F324044

General Info

Members Datasets Scaffolds Average Seq Length
213 120 213 227

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10006902|Ga0157371_100069026
Length 252
Sequence MAHGRFCNLYAVFQKIKGADCLILHSLKNLKMKFGVVIFPGSNCDRDMIDALQNDLNQEVITLWHKHKDLSMFDTSDCILLPGGFSYGDYLRCGAIARFSPMMQSVIDFANKGGKVFGVCNGFQILCESGLLPGVLLQNAQMKFACKNTFIKNDLTNEVLKIPVAHGEGRFFVKEEELEEIEKNEQVIYSYCDEKGEIHIDHSPNGSIHSIAGISNKERNVFGMMPHPERACSEALGNTDGKKVFKELFSIN

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10018308 3300005327 Bacteria 5607
2 Ga0070658_10039226 3300005327 Bacteria 3820
3 Ga0070658_10040462 3300005327 Bacteria 3760
4 Ga0070676_10151224 3300005328 Bacteria 1486
5 Ga0070683_100174935 3300005329 Bacteria 2038
6 Ga0070670_100146246 3300005331 Bacteria 2045
7 Ga0070680_100008831 3300005336 Bacteria 7728
8 Ga0070680_100015143 3300005336 Bacteria 6040
9 Ga0070680_100102583 3300005336 Bacteria 2376
10 Ga0070660_100002965 3300005339 Bacteria 11676
11 Ga0070660_100064087 3300005339 Bacteria 2859
12 Ga0070660_100163801 3300005339 Bacteria 1793
13 Ga0070660_100225532 3300005339 Bacteria 1524
14 Ga0070692_10097620 3300005345 Bacteria 1606
15 Ga0070659_100009739 3300005366 Bacteria 7060
16 Ga0070659_100010605 3300005366 Bacteria 6786
17 Ga0070659_100017860 3300005366 Bacteria 5344
18 Ga0070711_100413780 3300005439 Unclassified 1097
19 Ga0070663_100136081 3300005455 Bacteria 1871
20 Ga0070681_10059140 3300005458 Bacteria 3812
21 Ga0068867_100247631 3300005459 Bacteria 1448
22 Ga0070685_10236581 3300005466 Bacteria 1204
23 Ga0070706_100129394 3300005467 Bacteria 2355
24 Ga0070706_100210003 3300005467 Bacteria 1818
25 Ga0070706_100577795 3300005467 Bacteria 1045
26 Ga0070707_100121035 3300005468 Bacteria 2541
27 Ga0070679_100036567 3300005530 Bacteria 4873
28 Ga0070679_100258843 3300005530 Bacteria 1695
29 Ga0070679_100283304 3300005530 Bacteria 1609
30 Ga0070697_100320935 3300005536 Bacteria 1334
31 Ga0070697_100397179 3300005536 Bacteria 1196
32 Ga0070697_100775000 3300005536 Bacteria 848
33 Ga0070696_100323108 3300005546 Bacteria 1188
34 Ga0070704_100073833 3300005549 Bacteria 2486
35 Ga0068855_100012821 3300005563 Bacteria 10113
36 Ga0068855_100027745 3300005563 Bacteria 6774
37 Ga0068855_100049411 3300005563 Bacteria 4961
38 Ga0068855_100159460 3300005563 Bacteria 2561
39 Ga0068857_100486762 3300005577 Bacteria 1156
40 Ga0068856_100027876 3300005614 Bacteria 5511
41 Ga0068856_100616221 3300005614 Bacteria 1106
42 Ga0068852_100072038 3300005616 Bacteria 3036
43 Ga0068852_100569213 3300005616 Bacteria 1135
44 Ga0068859_100520148 3300005617 Bacteria 1285
45 Ga0068859_100908951 3300005617 Bacteria 965
46 Ga0068864_100499200 3300005618 Bacteria 1170
47 Ga0068861_100180762 3300005719 Bacteria 1756
48 Ga0068861_100744128 3300005719 Bacteria 915
49 Ga0070712_100199949 3300006175 Bacteria 1569
50 Ga0070712_100683275 3300006175 Bacteria 874
51 Ga0075428_100061041 3300006844 Bacteria 4128
52 Ga0075434_100037550 3300006871 Bacteria 4796
53 Ga0075434_100488910 3300006871 Bacteria 1251
54 Ga0068865_100214653 3300006881 Bacteria 1501
55 Ga0075436_100051138 3300006914 Bacteria 2852
56 Ga0097620_100520191 3300006931 Bacteria 1285
