F324031
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 125 | 426 | 862 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10000012|Ga0105239_10000012163 |
| Length | 921 |
| Sequence | MLRIYAGNDIFFGDIYAESGVDGLLQGYFYLNSCILPLGSFSLSFRKNNYLPYMKYAKLPLLLLLCAGMFNARAQNADDAKPVYDQHKIFNPLFYPEKGNEFRTAAGAPGAKYWQNHADYKLNVTLDTAKHSVTGTTLITYTNNSPDPLGFLWLQVDQNIYKEDSRGQATSPVEGGRFNNKTFTQGDEIKGVYVIKNGKAEKVDYIVTDTRMQIRLKDTLRSGGAKIQLKIDYKFDVPEYGTDRMGRVLTKNGWIYEIAQWYPRMEVYDDVTGWNVIPYMGASEFYLEYGNFDYTVTAPANLVVVGSGELLNPAEVYSPKILSRVNAARVSDKTIMIKDSVDLFSKDSYPAKATVTWHFFCKNARDVSWAASKAFIWDAARINLPSGKKAVAQSVYPIESKGMGAWSRSTEYVKACIELYSQEWFEYTYPVATNVGGVVGGMEYPGIVFCSSQSAGGALWEVTNHEFGHNWFPMIVGSNERKYAWMDEGFNTFINKVDTKVFNKGEYWEPGDEQKAAVSMFAPGADAIMNTPDVINADYLGYAAYEKPALGLKILREQILGEERFDYAFKTYIKRWAFKHPTPWDFFHTMDNVAGEDLSWFWNEWFITTLSLDQAVRSIDYVENDPSKGSLITIENLEGMALPVIASVKEENGKTGTVKLPAEIWQRGGTWTFQYKSTSKITFVTLDPDHVLPDIKPENNSMSGLSMEKGVTVNSVIKKYFDAVGGEQRLKDVNDLTLTSQGSIQGIDLIKESKFKNPGKEAVQVVIPKYNNLVFNHIIVNGDSVSVHQNNRLMDLSKGDKGAISAKYKLFPELDFGKQGYSAVLDTNYQVVNGQLAYLITVKNPDGIPVKYYYDQKTGLKVKQDVDMPNTSGVDFGDYQNIPTGIKIPFSEKTSVAGQPVEFKVKTAVVNTGVANDAFKM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 50 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 75 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 76 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 77 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 78 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 79 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 80 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 83 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 84 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 85 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 98 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 99 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 100 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 101 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 102 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 103 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 104 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 105 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 106 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 107 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 108 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 109 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 110 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 111 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 112 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 113 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 114 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 115 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 116 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 117 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 118 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 119 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 120 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 121 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 122 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 123 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 124 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 125 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.96 |
