903 Bacteria 2620
98 Ga0207680_10050662 3300025903 Bacteria 2479
99 Ga0207699_10406642 3300025906 Unclassified 970
100 Ga0207645_10017424 3300025907 Bacteria 4741
101 Ga0207645_10141573 3300025907 Bacteria 1567
102 Ga0207705_10028635 3300025909 Bacteria 3971
103 Ga0207695_10037057 3300025913 Bacteria 5264
104 Ga0207695_10063374 3300025913 Bacteria 3812
105 Ga0207693_10015974 3300025915 Bacteria 6010
106 Ga0207693_10241036 3300025915 Bacteria 1419
107 Ga0207693_10301424 3300025915 Unclassified 1255
108 Ga0207663_10094628 3300025916 Bacteria 1991
109 Ga0207646_10316481 3300025922 Bacteria 1410
110 Ga0207694_10000001 3300025924 Bacteria 4078485
111 Ga0207650_10414162 3300025925 Bacteria 1117
112 Ga0207659_10021957 3300025926 Bacteria 4244
113 Ga0207700_10073976 3300025928 Unclassified 2634
114 Ga0207664_10010540 3300025929 Bacteria 6530
115 Ga0207664_10461967 3300025929 Unclassified 1134
116 Ga0207706_10068733 3300025933 Bacteria 3116
117 Ga0207670_10103120 3300025936 Bacteria 2041
118 Ga0207670_10187702 3300025936 Bacteria 1562
119 Ga0207691_10046011 3300025940 Bacteria 4012
120 Ga0207711_10130941 3300025941 Bacteria 2249
121 Ga0207689_10008877 3300025942 Bacteria 8721
122 Ga0207661_10318446 3300025944 Bacteria 1398
123 Ga0207679_10514729 3300025945 Bacteria 1069
124 Ga0207667_10037368 3300025949 Bacteria 5191
125 Ga0207651_10013021 3300025960 Bacteria 4739
126 Ga0207668_10011336 3300025972 Bacteria 5413
127 Ga0207703_10299619 3300026035 Bacteria 1466
128 Ga0207678_10182178 3300026067 Bacteria 1794
129 Ga0207641_10002278 3300026088 Bacteria 17896
130 Ga0207641_10260392 3300026088 Bacteria 1624
131 Ga0207648_10358022 3300026089 Bacteria 1316
132 Ga0207428_10000031 3300027907 Bacteria 235245
133 Ga0268266_10000044 3300028379 Bacteria 315137
134 Ga0268266_10011419 3300028379 Bacteria 7724
135 Ga0265319_1015098 3300028563 Bacteria 3006
136 Ga0265334_10086544 3300028573 Bacteria 1148
137 Ga0265336_10004625 3300028666 Bacteria 5166
138 Ga0265336_10049112 3300028666 Bacteria 1278
139 Ga0265338_10000030 3300028800 Bacteria 260974
140 Ga0265338_10011576 3300028800 Bacteria 10170
141 Ga0265338_10014425 3300028800 Bacteria 8796
142 Ga0265338_10074261 3300028800 Bacteria 2893
143 Ga0265324_10018617 3300029957 Unclassified 2509
144 Ga0265339_10003574 3300031249 Bacteria 10866
145 Ga0265339_10064357 3300031249 Unclassified 1968
146 Ga0307513_10050013 3300031456 Bacteria 4523
147 Ga0265314_10180100 3300031711 Bacteria 1267
148 Ga0373934_0064512 3300035086 Bacteria 1462
149 Ga0373932_0000432 3300035112 Bacteria 12781
150 Ga0373953_0033206 3300035117 Bacteria 2017
151 Ga0373957_0060610 3300035120 Unclassified 1465
152 Ga0373931_0133580 3300035691 Bacteria 1431
153 Ga0373931_0329199 3300035691 Bacteria 951
154 Ga0373947_0059112 3300035725 Bacteria 2324
155 Ga0373937_0183818 3300036401 Unclassified 1963