57 Ga0097620_100908934 3300006931 Bacteria 965
58 Ga0075435_100335254 3300007076 Bacteria 1296
59 Ga0099794_10014322 3300007265 Bacteria 3472
60 Ga0099795_10069837 3300007788 Bacteria 1323
61 Ga0105244_10009059 3300009036 Bacteria 6153
62 Ga0105240_10046704 3300009093 Bacteria 5485
63 Ga0114129_10009263 3300009147 Bacteria 14042
64 Ga0114129_10317586 3300009147 Bacteria 2071
65 Ga0105249_10109911 3300009553 Bacteria 2604
66 Ga0099796_10060366 3300010159 Bacteria 1342
67 Ga0105246_10432230 3300011119 Unclassified 1102
68 Ga0157373_10000191 3300013100 Bacteria 50334
69 Ga0157373_10005156 3300013100 Bacteria 9821
70 Ga0157373_10050454 3300013100 Bacteria 2963
71 Ga0157373_10096900 3300013100 Bacteria 2077
72 Ga0157371_10000651 3300013102 Bacteria 41136
73 Ga0157371_10003531 3300013102 Bacteria 14107
74 Ga0157371_10006302 3300013102 Bacteria 9826
75 Ga0157371_10006902 3300013102 Bacteria 9270
76 Ga0157371_10022041 3300013102 Bacteria 4673
77 Ga0157371_10055710 3300013102 Bacteria 2806
78 Ga0157371_10116051 3300013102 Bacteria 1902
79 Ga0157371_10126117 3300013102 Unclassified 1820
80 Ga0157371_10214987 3300013102 Bacteria 1380
81 Ga0157370_10001583 3300013104 Bacteria 28157
82 Ga0157370_10042686 3300013104 Bacteria 4369
83 Ga0157370_10310807 3300013104 Bacteria 1454
84 Ga0157370_10381984 3300013104 Bacteria 1297
85 Ga0157370_11026051 3300013104 Bacteria 746
86 Ga0157369_10080158 3300013105 Bacteria 3496
87 Ga0157369_10317166 3300013105 Bacteria 1621
88 Ga0157369_10800648 3300013105 Bacteria 968
89 Ga0157374_10210993 3300013296 Bacteria 1904
90 Ga0157374_10257450 3300013296 Bacteria 1718
91 Ga0163162_10039590 3300013306 Bacteria 4711
92 Ga0157372_10014332 3300013307 Bacteria 8476
93 Ga0157372_10018907 3300013307 Bacteria 7414
94 Ga0157372_10052700 3300013307 Bacteria 4531
95 Ga0157372_10080362 3300013307 Bacteria 3688
96 Ga0157372_10643728 3300013307 Bacteria 1235
97 Ga0157372_10816312 3300013307 Bacteria 1083
98 Ga0157372_11039778 3300013307 Bacteria 948
99 Ga0163163_10105257 3300014325 Bacteria 2847
100 Ga0157380_10113500 3300014326 Bacteria 2282
101 Ga0157379_10336732 3300014968 Bacteria 1379
102 Ga0213876_10042738 3300021384 Bacteria 2395
103 Ga0207647_10191957 3300025904 Bacteria 1183
104 Ga0207705_10008007 3300025909 Bacteria 7749
105 Ga0207705_10013841 3300025909 Bacteria 5817
106 Ga0207705_10046900 3300025909 Bacteria 3107
107 Ga0207705_10101235 3300025909 Unclassified 2119
108 Ga0207684_10073654 3300025910 Bacteria 2901
109 Ga0207707_10012567 3300025912 Bacteria 7359
110 Ga0207660_10008538 3300025917 Bacteria 6627
111 Ga0207660_10068450 3300025917 Bacteria 2575
112 Ga0207660_10217107 3300025917 Bacteria 1499
113 Ga0207660_10787422 3300025917 Bacteria 776
114 Ga0207657_10008005 3300025919 Bacteria 10774
115 Ga0207657_10033140 3300025919 Bacteria 4659
116 Ga0207657_10386654 3300025919 Bacteria 1101
117 Ga0207652_10000018 3300025921 Bacteria 187527
118 Ga0207652_10000694 3300025921 Bacteria 32670
119 Ga0207652_10006757 3300025921 Bacteria 9249
120 Ga0207652_10820104 3300025921 Bacteria 825
121 Ga0207646_10275669 3300025922 Bacteria 1520
122 Ga0207659_10275124 3300025926 Bacteria 1375