| Metatranscriptomes | 0 |
| Isolates | 7.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.27 |
| Nodule | 0 |
| Rhizoplane | 0.47 |
| Rhizosphere | 74.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 2 | JGI24737J22298_10000042 | 3300001990 | Bacteria | 37008 |
| 3 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 4 | JGI25162J39368_1000022 | 3300002737 | Bacteria | 239510 |
| 5 | rootH1_10044863 | 3300003316 | Bacteria | 10188 |
| 6 | rootH2_10002871 | 3300003320 | Bacteria | 62767 |
| 7 | rootH2_10008717 | 3300003320 | Bacteria | 23143 |
| 8 | rootH2_10009544 | 3300003320 | Bacteria | 42409 |
| 9 | rootH2_10108312 | 3300003320 | Bacteria | 9995 |
| 10 | rootL2_10022046 | 3300003322 | Bacteria | 6995 |
| 11 | rootL2_10051564 | 3300003322 | Bacteria | 7828 |
| 12 | rootH1_10006785 | 3300003323 | Bacteria | 51850 |
| 13 | Ga0055531_10000144 | 3300003794 | Bacteria | 82231 |
| 14 | Ga0070658_10000047 | 3300005327 | Bacteria | 129483 |
| 15 | Ga0070658_10027019 | 3300005327 | Bacteria | 4608 |
| 16 | Ga0070683_100014107 | 3300005329 | Bacteria | 6978 |
| 17 | Ga0070666_10010421 | 3300005335 | Bacteria | 5814 |
| 18 | Ga0070680_100010363 | 3300005336 | Bacteria | 7184 |
| 19 | Ga0070680_100045469 | 3300005336 | Bacteria | 3569 |
| 20 | Ga0070660_100001792 | 3300005339 | Bacteria | 14743 |
| 21 | Ga0070660_100017844 | 3300005339 | Bacteria | 5177 |
| 22 | Ga0070671_100001421 | 3300005355 | Bacteria | 17898 |
| 23 | Ga0070673_100001562 | 3300005364 | Bacteria | 13484 |
| 24 | Ga0070659_100003474 | 3300005366 | Bacteria | 11211 |
| 25 | Ga0070659_100004502 | 3300005366 | Bacteria | 9955 |
| 26 | Ga0070662_100000083 | 3300005457 | Bacteria | 51358 |
| 27 | Ga0070681_10021037 | 3300005458 | Bacteria | 6537 |
| 28 | Ga0070679_100001254 | 3300005530 | Bacteria | 22385 |
| 29 | Ga0070684_100008118 | 3300005535 | Bacteria | 8194 |
| 30 | Ga0068853_100015998 | 3300005539 | Bacteria | 6169 |
| 31 | Ga0068853_100061938 | 3300005539 | Bacteria | 3237 |
| 32 | Ga0070665_100000041 | 3300005548 | Bacteria | 297849 |
| 33 | Ga0070665_100000267 | 3300005548 | Bacteria | 85526 |
| 34 | Ga0068855_100000506 | 3300005563 | Bacteria | 48223 |
| 35 | Ga0068855_100000704 | 3300005563 | Bacteria | 40979 |
| 36 | Ga0068855_100000748 | 3300005563 | Bacteria | 39873 |
| 37 | Ga0068855_100018316 | 3300005563 | Bacteria | 8412 |
| 38 | Ga0068855_100078844 | 3300005563 | Bacteria | 3821 |
| 39 | Ga0068857_100006959 | 3300005577 | Bacteria | 9735 |
| 40 | Ga0068856_100000015 | 3300005614 | Bacteria | 157353 |
| 41 | Ga0068856_100008864 | 3300005614 | Bacteria | 9789 |
| 42 | Ga0068856_100109041 | 3300005614 | Bacteria | 2764 |
| 43 | Ga0068852_100001785 | 3300005616 | Bacteria | 14610 |
| 44 | Ga0068860_100000208 | 3300005843 | Bacteria | 92818 |
| 45 | Ga0068860_100007619 | 3300005843 | Bacteria | 10834 |