156 Ga0436365_0103659 3300039437 Bacteria 3484
157 Ga0436365_1007086 3300039437 Bacteria 30486
158 Ga0436362_0952873 3300039453 Bacteria 11630
159 Ga0495592_0008600 3300046454 Bacteria 7660
160 Ga0495629_0289297 3300046459 Bacteria 1123
161 Ga0495629_0371913 3300046459 Bacteria 973
162 Ga0495651_0227444 3300046462 Unclassified 1287
163 Ga0495653_0173118 3300046463 Unclassified 1488
164 Ga0495580_0000273 3300046472 Bacteria 41539
165 Ga0495582_0156727 3300046473 Bacteria 1294
166 Ga0495639_0079699 3300046475 Bacteria 1523
167 Ga0495628_0005211 3300046516 Bacteria 11412
168 Ga0495630_0000031 3300046517 Bacteria 135085
169 Ga0495666_0012312 3300046526 Bacteria 4266
170 Ga0495652_0055426 3300046529 Bacteria 3371
171 Ga0495640_0031608 3300046533 Bacteria 3776
172 Ga0495586_0000016 3300046535 Bacteria 126380
173 Ga0495586_0037343 3300046535 Bacteria 2608
174 Ga0495645_0030681 3300046543 Bacteria 3916
175 Ga0495634_0014133 3300046642 Bacteria 5764
176 Ga0495634_0059430 3300046642 Bacteria 2546
177 Ga0495657_0157142 3300046675 Bacteria 1409
178 Ga0495599_0004657 3300046678 Bacteria 8132
179 Ga0495623_0014666 3300046679 Bacteria 5068
180 Ga0495646_0011424 3300046680 Bacteria 5639
181 Ga0495647_0006130 3300046681 Bacteria 3965
182 Ga0495613_0037645 3300046689 Bacteria 3586
183 Ga0495604_0045689 3300047317 Unclassified 3417
184 Ga0495674_0000794 3300047319 Bacteria 29966
185 Ga0495674_0049550 3300047319 Bacteria 3711
186 Ga0495674_0099244 3300047319 Bacteria 2479
187 Ga0495676_0244707 3300047321 Bacteria 1226
188 Ga0495675_0004185 3300047444 Bacteria 8732
189 Ga0495679_012526 3300047446 Bacteria 3222
190 Ga0495684_0016163 3300047471 Bacteria 5747
191 Ga0495602_0036347 3300048088 Unclassified 4585
192 Ga0496106_0234063 3300048909 Unclassified 1467
193 Ga0496113_0203836 3300048916 Unclassified 1573
194 Ga0496115_0071393 3300048918 Unclassified 2816
195 Ga0501034_0192735 3300049571 Bacteria 2000
196 Ga0501038_0000614 3300049574 Bacteria 31784
197 Ga0501048_0102039 3300049582 Bacteria 2024
198 Ga0501067_0036045 3300049583 Bacteria 2747
199 Ga0501081_0442696 3300049743 Unclassified 965
200 Ga0501083_0006938 3300049744 Bacteria 8040
201 nmdc:mga05p37_130272_c1 3300050507 Bacteria 3086
202 nmdc:mga0qj67_47339_c1 3300050509 Bacteria 3397
203 nmdc:mga06r32_214463_c1 3300050510 Bacteria 1913
204 nmdc:mga06r32_321121_c1 3300050510 Bacteria 1534
205 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
206 Ga0495601_0000932 3300053077 Bacteria 15877
207 Ga0495612_0041018 3300053078 Bacteria 1887
208 Ga0495619_0249377 3300053085 Bacteria 1230
209 Ga0495619_0431341 3300053085 Unclassified 909
210 Ga0500618_046876 3300053125 Bacteria 984
211 Ga0500559_0004596 3300053136 Bacteria 6522
212 Ga0500573_0193731 3300053140 Unclassified 1084
213 Ga0500616_0004242 3300053153 Bacteria 10310