123 Ga0207690_10172162 3300025932 Bacteria 1623
124 Ga0207690_10172307 3300025932 Bacteria 1622
125 Ga0207670_10348929 3300025936 Bacteria 1171
126 Ga0207704_10263484 3300025938 Bacteria 1301
127 Ga0207665_10222699 3300025939 Bacteria 1383
128 Ga0207665_10237017 3300025939 Bacteria 1343
129 Ga0207661_10048023 3300025944 Bacteria 3391
130 Ga0207667_10008310 3300025949 Bacteria 12349
131 Ga0207667_10079352 3300025949 Bacteria 3402
132 Ga0207667_10570004 3300025949 Bacteria 1144
133 Ga0207678_10056431 3300026067 Bacteria 3380
134 Ga0207641_10370839 3300026088 Bacteria 1369
135 Ga0207674_10103558 3300026116 Bacteria 2825
136 Ga0207674_10484006 3300026116 Bacteria 1196
137 Ga0207675_100050794 3300026118 Bacteria 3870
138 Ga0207698_10178073 3300026142 Bacteria 1880
139 Ga0207698_11274121 3300026142 Unclassified 750
140 Ga0268264_10142866 3300028381 Bacteria 2136
141 Ga0268264_10356117 3300028381 Bacteria 1394
142 Ga0265332_10001136 3300031238 Bacteria 15449
143 Ga0265339_10000406 3300031249 Bacteria 33894
144 Ga0265331_10002526 3300031250 Bacteria 12334
145 Ga0265313_10150112 3300031595 Bacteria 996
146 Ga0265314_10000449 3300031711 Bacteria 55159
147 Ga0265342_10011674 3300031712 Bacteria 5993
148 Ga0316583_10000002 3300032133 Bacteria 59484
149 Ga0373923_0038536 3300035111 Bacteria 1959
150 Ga0373954_0042965 3300035118 Bacteria 2107
151 Ga0373955_0014363 3300035172 Bacteria 3850
152 Ga0373935_0183742 3300035692 Bacteria 1437
153 Ga0373927_0016866 3300035695 Bacteria 4816
154 Ga0373927_0070238 3300035695 Bacteria 2267
155 Ga0373933_0049265 3300035724 Bacteria 2511
156 Ga0373937_0001272 3300036401 Bacteria 21126
157 Ga0373925_0467647 3300037068 Bacteria 1034
158 Ga0395899_0003749 3300037312 Bacteria 12009
159 Ga0395899_0012123 3300037312 Bacteria 6600
160 Ga0395899_0058734 3300037312 Bacteria 2836
161 Ga0395899_0127218 3300037312 Unclassified 1821
162 Ga0395900_0002331 3300037418 Bacteria 21014
163 Ga0395900_0013697 3300037418 Bacteria 8278
164 Ga0395900_0014755 3300037418 Bacteria 7963
165 Ga0395900_0024391 3300037418 Bacteria 6193
166 Ga0395900_0063650 3300037418 Bacteria 3791
167 Ga0395900_0375670 3300037418 Bacteria 1390
168 Ga0395900_0514376 3300037418 Bacteria 1146
169 Ga0395898_0001959 3300037466 Bacteria 26028
170 Ga0395898_0009414 3300037466 Bacteria 10259
171 Ga0395898_0018844 3300037466 Bacteria 7032
172 Ga0395905_0036208 3300037471 Bacteria 4634
173 Ga0395901_0003954 3300038443 Bacteria 14909
174 Ga0395901_0021047 3300038443 Bacteria 6681
175 Ga0395901_0047116 3300038443 Bacteria 4476
176 Ga0395901_0336710 3300038443 Bacteria 1559
177 Ga0436365_0427875 3300039437 Bacteria 8704
178 Ga0436362_0876933 3300039453 Bacteria 1564
179 Ga0436362_1282136 3300039453 Bacteria 1928
180 Ga0439465_0015661 3300041413 Bacteria 2365
181 Ga0451576_0250025 3300045051 Bacteria 1853
182 Ga0495580_0145215 3300046472 Bacteria 1644
183 Ga0495628_0089664 3300046516 Bacteria 2381
184 Ga0495622_0179529 3300046557 Bacteria 950
185 Ga0495647_0059742 3300046681 Bacteria 1502
186 Ga0495658_0053074 3300046683 Bacteria 2301
187 Ga0495658_0150589 3300046683 Bacteria 1429
188 Ga0496113_0018893 3300048916 Bacteria 4811