| 46 | Ga0075366_10000386 | 3300006195 | Bacteria | 20464 |
| 47 | Ga0097621_100000259 | 3300006237 | Bacteria | 35593 |
| 48 | Ga0068871_100000824 | 3300006358 | Bacteria | 20776 |
| 49 | Ga0068865_100000492 | 3300006881 | Bacteria | 22165 |
| 50 | Ga0105240_10000224 | 3300009093 | Bacteria | 113175 |
| 51 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 52 | Ga0105240_10002232 | 3300009093 | Bacteria | 31507 |
| 53 | Ga0105241_10000493 | 3300009174 | Bacteria | 29814 |
| 54 | Ga0105241_10002347 | 3300009174 | Bacteria | 14220 |
| 55 | Ga0105237_10000622 | 3300009545 | Bacteria | 49566 |
| 56 | Ga0105237_10002801 | 3300009545 | Bacteria | 21180 |
| 57 | Ga0105237_10008284 | 3300009545 | Bacteria | 11287 |
| 58 | Ga0105237_10018180 | 3300009545 | Bacteria | 7277 |
| 59 | Ga0105237_10023397 | 3300009545 | Bacteria | 6330 |
| 60 | Ga0105237_10028338 | 3300009545 | Bacteria | 5706 |
| 61 | Ga0105238_10000247 | 3300009551 | Bacteria | 60300 |
| 62 | Ga0105238_10008890 | 3300009551 | Bacteria | 10053 |
| 63 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 64 | Ga0105239_10000685 | 3300010375 | Bacteria | 48269 |
| 65 | Ga0105239_10000887 | 3300010375 | Bacteria | 42411 |
| 66 | Ga0105239_10001617 | 3300010375 | Bacteria | 29762 |
| 67 | Ga0105239_10008895 | 3300010375 | Bacteria | 11368 |
| 68 | Ga0105239_10034753 | 3300010375 | Bacteria | 5537 |
| 69 | Ga0157373_10001878 | 3300013100 | Bacteria | 15937 |
| 70 | Ga0157373_10003781 | 3300013100 | Bacteria | 11453 |
| 71 | Ga0157371_10001086 | 3300013102 | Bacteria | 29437 |
| 72 | Ga0157371_10001267 | 3300013102 | Bacteria | 26607 |
| 73 | Ga0157371_10003814 | 3300013102 | Bacteria | 13473 |
| 74 | Ga0157371_10003970 | 3300013102 | Bacteria | 13121 |
| 75 | Ga0157371_10006969 | 3300013102 | Bacteria | 9204 |
| 76 | Ga0157371_10013988 | 3300013102 | Bacteria | 6074 |
| 77 | Ga0157370_10006476 | 3300013104 | Bacteria | 12911 |
| 78 | Ga0157369_10020699 | 3300013105 | Bacteria | 7354 |
| 79 | Ga0157369_10061497 | 3300013105 | Bacteria | 4048 |
| 80 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 81 | Ga0157374_10001231 | 3300013296 | Bacteria | 21878 |
| 82 | Ga0157374_10001437 | 3300013296 | Bacteria | 20134 |
| 83 | Ga0163162_10000034 | 3300013306 | Bacteria | 149611 |
| 84 | Ga0163162_10001520 | 3300013306 | Bacteria | 21611 |
| 85 | Ga0163162_10025420 | 3300013306 | Bacteria | 5851 |
| 86 | Ga0157372_10000252 | 3300013307 | Bacteria | 59348 |
| 87 | Ga0157372_10000317 | 3300013307 | Bacteria | 53205 |
| 88 | Ga0157372_10002015 | 3300013307 | Bacteria | 22086 |
| 89 | Ga0157372_10002225 | 3300013307 | Bacteria | 21049 |
| 90 | Ga0157372_10109233 | 3300013307 | Bacteria | 3167 |
| 91 | Ga0157375_10016384 | 3300013308 | Bacteria | 6657 |
| 92 | Ga0182005_1000091 | 3300015265 | Bacteria | 67859 |
| 93 | Ga0207427_100171 | 3300025231 | Bacteria | 71988 |
| 94 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 95 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 96 | Ga0209258_100081 | 3300025242 | Bacteria | 254564 |
| 97 | Ga0209026_1000834 | 3300025250 | Bacteria | 16276 |