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100179473 Ga0070674_1001794733 198
2 3300049743 Ga0501081_0442696 Ga0501081_0442696_188_922 208
3 3300050509 nmdc:mga0qj67_47339_c1 nmdc:mga0qj67_47339_c1_1631_2326 210
4 3300050510 nmdc:mga06r32_321121_c1 nmdc:mga06r32_321121_c1_427_1122 210
5 3300005347 Ga0070668_100313756 Ga0070668_1003137562 211
6 3300005458 Ga0070681_10385442 Ga0070681_103854423 211
7 3300005545 Ga0070695_100165516 Ga0070695_1001655162 211
8 3300005441 Ga0070700_100000014 Ga0070700_10000001434 212
9 3300005518 Ga0070699_100097600 Ga0070699_1000976004 212
10 3300005334 Ga0068869_100010417 Ga0068869_1000104173 213
11 3300005445 Ga0070708_100006420 Ga0070708_1000064206 213
12 3300005468 Ga0070707_100026270 Ga0070707_1000262703 213
13 3300005518 Ga0070699_100204065 Ga0070699_1002040653 213
14 3300025922 Ga0207646_10316481 Ga0207646_103164812 213
15 3300005466 Ga0070685_10302003 Ga0070685_103020032 215
16 3300005335 Ga0070666_10008109 Ga0070666_100081095 216
17 3300025907 Ga0207645_10141573 Ga0207645_101415732 218
18 3300046459 Ga0495629_0289297 Ga0495629_0289297_77_850 218
19 3300046473 Ga0495582_0156727 Ga0495582_0156727_369_1142 218
20 3300046475 Ga0495639_0079699 Ga0495639_0079699_104_877 218
21 3300046517 Ga0495630_0000031 Ga0495630_0000031_46395_47168 218
22 3300046526 Ga0495666_0012312 Ga0495666_0012312_2023_2796 218
23 3300046533 Ga0495640_0031608 Ga0495640_0031608_2010_2783 218
24 3300046535 Ga0495586_0000016 Ga0495586_0000016_87893_88666 218
25 3300046642 Ga0495634_0014133 Ga0495634_0014133_2441_3214 218
26 3300046681 Ga0495647_0006130 Ga0495647_0006130_18_791 218
27 3300046689 Ga0495613_0037645 Ga0495613_0037645_50_823 218
28 3300047319 Ga0495674_0000794 Ga0495674_0000794_5163_5936 218
29 3300047321 Ga0495676_0244707 Ga0495676_0244707_263_1036 218
30 3300005471 Ga0070698_100145437 Ga0070698_1001454372 219
31 3300009147 Ga0114129_10166487 Ga0114129_101664872 219
32 3300050507 nmdc:mga05p37_130272_c1 nmdc:mga05p37_130272_c1_2121_2831 219
33 3300048916 Ga0496113_0203836 Ga0496113_0203836_837_1550 220
34 3300031711 Ga0265314_10180100 Ga0265314_101801001 221
35 3300006914 Ga0075436_100008478 Ga0075436_1000084785 222
36 3300005331 Ga0070670_100134863 Ga0070670_1001348632 223
37 3300005985 Ga0081539_10085538 Ga0081539_100855381 223
38 3300035112 Ga0373932_0000432 Ga0373932_0000432_4449_5180 223
39 3300005334 Ga0068869_100432843 Ga0068869_1004328432 224
40 3300009177 Ga0105248_10302463 Ga0105248_103024632 224
41 3300025941 Ga0207711_10130941 Ga0207711_101309412 224
42 3300028800 Ga0265338_10011576 Ga0265338_100115768 224
43 3300005842 Ga0068858_100269767 Ga0068858_1002697672 225
44 3300026035 Ga0207703_10299619 Ga0207703_102996192 225
45 3300028563 Ga0265319_1015098 Ga0265319_10150984 225
46 3300028800 Ga0265338_10074261 Ga0265338_100742611 225
47 3300005355 Ga0070671_100203523 Ga0070671_1002035233 226
48 3300005543 Ga0070672_100585209 Ga0070672_1005852092 226
49 3300003320 rootH2_10017229 rootH2_100172294 227
50 3300003322 rootL2_10166686 rootL2_101666864 227
51 3300005437 Ga0070710_10410633 Ga0070710_104106331 227
52 3300006847 Ga0075431_100169495 Ga0075431_1001694952 227
53 3300021384 Ga0213876_10018301 Ga0213876_100183014 227
54 3300025898 Ga0207692_10114713 Ga0207692_101147133 227
55 3300025915 Ga0207693_10241036 Ga0207693_102410362 227
56 3300025928 Ga0207700_10073976 Ga0207700_100739763 227
57 3300025929 Ga0207664_10461967 Ga0207664_104619671 227
58 3300035086 Ga0373934_0064512 Ga0373934_0064512_189_932 227
59 3300035117 Ga0373953_0033206 Ga0373953_0033206_580_1323 227