189 Ga0501032_0045041 3300049569 Bacteria 2985
190 Ga0501033_0071775 3300049570 Unclassified 2543
191 Ga0501033_0341187 3300049570 Bacteria 1050
192 Ga0501034_0004635 3300049571 Bacteria 15228
193 Ga0501034_0016236 3300049571 Bacteria 7641
194 Ga0501038_0779481 3300049574 Bacteria 712
195 Ga0501043_0183889 3300049579 Bacteria 1628
196 Ga0501073_0024102 3300049589 Bacteria 4370
197 Ga0501073_0107896 3300049589 Bacteria 1932
198 Ga0501076_0213068 3300049592 Bacteria 1579
199 Ga0501080_0080042 3300049742 Bacteria 3037
200 Ga0501083_0116584 3300049744 Bacteria 1753
201 Ga0501035_0027601 3300049822 Bacteria 5188
202 Ga0501035_0382717 3300049822 Bacteria 1173
203 Ga0501044_0112438 3300049823 Unclassified 2730
204 Ga0501044_0115315 3300049823 Bacteria 2692
205 Ga0501044_0226610 3300049823 Unclassified 1818
206 nmdc:mga05p37_294046_c1 3300050507 Bacteria 1932
207 nmdc:mga09592_318997_c1 3300050508 Bacteria 1346
208 nmdc:mga0n895_116765_c1 3300050512 Bacteria 2687
209 nmdc:mga0n895_242380_c1 3300050512 Bacteria 1830
210 nmdc:mga0n895_56433_c1 3300050512 Bacteria 3869
211 nmdc:mga0rr50_110743_c1 3300050513 Bacteria 2172
212 nmdc:mga08x19_2213_c1 3300050514 Bacteria 11886
213 Ga0501082_0132766 3300060353 Bacteria 2160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10151224 Ga0070676_101512242 199
2 3300046681 Ga0495647_0059742 Ga0495647_0059742_793_1482 199
3 3300041413 Ga0439465_0015661 Ga0439465_0015661_1355_2029 200
4 3300049570 Ga0501033_0071775 Ga0501033_0071775_1245_1859 204
5 3300049571 Ga0501034_0004635 Ga0501034_0004635_2778_3392 204
6 3300049742 Ga0501080_0080042 Ga0501080_0080042_2051_2665 204
7 3300049823 Ga0501044_0112438 Ga0501044_0112438_486_1100 204
8 3300013102 Ga0157371_10116051 Ga0157371_101160514 205
9 3300013307 Ga0157372_10643728 Ga0157372_106437282 205
10 3300005549 Ga0070704_100073833 Ga0070704_1000738333 206
11 3300048916 Ga0496113_0018893 Ga0496113_0018893_3422_4096 206
12 3300049574 Ga0501038_0779481 Ga0501038_0779481_60_683 206
13 3300005546 Ga0070696_100323108 Ga0070696_1003231081 207
14 3300006871 Ga0075434_100488910 Ga0075434_1004889101 207
15 3300007076 Ga0075435_100335254 Ga0075435_1003352542 207
16 3300009147 Ga0114129_10317586 Ga0114129_103175862 207
17 3300025939 Ga0207665_10237017 Ga0207665_102370172 207
18 3300050507 nmdc:mga05p37_294046_c1 nmdc:mga05p37_294046_c1_1121_1819 207
19 3300050512 nmdc:mga0n895_242380_c1 nmdc:mga0n895_242380_c1_161_859 207
20 3300050512 nmdc:mga0n895_56433_c1 nmdc:mga0n895_56433_c1_1711_2409 207
21 3300050513 nmdc:mga0rr50_110743_c1 nmdc:mga0rr50_110743_c1_805_1503 207
22 3300005459 Ga0068867_100247631 Ga0068867_1002476312 208
23 3300006175 Ga0070712_100683275 Ga0070712_1006832752 208
24 3300006871 Ga0075434_100037550 Ga0075434_1000375502 208
25 3300009147 Ga0114129_10009263 Ga0114129_100092636 208
26 3300009036 Ga0105244_10009059 Ga0105244_100090596 210
27 3300039453 Ga0436362_0876933 Ga0436362_0876933_73_759 213
28 3300031238 Ga0265332_10001136 Ga0265332_1000113614 214
29 3300031249 Ga0265339_10000406 Ga0265339_1000040625 214
30 3300031250 Ga0265331_10002526 Ga0265331_100025265 214
31 3300031595 Ga0265313_10150112 Ga0265313_101501122 214