| 98 | Ga0209026_1006353 | 3300025250 | Bacteria | 2915 |
| 99 | Ga0209148_1000202 | 3300025254 | Bacteria | 106106 |
| 100 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 101 | Ga0209130_1001650 | 3300025284 | Bacteria | 13651 |
| 102 | Ga0207426_1000114 | 3300025302 | Bacteria | 228273 |
| 103 | Ga0207426_1012464 | 3300025302 | Bacteria | 3191 |
| 104 | Ga0209257_1000064 | 3300025304 | Bacteria | 356803 |
| 105 | Ga0207647_10000098 | 3300025904 | Bacteria | 67170 |
| 106 | Ga0207647_10014136 | 3300025904 | Bacteria | 5512 |
| 107 | Ga0207645_10000185 | 3300025907 | Bacteria | 49988 |
| 108 | Ga0207705_10000052 | 3300025909 | Bacteria | 168319 |
| 109 | Ga0207654_10001487 | 3300025911 | Bacteria | 12386 |
| 110 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 111 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 112 | Ga0207695_10002344 | 3300025913 | Bacteria | 28132 |
| 113 | Ga0207695_10005513 | 3300025913 | Bacteria | 16753 |
| 114 | Ga0207695_10036926 | 3300025913 | Bacteria | 5275 |
| 115 | Ga0207671_10002229 | 3300025914 | Bacteria | 21016 |
| 116 | Ga0207671_10003957 | 3300025914 | Bacteria | 14415 |
| 117 | Ga0207671_10004371 | 3300025914 | Bacteria | 13550 |
| 118 | Ga0207671_10005442 | 3300025914 | Bacteria | 11721 |
| 119 | Ga0207671_10005873 | 3300025914 | Bacteria | 11150 |
| 120 | Ga0207671_10020779 | 3300025914 | Bacteria | 4993 |
| 121 | Ga0207657_10004060 | 3300025919 | Bacteria | 15540 |
| 122 | Ga0207657_10025671 | 3300025919 | Bacteria | 5428 |
| 123 | Ga0207657_10034131 | 3300025919 | Bacteria | 4579 |
| 124 | Ga0207652_10000180 | 3300025921 | Bacteria | 66974 |
| 125 | Ga0207652_10000337 | 3300025921 | Bacteria | 48786 |
| 126 | Ga0207694_10020081 | 3300025924 | Bacteria | 5053 |
| 127 | Ga0207644_10001351 | 3300025931 | Bacteria | 15777 |
| 128 | Ga0207706_10000176 | 3300025933 | Bacteria | 70917 |
| 129 | Ga0207704_10000055 | 3300025938 | Bacteria | 78858 |
| 130 | Ga0207667_10000144 | 3300025949 | Bacteria | 108295 |
| 131 | Ga0207667_10000375 | 3300025949 | Bacteria | 60547 |
| 132 | Ga0207667_10000773 | 3300025949 | Bacteria | 41528 |
| 133 | Ga0207667_10002384 | 3300025949 | Bacteria | 23511 |
| 134 | Ga0207667_10002632 | 3300025949 | Bacteria | 22201 |
| 135 | Ga0207667_10100429 | 3300025949 | Bacteria | 2984 |
| 136 | Ga0207651_10011900 | 3300025960 | Bacteria | 4891 |
| 137 | Ga0207639_10012076 | 3300026041 | Bacteria | 6007 |
| 138 | Ga0207702_10002568 | 3300026078 | Bacteria | 17064 |
| 139 | Ga0207674_10011947 | 3300026116 | Bacteria | 9735 |
| 140 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 141 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 142 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 143 | Ga0268264_10000950 | 3300028381 | Bacteria | 29935 |
| 144 | Ga0307517_10022720 | 3300028786 | Bacteria | 7845 |
| 145 | Ga0307517_10028299 | 3300028786 | Bacteria | 6689 |
| 146 | Ga0307515_10005287 | 3300028794 | Bacteria | 26245 |
| 147 | Ga0307515_10017194 | 3300028794 | Bacteria | 13192 |
| 148 | Ga0307511_10000122 | 3300030521 | Bacteria | 70869 |