60 3300035120 Ga0373957_0060610 Ga0373957_0060610_90_833 227
61 3300035725 Ga0373947_0059112 Ga0373947_0059112_1531_2274 227
62 3300036401 Ga0373937_0183818 Ga0373937_0183818_611_1354 227
63 3300039437 Ga0436365_0103659 Ga0436365_0103659_2583_3380 227
64 3300046454 Ga0495592_0008600 Ga0495592_0008600_2387_3130 227
65 3300046459 Ga0495629_0371913 Ga0495629_0371913_147_890 227
66 3300046462 Ga0495651_0227444 Ga0495651_0227444_294_1037 227
67 3300046463 Ga0495653_0173118 Ga0495653_0173118_280_1023 227
68 3300046516 Ga0495628_0005211 Ga0495628_0005211_8816_9559 227
69 3300046529 Ga0495652_0055426 Ga0495652_0055426_2348_3091 227
70 3300046535 Ga0495586_0037343 Ga0495586_0037343_1321_2064 227
71 3300046543 Ga0495645_0030681 Ga0495645_0030681_2503_3246 227
72 3300046642 Ga0495634_0059430 Ga0495634_0059430_23_766 227
73 3300046675 Ga0495657_0157142 Ga0495657_0157142_335_1078 227
74 3300046678 Ga0495599_0004657 Ga0495599_0004657_2586_3329 227
75 3300046679 Ga0495623_0014666 Ga0495623_0014666_3334_4077 227
76 3300046680 Ga0495646_0011424 Ga0495646_0011424_1085_1828 227
77 3300047317 Ga0495604_0045689 Ga0495604_0045689_1194_1937 227
78 3300047319 Ga0495674_0049550 Ga0495674_0049550_789_1532 227
79 3300047319 Ga0495674_0099244 Ga0495674_0099244_1472_2215 227
80 3300047444 Ga0495675_0004185 Ga0495675_0004185_4535_5278 227
81 3300047471 Ga0495684_0016163 Ga0495684_0016163_1602_2345 227
82 3300048088 Ga0495602_0036347 Ga0495602_0036347_1908_2651 227
83 3300048918 Ga0496115_0071393 Ga0496115_0071393_668_1411 227
84 3300049574 Ga0501038_0000614 Ga0501038_0000614_18045_18791 227
85 3300049582 Ga0501048_0102039 Ga0501048_0102039_1192_1938 227
86 3300049583 Ga0501067_0036045 Ga0501067_0036045_741_1487 227
87 3300053077 Ga0495601_0000932 Ga0495601_0000932_12389_13132 227
88 3300053078 Ga0495612_0041018 Ga0495612_0041018_945_1688 227
89 3300053085 Ga0495619_0249377 Ga0495619_0249377_200_943 227
90 3300053085 Ga0495619_0431341 Ga0495619_0431341_146_889 227
91 3300053125 Ga0500618_046876 Ga0500618_046876_63_806 227
92 3300053136 Ga0500559_0004596 Ga0500559_0004596_805_1575 227
93 3300005328 Ga0070676_10045433 Ga0070676_100454333 228
94 3300005335 Ga0070666_10030338 Ga0070666_100303384 228
95 3300005336 Ga0070680_100255442 Ga0070680_1002554421 228
96 3300005344 Ga0070661_100295291 Ga0070661_1002952912 228
97 3300005347 Ga0070668_100027672 Ga0070668_1000276723 228
98 3300005353 Ga0070669_100049804 Ga0070669_1000498042 228
99 3300005355 Ga0070671_100124406 Ga0070671_1001244062 228
100 3300005364 Ga0070673_100068632 Ga0070673_1000686324 228
101 3300005367 Ga0070667_100012742 Ga0070667_10001274211 228
102 3300005457 Ga0070662_100051140 Ga0070662_1000511401 228
103 3300005548 Ga0070665_100203079 Ga0070665_1002030794 228
104 3300005548 Ga0070665_100356692 Ga0070665_1003566921 228
105 3300005564 Ga0070664_100406937 Ga0070664_1004069373 228
106 3300005841 Ga0068863_100439634 Ga0068863_1004396343 228
107 3300005981 Ga0081538_10119484 Ga0081538_101194842 228
108 3300005983 Ga0081540_1022454 Ga0081540_10224542 228
109 3300009093 Ga0105240_10046973 Ga0105240_100469734 228
110 3300009147 Ga0114129_10464093 Ga0114129_104640932 228
111 3300013296 Ga0157374_10090104 Ga0157374_100901041 228
112 3300013297 Ga0157378_10001230 Ga0157378_1000123013 228
113 3300013297 Ga0157378_10045126 Ga0157378_100451263 228
114 3300013306 Ga0163162_10064490 Ga0163162_100644905 228
115 3300013308 Ga0157375_10344130 Ga0157375_103441301 228
116 3300014969 Ga0157376_10353471 Ga0157376_103534712 228
117 3300021358 Ga0213873_10006930 Ga0213873_100069303 228
118 3300021384 Ga0213876_10000517 Ga0213876_1000051713 228