32 3300031711 Ga0265314_10000449 Ga0265314_1000044917 214
33 3300031712 Ga0265342_10011674 Ga0265342_100116745 214
34 3300032133 Ga0316583_10000002 Ga0316583_1000000232 214
35 3300049589 Ga0501073_0024102 Ga0501073_0024102_774_1502 214
36 3300049744 Ga0501083_0116584 Ga0501083_0116584_937_1665 214
37 3300005331 Ga0070670_100146246 Ga0070670_1001462462 215
38 3300005336 Ga0070680_100102583 Ga0070680_1001025832 215
39 3300005466 Ga0070685_10236581 Ga0070685_102365812 215
40 3300005467 Ga0070706_100129394 Ga0070706_1001293942 215
41 3300005467 Ga0070706_100210003 Ga0070706_1002100032 215
42 3300005467 Ga0070706_100577795 Ga0070706_1005777951 215
43 3300005468 Ga0070707_100121035 Ga0070707_1001210352 215
44 3300005536 Ga0070697_100320935 Ga0070697_1003209352 215
45 3300005563 Ga0068855_100027745 Ga0068855_1000277454 215
46 3300005614 Ga0068856_100616221 Ga0068856_1006162211 215
47 3300005617 Ga0068859_100520148 Ga0068859_1005201482 215
48 3300005617 Ga0068859_100908951 Ga0068859_1009089512 215
49 3300005719 Ga0068861_100180762 Ga0068861_1001807622 215
50 3300005719 Ga0068861_100744128 Ga0068861_1007441282 215
51 3300006175 Ga0070712_100199949 Ga0070712_1001999492 215
52 3300006844 Ga0075428_100061041 Ga0075428_1000610412 215
53 3300006881 Ga0068865_100214653 Ga0068865_1002146532 215
54 3300006914 Ga0075436_100051138 Ga0075436_1000511382 215
55 3300006931 Ga0097620_100520191 Ga0097620_1005201912 215
56 3300006931 Ga0097620_100908934 Ga0097620_1009089341 215
57 3300007265 Ga0099794_10014322 Ga0099794_100143223 215
58 3300007788 Ga0099795_10069837 Ga0099795_100698373 215
59 3300009093 Ga0105240_10046704 Ga0105240_100467042 215
60 3300009553 Ga0105249_10109911 Ga0105249_101099112 215
61 3300010159 Ga0099796_10060366 Ga0099796_100603663 215
62 3300013296 Ga0157374_10210993 Ga0157374_102109932 215
63 3300013306 Ga0163162_10039590 Ga0163162_100395903 215
64 3300014325 Ga0163163_10105257 Ga0163163_101052572 215
65 3300014326 Ga0157380_10113500 Ga0157380_101135003 215
66 3300014968 Ga0157379_10336732 Ga0157379_103367322 215
67 3300025910 Ga0207684_10073654 Ga0207684_100736543 215
68 3300025922 Ga0207646_10275669 Ga0207646_102756693 215
69 3300025926 Ga0207659_10275124 Ga0207659_102751242 215
70 3300025936 Ga0207670_10348929 Ga0207670_103489292 215
71 3300025938 Ga0207704_10263484 Ga0207704_102634842 215
72 3300025939 Ga0207665_10222699 Ga0207665_102226992 215
73 3300025949 Ga0207667_10079352 Ga0207667_100793523 215
74 3300026088 Ga0207641_10370839 Ga0207641_103708393 215
75 3300026116 Ga0207674_10484006 Ga0207674_104840063 215
76 3300026118 Ga0207675_100050794 Ga0207675_1000507943 215
77 3300028381 Ga0268264_10142866 Ga0268264_101428664 215
78 3300028381 Ga0268264_10356117 Ga0268264_103561171 215
79 3300035111 Ga0373923_0038536 Ga0373923_0038536_618_1355 215
80 3300035118 Ga0373954_0042965 Ga0373954_0042965_946_1683 215
81 3300035172 Ga0373955_0014363 Ga0373955_0014363_2203_2940 215
82 3300035692 Ga0373935_0183742 Ga0373935_0183742_327_1016 215
83 3300035695 Ga0373927_0016866 Ga0373927_0016866_3136_3873 215
84 3300035695 Ga0373927_0070238 Ga0373927_0070238_432_1121 215
85 3300035724 Ga0373933_0049265 Ga0373933_0049265_1016_1753 215