| 149 | Ga0307516_10001339 | 3300031730 | Bacteria | 34211 |
| 150 | Ga0307507_10002030 | 3300033179 | Bacteria | 43887 |
| 151 | Ga0307510_10003612 | 3300033180 | Bacteria | 18058 |
| 152 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 153 | Ga0395899_0010665 | 3300037312 | Bacteria | 7040 |
| 154 | Ga0395900_0001549 | 3300037418 | Bacteria | 27320 |
| 155 | Ga0395900_0018022 | 3300037418 | Bacteria | 7209 |
| 156 | Ga0395900_0019851 | 3300037418 | Bacteria | 6851 |
| 157 | Ga0395905_0000520 | 3300037471 | Bacteria | 52744 |
| 158 | Ga0395905_0003309 | 3300037471 | Bacteria | 17296 |
| 159 | Ga0395905_0041792 | 3300037471 | Bacteria | 4302 |
| 160 | Ga0395905_0079644 | 3300037471 | Bacteria | 3071 |
| 161 | Ga0395901_0003324 | 3300038443 | Bacteria | 16201 |
| 162 | Ga0395901_0003411 | 3300038443 | Bacteria | 16009 |
| 163 | Ga0395901_0003486 | 3300038443 | Bacteria | 15853 |
| 164 | Ga0436365_1133037 | 3300039437 | Bacteria | 24803 |
| 165 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 166 | Ga0495585_0000085 | 3300046492 | Bacteria | 97836 |
| 167 | Ga0495606_0000145 | 3300046507 | Bacteria | 122857 |
| 168 | Ga0495606_0011010 | 3300046507 | Bacteria | 7428 |
| 169 | Ga0495610_0001185 | 3300046512 | Bacteria | 23579 |
| 170 | Ga0495648_0000729 | 3300046524 | Bacteria | 35114 |
| 171 | Ga0495633_0000069 | 3300046558 | Bacteria | 135128 |
| 172 | Ga0495633_0000123 | 3300046558 | Bacteria | 104682 |
| 173 | Ga0495633_0023872 | 3300046558 | Bacteria | 3026 |
| 174 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 175 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 176 | Ga0495625_0001880 | 3300046660 | Bacteria | 23825 |
| 177 | Ga0495625_0030259 | 3300046660 | Bacteria | 4041 |
| 178 | Ga0495661_0000511 | 3300046665 | Bacteria | 40405 |
| 179 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 180 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 181 | Ga0495687_000672 | 3300047443 | Bacteria | 38920 |
| 182 | Ga0495687_002396 | 3300047443 | Bacteria | 15120 |
| 183 | Ga0495686_0000367 | 3300047472 | Bacteria | 73112 |
| 184 | Ga0496121_0000011 | 3300048924 | Bacteria | 792193 |
| 185 | Ga0496126_0026817 | 3300048929 | Bacteria | 5516 |
| 186 | Ga0501241_001305 | 3300049758 | Bacteria | 5160 |
| 187 | nmdc:mga0k408_342_c1 | 3300050493 | Bacteria | 25447 |
| 188 | Ga0500644_0000035 | 3300053088 | Bacteria | 82815 |
| 189 | Ga0500583_0000989 | 3300053092 | Bacteria | 8077 |
| 190 | Ga0500651_0006188 | 3300053093 | Bacteria | 6879 |
| 191 | Ga0500608_000736 | 3300053122 | Bacteria | 11950 |
| 192 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 193 | Ga0500568_0017858 | 3300053139 | Bacteria | 3121 |
| 194 | Ga0500577_0002129 | 3300053142 | Bacteria | 5055 |
| 195 | Ga0500616_0011240 | 3300053153 | Bacteria | 5303 |
| 196 | Ga0500622_0000203 | 3300053156 | Bacteria | 63042 |
| 197 | Ga0500622_0001514 | 3300053156 | Bacteria | 18450 |
| 198 | Ga0466962_0020802 | 3300061719 | Bacteria | 3153 |
| 199 | 2599477708 | 2599185184 | Bacteria | 6430550 |
| 200 | 2819576266 | 2818991442 | Bacteria | 8318214 |