119 3300025315 Ga0207697_10028311 Ga0207697_100283113 228
120 3300025901 Ga0207688_10085637 Ga0207688_100856371 228
121 3300025903 Ga0207680_10050662 Ga0207680_100506624 228
122 3300025907 Ga0207645_10017424 Ga0207645_100174245 228
123 3300025913 Ga0207695_10063374 Ga0207695_100633746 228
124 3300025925 Ga0207650_10414162 Ga0207650_104141622 228
125 3300025926 Ga0207659_10021957 Ga0207659_100219572 228
126 3300025933 Ga0207706_10068733 Ga0207706_100687334 228
127 3300025936 Ga0207670_10187702 Ga0207670_101877022 228
128 3300025940 Ga0207691_10046011 Ga0207691_100460116 228
129 3300025944 Ga0207661_10318446 Ga0207661_103184462 228
130 3300025945 Ga0207679_10514729 Ga0207679_105147292 228
131 3300025960 Ga0207651_10013021 Ga0207651_100130216 228
132 3300025972 Ga0207668_10011336 Ga0207668_100113367 228
133 3300026067 Ga0207678_10182178 Ga0207678_101821783 228
134 3300026088 Ga0207641_10260392 Ga0207641_102603923 228
135 3300028379 Ga0268266_10011419 Ga0268266_100114198 228
136 3300028666 Ga0265336_10004625 Ga0265336_100046255 228
137 3300028666 Ga0265336_10049112 Ga0265336_100491122 228
138 3300028800 Ga0265338_10000030 Ga0265338_1000003091 228
139 3300029957 Ga0265324_10018617 Ga0265324_100186173 228
140 3300031249 Ga0265339_10064357 Ga0265339_100643573 228
141 3300035691 Ga0373931_0133580 Ga0373931_0133580_463_1206 228
142 3300039453 Ga0436362_0952873 Ga0436362_0952873_5042_5788 228
143 3300046472 Ga0495580_0000273 Ga0495580_0000273_9183_9944 228
144 3300049571 Ga0501034_0192735 Ga0501034_0192735_421_1182 228
145 3300005289 Ga0065704_10075529 Ga0065704_100755292 229
146 3300005293 Ga0065715_10037433 Ga0065715_100374332 229
147 3300005327 Ga0070658_10044918 Ga0070658_100449184 229
148 3300005335 Ga0070666_10228979 Ga0070666_102289792 229
149 3300005436 Ga0070713_100058844 Ga0070713_1000588442 229
150 3300005549 Ga0070704_100425300 Ga0070704_1004253002 229
151 3300005578 Ga0068854_100072714 Ga0068854_1000727143 229
152 3300006028 Ga0070717_10173259 Ga0070717_101732593 229
153 3300009093 Ga0105240_10024493 Ga0105240_100244935 229
154 3300009093 Ga0105240_10333450 Ga0105240_103334502 229
155 3300009551 Ga0105238_10000005 Ga0105238_10000005292 229
156 3300013296 Ga0157374_10000006 Ga0157374_10000006530 229
157 3300013296 Ga0157374_10170520 Ga0157374_101705202 229
158 3300013297 Ga0157378_10001063 Ga0157378_1000106313 229
159 3300013297 Ga0157378_10103630 Ga0157378_101036303 229
160 3300013307 Ga0157372_10116262 Ga0157372_101162624 229
161 3300013308 Ga0157375_10000009 Ga0157375_1000000989 229
162 3300014745 Ga0157377_10000003 Ga0157377_1000000346 229
163 3300025315 Ga0207697_10009071 Ga0207697_100090714 229
164 3300025906 Ga0207699_10406642 Ga0207699_104066422 229
165 3300025909 Ga0207705_10028635 Ga0207705_100286353 229
166 3300025915 Ga0207693_10015974 Ga0207693_100159742 229
167 3300025915 Ga0207693_10301424 Ga0207693_103014242 229
168 3300025916 Ga0207663_10094628 Ga0207663_100946282 229
169 3300025924 Ga0207694_10000001 Ga0207694_100000012864 229
170 3300025942 Ga0207689_10008877 Ga0207689_100088775 229
171 3300047446 Ga0495679_012526 Ga0495679_012526_2295_3044 229
172 3300048909 Ga0496106_0234063 Ga0496106_0234063_302_1051 229
173 3300053140 Ga0500573_0193731 Ga0500573_0193731_74_841 229
174 3300053153 Ga0500616_0004242 Ga0500616_0004242_5253_6032 229
175 3300005295 Ga0065707_10132156 Ga0065707_101321561 230
176 3300005468 Ga0070707_100080388 Ga0070707_1000803882 230
177 3300005548 Ga0070665_100000035 Ga0070665_100000035198 230
178 3300005841 Ga0068863_100001013 Ga0068863_10000101313 230
179 3300009093 Ga0105240_10005149 Ga0105240_1000514924 230