86 3300036401 Ga0373937_0001272 Ga0373937_0001272_10810_11547 215
87 3300037068 Ga0373925_0467647 Ga0373925_0467647_201_890 215
88 3300039453 Ga0436362_1282136 Ga0436362_1282136_1197_1889 215
89 3300045051 Ga0451576_0250025 Ga0451576_0250025_354_1076 215
90 3300046472 Ga0495580_0145215 Ga0495580_0145215_504_1241 215
91 3300046516 Ga0495628_0089664 Ga0495628_0089664_1585_2274 215
92 3300046683 Ga0495658_0053074 Ga0495658_0053074_888_1625 215
93 3300046683 Ga0495658_0150589 Ga0495658_0150589_243_974 215
94 3300050508 nmdc:mga09592_318997_c1 nmdc:mga09592_318997_c1_610_1293 215
95 3300050512 nmdc:mga0n895_116765_c1 nmdc:mga0n895_116765_c1_1157_1894 215
96 3300050514 nmdc:mga08x19_2213_c1 nmdc:mga08x19_2213_c1_7085_7822 215
97 3300046557 Ga0495622_0179529 Ga0495622_0179529_217_909 216
98 3300005536 Ga0070697_100397179 Ga0070697_1003971792 217
99 3300049589 Ga0501073_0107896 Ga0501073_0107896_826_1569 218
100 3300005536 Ga0070697_100775000 Ga0070697_1007750001 219
101 3300021384 Ga0213876_10042738 Ga0213876_100427383 219
102 3300039437 Ga0436365_0427875 Ga0436365_0427875_1853_2512 219
103 3300049592 Ga0501076_0213068 Ga0501076_0213068_668_1372 219
104 3300049822 Ga0501035_0382717 Ga0501035_0382717_322_981 219
105 3300060353 Ga0501082_0132766 Ga0501082_0132766_139_843 219
106 3300005327 Ga0070658_10040462 Ga0070658_100404623 221
107 3300005329 Ga0070683_100174935 Ga0070683_1001749352 221
108 3300005336 Ga0070680_100015143 Ga0070680_1000151433 221
109 3300005339 Ga0070660_100163801 Ga0070660_1001638011 221
110 3300005339 Ga0070660_100225532 Ga0070660_1002255322 221
111 3300005366 Ga0070659_100009739 Ga0070659_1000097395 221
112 3300005366 Ga0070659_100010605 Ga0070659_1000106054 221
113 3300005366 Ga0070659_100017860 Ga0070659_1000178603 221
114 3300005439 Ga0070711_100413780 Ga0070711_1004137802 221
115 3300005458 Ga0070681_10059140 Ga0070681_100591402 221
116 3300005530 Ga0070679_100036567 Ga0070679_1000365673 221
117 3300005530 Ga0070679_100258843 Ga0070679_1002588433 221
118 3300005530 Ga0070679_100283304 Ga0070679_1002833042 221
119 3300005563 Ga0068855_100012821 Ga0068855_1000128214 221
120 3300005563 Ga0068855_100049411 Ga0068855_1000494116 221
121 3300005577 Ga0068857_100486762 Ga0068857_1004867621 221
122 3300005616 Ga0068852_100072038 Ga0068852_1000720383 221
123 3300013100 Ga0157373_10005156 Ga0157373_100051566 221
124 3300013100 Ga0157373_10050454 Ga0157373_100504542 221
125 3300013100 Ga0157373_10096900 Ga0157373_100969002 221
126 3300013102 Ga0157371_10000651 Ga0157371_100006518 221
127 3300013102 Ga0157371_10006302 Ga0157371_100063024 221
128 3300013102 Ga0157371_10006902 Ga0157371_100069026 221
129 3300013102 Ga0157371_10022041 Ga0157371_100220413 221
130 3300013102 Ga0157371_10126117 Ga0157371_101261172 221
131 3300013102 Ga0157371_10214987 Ga0157371_102149872 221
132 3300013104 Ga0157370_10001583 Ga0157370_100015833 221
133 3300013104 Ga0157370_10310807 Ga0157370_103108072 221
134 3300013104 Ga0157370_10381984 Ga0157370_103819842 221
135 3300013105 Ga0157369_10317166 Ga0157369_103171662 221
136 3300013307 Ga0157372_10052700 Ga0157372_100527004 221
137 3300013307 Ga0157372_10080362 Ga0157372_100803623 221