| 201 | 2819681636 | 2818991460 | Bacteria | 7595395 |
| 202 | 2821142494 | 2821136567 | Bacteria | 8080116 |
| 203 | 2884792376 | 2884791551 | Bacteria | 8511252 |
| 204 | 2904470338 | 2904467357 | Bacteria | 8057758 |
| 205 | 2910249918 | 2910245624 | Bacteria | 6935613 |
| 206 | 2919441663 | 2919437846 | Bacteria | 6199444 |
| 207 | 2928079624 | 2928078545 | Bacteria | 6534839 |
| 208 | 2928147900 | 2928147474 | Bacteria | 6512076 |
| 209 | 2929181526 | 2929177148 | Bacteria | 7883697 |
| 210 | 2929243439 | 2929239360 | Bacteria | 7745570 |
| 211 | 2932086752 | 2932082852 | Bacteria | 6563563 |
| 212 | 2945983936 | 2945977869 | Bacteria | 7777518 |
| 213 | 2946016671 | 2946013367 | Bacteria | 7766675 |
| 214 | Ga0105239_10000012 | |||
| 215 | JGI24737J22298_10000042 | |||
| 216 | JGI24735J21928_10000014 | |||
| 217 | JGI25162J39368_1000022 | |||
| 218 | rootH1_10044863 | |||
| 219 | rootH2_10002871 | |||
| 220 | rootH2_10008717 | |||
| 221 | rootH2_10009544 | |||
| 222 | rootH2_10108312 | |||
| 223 | rootL2_10022046 | |||
| 224 | rootL2_10051564 | |||
| 225 | rootH1_10006785 | |||
| 226 | Ga0055531_10000144 | |||
| 227 | Ga0070658_10000047 | |||
| 228 | Ga0070658_10027019 | |||
| 229 | Ga0070683_100014107 | |||
| 230 | Ga0070666_10010421 | |||
| 231 | Ga0070680_100010363 | |||
| 232 | Ga0070680_100045469 | |||
| 233 | Ga0070660_100001792 | |||
| 234 | Ga0070660_100017844 | |||
| 235 | Ga0070671_100001421 | |||
| 236 | Ga0070673_100001562 | |||
| 237 | Ga0070659_100003474 | |||
| 238 | Ga0070659_100004502 | |||
| 239 | Ga0070662_100000083 | |||
| 240 | Ga0070681_10021037 | |||
| 241 | Ga0070679_100001254 | |||
| 242 | Ga0070684_100008118 | |||
| 243 | Ga0068853_100015998 | |||
| 244 | Ga0068853_100061938 | |||
| 245 | Ga0070665_100000041 | |||
| 246 | Ga0070665_100000267 | |||
| 247 | Ga0068855_100000506 | |||
| 248 | Ga0068855_100000704 | |||
| 249 | Ga0068855_100000748 | |||
| 250 | Ga0068855_100018316 | |||
| 251 | Ga0068855_100078844 | |||
| 252 | Ga0068857_100006959 | |||
| 253 | Ga0068856_100000015 | |||
| 254 | Ga0068856_100008864 | |||
| 255 | Ga0068856_100109041 | |||
| 256 | Ga0068852_100001785 | |||
| 257 | Ga0068860_100000208 | |||
| 258 | Ga0068860_100007619 | |||
| 259 | Ga0075366_10000386 | |||
| 260 | Ga0097621_100000259 | |||
| 261 | Ga0068871_100000824 | |||
| 262 | Ga0068865_100000492 | |||
| 263 | Ga0105240_10000224 | |||
| 264 | Ga0105240_10000728 | |||
| 265 | Ga0105240_10002232 | |||
| 266 | Ga0105241_10000493 | |||
| 267 | Ga0105241_10002347 | |||
| 268 | Ga0105237_10000622 | |||
| 269 | Ga0105237_10002801 | |||
| 270 | Ga0105237_10008284 | |||
| 271 | Ga0105237_10018180 | |||
| 272 | Ga0105237_10023397 | |||
| 273 | Ga0105237_10028338 | |||
| 274 | Ga0105238_10000247 | |||
| 275 | Ga0105238_10008890 | |||
| 276 | Ga0105239_10000002 | |||
| 277 | Ga0105239_10000685 | |||
| 278 | Ga0105239_10000887 | |||
| 279 | Ga0105239_10001617 | |||
| 280 | Ga0105239_10008895 | |||
| 281 | Ga0105239_10034753 | |||
| 282 | Ga0157373_10001878 | |||
| 283 | Ga0157373_10003781 | |||
| 284 | Ga0157371_10001086 | |||
| 285 | Ga0157371_10001267 | |||