180 3300009094 Ga0111539_10000536 Ga0111539_100005366 230
181 3300021384 Ga0213876_10007649 Ga0213876_100076498 230
182 3300025298 Ga0209050_1003987 Ga0209050_10039879 230
183 3300025913 Ga0207695_10037057 Ga0207695_100370572 230
184 3300026088 Ga0207641_10002278 Ga0207641_1000227813 230
185 3300027907 Ga0207428_10000031 Ga0207428_10000031163 230
186 3300028379 Ga0268266_10000044 Ga0268266_10000044127 230
187 3300028800 Ga0265338_10014425 Ga0265338_100144255 230
188 3300031249 Ga0265339_10003574 Ga0265339_100035746 230
189 3300039437 Ga0436365_1007086 Ga0436365_1007086_14211_14963 230
190 3300050510 nmdc:mga06r32_214463_c1 nmdc:mga06r32_214463_c1_260_1027 230
191 3300050511 nmdc:mga08y16_22_c1 nmdc:mga08y16_22_c1_208721_209473 230
192 3300005435 Ga0070714_100013671 Ga0070714_1000136712 231
193 3300005459 Ga0068867_100423460 Ga0068867_1004234601 231
194 3300005563 Ga0068855_100130706 Ga0068855_1001307063 231
195 3300005937 Ga0081455_10207485 Ga0081455_102074852 231
196 3300013297 Ga0157378_10737640 Ga0157378_107376401 231
197 3300013307 Ga0157372_10696558 Ga0157372_106965582 231
198 3300025929 Ga0207664_10010540 Ga0207664_100105409 231
199 3300025936 Ga0207670_10103120 Ga0207670_101031203 231
200 3300025949 Ga0207667_10037368 Ga0207667_100373682 231
201 3300026089 Ga0207648_10358022 Ga0207648_103580222 231
202 3300035691 Ga0373931_0329199 Ga0373931_0329199_59_820 231
203 3300000545 CNXas_1000026 CNXas_100002617 232
204 3300003320 rootH2_10097523 rootH2_100975231 232
205 3300005330 Ga0070690_100206860 Ga0070690_1002068601 232
206 3300005335 Ga0070666_10036868 Ga0070666_100368685 232
207 3300006844 Ga0075428_100000473 Ga0075428_10000047341 232
208 3300006846 Ga0075430_100022156 Ga0075430_1000221562 232
209 3300006847 Ga0075431_100337103 Ga0075431_1003371032 232
210 3300025903 Ga0207680_10044102 Ga0207680_100441024 232
211 3300028573 Ga0265334_10086544 Ga0265334_100865442 232
212 3300031456 Ga0307513_10050013 Ga0307513_100500134 232
213 3300049744 Ga0501083_0006938 Ga0501083_0006938_4658_5425 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

56

278

0.98

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

61

270

0.92

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

54

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.8299 19 68
5wpz-assembly3.cif.gz_C crystal structure of mnda pyd with mbp tag 0.8254 22 66
6dtu-assembly1.cif.gz_A maltotetraose bound t. maritima male1 0.8204 20 73
6lce-assembly1.cif.gz_A crystal structure of beta-l-arabinobiose binding protein - selenomethionine derivative 0.8194 20 68
4h1x-assembly1.cif.gz_A crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution 0.8113 20 66
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9775 25 91 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9736 23 93 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9648 20 92 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9645 25 94 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9633 23 88 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P1AX47-F1-model_v4 deleted 0.9934 22 94
AF-P44205-F1-model_v4 Uncharacterized protein HI_1469 0.9751 21 92 GO:0015689
GO:0030288
GO:0030973
AF-A0A1H1K1C0-F1-model_v4 Extracellular solute-binding protein 0.9737 18 91 GO:0015689
GO:0030973
AF-A0A377KBX2-F1-model_v4 Molybdate transporter periplasmic protein 0.9672 21 94 GO:0015689
GO:0030288
GO:0030973
AF-A0A2E3ZK34-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9618 20 92

Feature Viewer

pLDDT pTM Quality
76.72 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map