138 3300013307 Ga0157372_10816312 Ga0157372_108163121 221
139 3300013307 Ga0157372_11039778 Ga0157372_110397781 221
140 3300025909 Ga0207705_10101235 Ga0207705_101012352 221
141 3300025917 Ga0207660_10068450 Ga0207660_100684502 221
142 3300025917 Ga0207660_10217107 Ga0207660_102171072 221
143 3300025917 Ga0207660_10787422 Ga0207660_107874221 221
144 3300025919 Ga0207657_10386654 Ga0207657_103866542 221
145 3300025921 Ga0207652_10000694 Ga0207652_1000069410 221
146 3300025921 Ga0207652_10006757 Ga0207652_100067575 221
147 3300025921 Ga0207652_10820104 Ga0207652_108201042 221
148 3300025932 Ga0207690_10172162 Ga0207690_101721622 221
149 3300025932 Ga0207690_10172307 Ga0207690_101723072 221
150 3300026116 Ga0207674_10103558 Ga0207674_101035583 221
151 3300026142 Ga0207698_10178073 Ga0207698_101780733 221
152 3300026142 Ga0207698_11274121 Ga0207698_112741211 221
153 3300037312 Ga0395899_0003749 Ga0395899_0003749_7096_7761 221
154 3300037312 Ga0395899_0012123 Ga0395899_0012123_3859_4524 221
155 3300037418 Ga0395900_0002331 Ga0395900_0002331_15566_16231 221
156 3300037418 Ga0395900_0013697 Ga0395900_0013697_2391_3056 221
157 3300037418 Ga0395900_0014755 Ga0395900_0014755_3219_3884 221
158 3300037466 Ga0395898_0001959 Ga0395898_0001959_93_758 221
159 3300037466 Ga0395898_0018844 Ga0395898_0018844_3150_3815 221
160 3300038443 Ga0395901_0003954 Ga0395901_0003954_11024_11689 221
161 3300038443 Ga0395901_0021047 Ga0395901_0021047_2107_2772 221
162 3300049569 Ga0501032_0045041 Ga0501032_0045041_88_753 221
163 3300049570 Ga0501033_0341187 Ga0501033_0341187_365_1030 221
164 3300049571 Ga0501034_0016236 Ga0501034_0016236_4067_4732 221
165 3300049579 Ga0501043_0183889 Ga0501043_0183889_783_1448 221
166 3300049822 Ga0501035_0027601 Ga0501035_0027601_380_1045 221
167 3300049823 Ga0501044_0115315 Ga0501044_0115315_111_776 221
168 3300005327 Ga0070658_10018308 Ga0070658_100183084 222
169 3300005327 Ga0070658_10039226 Ga0070658_100392263 222
170 3300005336 Ga0070680_100008831 Ga0070680_1000088312 222
171 3300005339 Ga0070660_100002965 Ga0070660_1000029653 222
172 3300005339 Ga0070660_100064087 Ga0070660_1000640873 222
173 3300005345 Ga0070692_10097620 Ga0070692_100976202 222
174 3300005455 Ga0070663_100136081 Ga0070663_1001360811 222
175 3300005563 Ga0068855_100159460 Ga0068855_1001594602 222
176 3300005614 Ga0068856_100027876 Ga0068856_1000278763 222
177 3300005616 Ga0068852_100569213 Ga0068852_1005692131 222
178 3300005618 Ga0068864_100499200 Ga0068864_1004992002 222
179 3300011119 Ga0105246_10432230 Ga0105246_104322302 222
180 3300013100 Ga0157373_10000191 Ga0157373_1000019129 222
181 3300013102 Ga0157371_10003531 Ga0157371_1000353113 222
182 3300013102 Ga0157371_10055710 Ga0157371_100557103 222
183 3300013104 Ga0157370_10042686 Ga0157370_100426863 222
184 3300013104 Ga0157370_11026051 Ga0157370_110260511 222
185 3300013105 Ga0157369_10080158 Ga0157369_100801582 222
186 3300013105 Ga0157369_10800648 Ga0157369_108006481 222
187 3300013296 Ga0157374_10257450 Ga0157374_102574502 222
188 3300013307 Ga0157372_10014332 Ga0157372_100143329 222
189 3300013307 Ga0157372_10018907 Ga0157372_100189075 222