| 286 | Ga0157371_10003814 | |||
| 287 | Ga0157371_10003970 | |||
| 288 | Ga0157371_10006969 | |||
| 289 | Ga0157371_10013988 | |||
| 290 | Ga0157370_10006476 | |||
| 291 | Ga0157369_10020699 | |||
| 292 | Ga0157369_10061497 | |||
| 293 | Ga0157374_10000001 | |||
| 294 | Ga0157374_10001231 | |||
| 295 | Ga0157374_10001437 | |||
| 296 | Ga0163162_10000034 | |||
| 297 | Ga0163162_10001520 | |||
| 298 | Ga0163162_10025420 | |||
| 299 | Ga0157372_10000252 | |||
| 300 | Ga0157372_10000317 | |||
| 301 | Ga0157372_10002015 | |||
| 302 | Ga0157372_10002225 | |||
| 303 | Ga0157372_10109233 | |||
| 304 | Ga0157375_10016384 | |||
| 305 | Ga0182005_1000091 | |||
| 306 | Ga0207427_100171 | |||
| 307 | Ga0209437_100024 | |||
| 308 | Ga0209437_100052 | |||
| 309 | Ga0209258_100081 | |||
| 310 | Ga0209026_1000834 | |||
| 311 | Ga0209026_1006353 | |||
| 312 | Ga0209148_1000202 | |||
| 313 | Ga0209233_1000067 | |||
| 314 | Ga0209130_1001650 | |||
| 315 | Ga0207426_1000114 | |||
| 316 | Ga0207426_1012464 | |||
| 317 | Ga0209257_1000064 | |||
| 318 | Ga0207647_10000098 | |||
| 319 | Ga0207647_10014136 | |||
| 320 | Ga0207645_10000185 | |||
| 321 | Ga0207705_10000052 | |||
| 322 | Ga0207654_10001487 | |||
| 323 | Ga0207695_10000110 | |||
| 324 | Ga0207695_10000189 | |||
| 325 | Ga0207695_10002344 | |||
| 326 | Ga0207695_10005513 | |||
| 327 | Ga0207695_10036926 | |||
| 328 | Ga0207671_10002229 | |||
| 329 | Ga0207671_10003957 | |||
| 330 | Ga0207671_10004371 | |||
| 331 | Ga0207671_10005442 | |||
| 332 | Ga0207671_10005873 | |||
| 333 | Ga0207671_10020779 | |||
| 334 | Ga0207657_10004060 | |||
| 335 | Ga0207657_10025671 | |||
| 336 | Ga0207657_10034131 | |||
| 337 | Ga0207652_10000180 | |||
| 338 | Ga0207652_10000337 | |||
| 339 | Ga0207694_10020081 | |||
| 340 | Ga0207644_10001351 | |||
| 341 | Ga0207706_10000176 | |||
| 342 | Ga0207704_10000055 | |||
| 343 | Ga0207667_10000144 | |||
| 344 | Ga0207667_10000375 | |||
| 345 | Ga0207667_10000773 | |||
| 346 | Ga0207667_10002384 | |||
| 347 | Ga0207667_10002632 | |||
| 348 | Ga0207667_10100429 | |||
| 349 | Ga0207651_10011900 | |||
| 350 | Ga0207639_10012076 | |||
| 351 | Ga0207702_10002568 | |||
| 352 | Ga0207674_10011947 | |||
| 353 | Ga0268266_10000014 | |||
| 354 | Ga0268266_10000018 | |||
| 355 | Ga0268264_10000041 | |||
| 356 | Ga0268264_10000950 | |||
| 357 | Ga0307517_10022720 | |||
| 358 | Ga0307517_10028299 | |||
| 359 | Ga0307515_10005287 | |||
| 360 | Ga0307515_10017194 | |||
| 361 | Ga0307511_10000122 | |||
| 362 | Ga0307516_10001339 | |||
| 363 | Ga0307507_10002030 | |||
| 364 | Ga0307510_10003612 | |||
| 365 | Ga0395899_0000002 | |||
| 366 | Ga0395899_0010665 | |||
| 367 | Ga0395900_0001549 | |||
| 368 | Ga0395900_0018022 | |||
| 369 | Ga0395900_0019851 | |||
| 370 | Ga0395905_0000520 | |||
| 371 | Ga0395905_0003309 | |||
| 372 | Ga0395905_0041792 | |||
| 373 | Ga0395905_0079644 | |||
| 374 | Ga0395901_0003324 | |||
| 375 | Ga0395901_0003411 | |||
| 376 | Ga0395901_0003486 | |||
| 377 | Ga0436365_1133037 | |||
| 378 | Ga0495650_0000003 | |||
| 379 | Ga0495585_0000085 | |||