190 3300025904 Ga0207647_10191957 Ga0207647_101919571 222
191 3300025909 Ga0207705_10008007 Ga0207705_100080073 222
192 3300025909 Ga0207705_10013841 Ga0207705_100138412 222
193 3300025909 Ga0207705_10046900 Ga0207705_100469001 222
194 3300025912 Ga0207707_10012567 Ga0207707_100125673 222
195 3300025917 Ga0207660_10008538 Ga0207660_100085384 222
196 3300025919 Ga0207657_10008005 Ga0207657_100080059 222
197 3300025919 Ga0207657_10033140 Ga0207657_100331402 222
198 3300025921 Ga0207652_10000018 Ga0207652_10000018129 222
199 3300025944 Ga0207661_10048023 Ga0207661_100480233 222
200 3300025949 Ga0207667_10008310 Ga0207667_1000831013 222
201 3300025949 Ga0207667_10570004 Ga0207667_105700042 222
202 3300026067 Ga0207678_10056431 Ga0207678_100564311 222
203 3300037312 Ga0395899_0058734 Ga0395899_0058734_300_968 222
204 3300037312 Ga0395899_0127218 Ga0395899_0127218_31_702 222
205 3300037418 Ga0395900_0024391 Ga0395900_0024391_3657_4325 222
206 3300037418 Ga0395900_0063650 Ga0395900_0063650_21_689 222
207 3300037418 Ga0395900_0375670 Ga0395900_0375670_10_681 222
208 3300037418 Ga0395900_0514376 Ga0395900_0514376_318_989 222
209 3300037466 Ga0395898_0009414 Ga0395898_0009414_7988_8659 222
210 3300037471 Ga0395905_0036208 Ga0395905_0036208_756_1424 222
211 3300038443 Ga0395901_0047116 Ga0395901_0047116_1072_1740 222
212 3300038443 Ga0395901_0336710 Ga0395901_0336710_718_1389 222
213 3300049823 Ga0501044_0226610 Ga0501044_0226610_71_742 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

42

136

0.87

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

31

247

0.86

PF00117

GATase

Glutamine amidotransferase class-I

44

248

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8681 2 220
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8407 2 220
7dw7-assembly1.cif.gz_A crystal structure of n1051a mutant of formylglycinamidine synthetase 0.8068 2 209
6jta-assembly1.cif.gz_A crystal structure of d464a l465a mutant of fgam synthetase 0.8062 2 209
4lgy-assembly1.cif.gz_A importance of hydrophobic cavities in allosteric regulation of formylglycinamide synthetase: insight from xenon trapping and statistical coupling analysis 0.8059 2 209
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9144 1 220 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9026 1 220 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8957 1 220 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8908 2 220 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.88 1 220 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9777 84 197 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9751 83 212 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A386HRR4-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9733 1 218 GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541
AF-A0A520I2E2-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9719 1 51 GO:0004642
GO:0006189
AF-A0A537FVQ6-F1-model_v4 Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3) 0.971 72 198 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Feature Viewer

pLDDT pTM Quality
91.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map