| 380 | Ga0495606_0000145 | |||
| 381 | Ga0495606_0011010 | |||
| 382 | Ga0495610_0001185 | |||
| 383 | Ga0495648_0000729 | |||
| 384 | Ga0495633_0000069 | |||
| 385 | Ga0495633_0000123 | |||
| 386 | Ga0495633_0023872 | |||
| 387 | Ga0495668_0000003 | |||
| 388 | Ga0495625_0000005 | |||
| 389 | Ga0495625_0001880 | |||
| 390 | Ga0495625_0030259 | |||
| 391 | Ga0495661_0000511 | |||
| 392 | Ga0495649_0000003 | |||
| 393 | Ga0495687_000001 | |||
| 394 | Ga0495687_000672 | |||
| 395 | Ga0495687_002396 | |||
| 396 | Ga0495686_0000367 | |||
| 397 | Ga0496121_0000011 | |||
| 398 | Ga0496126_0026817 | |||
| 399 | Ga0501241_001305 | |||
| 400 | nmdc:mga0k408_342_c1 | |||
| 401 | Ga0500644_0000035 | |||
| 402 | Ga0500583_0000989 | |||
| 403 | Ga0500651_0006188 | |||
| 404 | Ga0500608_000736 | |||
| 405 | Ga0500618_000002 | |||
| 406 | Ga0500568_0017858 | |||
| 407 | Ga0500577_0002129 | |||
| 408 | Ga0500616_0011240 | |||
| 409 | Ga0500622_0000203 | |||
| 410 | Ga0500622_0001514 | |||
| 411 | Ga0466962_0020802 | |||
| 412 | 2599477708 | |||
| 413 | 2819576266 | |||
| 414 | 2819681636 | |||
| 415 | 2821142494 | |||
| 416 | 2884792376 | |||
| 417 | 2904470338 | |||
| 418 | 2910249918 | |||
| 419 | 2919441663 | |||
| 420 | 2928079624 | |||
| 421 | 2928147900 | |||
| 422 | 2929181526 | |||
| 423 | 2929243439 | |||
| 424 | 2932086752 | |||
| 425 | 2945983936 | |||
| 426 | 2946016671 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mj6-assembly1.cif.gz_A | ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity. | 0.7737 | 63 | 638 |
| 3se6-assembly2.cif.gz_B | crystal structure of the human endoplasmic reticulum aminopeptidase 2 | 0.762 | 62 | 641 |
| 7zyf-assembly1.cif.gz_A | insulin regulated aminopeptidase (irap) in complex with a nanomolar alpha hydroxy beta amino acid based inhibitor. | 0.7599 | 63 | 638 |
| 1z5h-assembly1.cif.gz_A | crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum | 0.7595 | 61 | 638 |
| 4p8q-assembly1.cif.gz_A | crystal structure of human insulin regulated aminopeptidase with alanine in active site | 0.7501 | 62 | 638 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EGH4_402_652_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.8008 | 328 | 543 | 1.10.390.10 |
| af_Q22531_292_547_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.8005 | 326 | 540 | 1.10.390.10 |
| 2dq6A03 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.7991 | 408 | 553 | 1.10.390.10 |
| af_Q9UKU6_341_596_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.7985 | 328 | 552 | 1.10.390.10 |
| af_Q9VFX0_332_577_1.10.390.10 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.7973 | 343 | 553 | 1.10.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1Q885-F1-model_v4 | deleted | 0.9665 | 572 | 652 |
|
| AF-A0A519W4N5-F1-model_v4 | M1 family peptidase | 0.9645 | 254 | 651 |
GO:0008237
GO:0008270 |
| AF-A0A848QDG2-F1-model_v4 | deleted | 0.9638 | 460 | 650 |
|
| AF-A0A4Q5R014-F1-model_v4 | M1 family peptidase | 0.9636 | 135 | 650 |
GO:0008237
GO:0008270 |
| AF-A0A4V1SUQ0-F1-model_v4 | M1 family peptidase | 0.9636 | 184 | 532 |
GO:0008237
GO:0008270 |