F324280

General Info

Members Datasets Scaffolds Average Seq Length
213 174 426 66

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0631372|Ga0436364_0631372_519_743
Length 74
Sequence MAAEPAHPLRNHIRVERARHDLTQEQLAELVGVTRKTINTVETGRFIPSTVLALKLARALRTRVDELFYLDDTD

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 2738541284 Pedobacter sp. YR016 Isolate Unclassified
168 2739367651 Pedobacter sp. OK291 Isolate Unclassified
169 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
170 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
171 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
172 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
173 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
174 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0
Isolates 3.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.98
Nodule 0
Rhizoplane 7.04
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0631372 3300037853 Bacteria 1810
2 JGI24735J21928_10193312 3300002067 Bacteria 590
3 JGI24033J26618_1049663 3300002155 Bacteria 600
4 JGI25152J39213_1000028 3300002773 Bacteria 100367
5 JGI25150J39212_1000006 3300002774 Bacteria 257228
6 JGI25151J46595_10000024 3300003187 Bacteria 217596
7 JGI25153J46596_10000026 3300003215 Bacteria 217245
8 rootH2_10046647 3300003320 Bacteria 6966
9 JGI25160J50197_1006884 3300003354 Bacteria 4534
10 Ga0065714_10305542 3300005288 Unclassified 641
11 Ga0065704_10585971 3300005289 Bacteria 615
12 Ga0070658_10050737 3300005327 Bacteria 3363
13 Ga0070658_10097721 3300005327 Bacteria 2425
14 Ga0070677_10758431 3300005333 Bacteria 551
15 Ga0070660_100039211 3300005339 Bacteria 3600
16 Ga0070691_10705143 3300005341 Bacteria 606
17 Ga0070671_100165399 3300005355 Bacteria 1870
18 Ga0070659_100000134 3300005366 Bacteria 56651
19 Ga0070711_100548357 3300005439 Bacteria 959
20 Ga0070686_100223387 3300005544 Bacteria 1362
21 Ga0068854_100569286 3300005578 Bacteria 963
22 Ga0081455_10340666 3300005937 Bacteria 1061
23 Ga0070717_10631166 3300006028 Bacteria 972
24 Ga0070712_100467449 3300006175 Unclassified 1053
25 Ga0097621_100716841 3300006237 Bacteria 922
26 Ga0068871_101523692 3300006358 Bacteria 632
27 Ga0075433_10123123 3300006852 Bacteria 2303
28 Ga0075434_101672138 3300006871 Bacteria 644
29 Ga0068865_101079666 3300006881 Bacteria 706
30 Ga0068865_101827730 3300006881 Bacteria 549
31 Ga0075435_100216124 3300007076 Bacteria 1627
32 Ga0105240_10000573 3300009093 Bacteria 68110
33 Ga0111539_10194673 3300009094 Bacteria 2365
34 Ga0105245_10442281 3300009098 Bacteria 1307
35 Ga0114129_12306898 3300009147 Bacteria 646
36 Ga0105243_10385543 3300009148 Bacteria 1297
37 Ga0105243_10838033 3300009148 Bacteria 910
38 Ga0105243_13093707 3300009148 Bacteria 504
39 Ga0105241_10166836 3300009174 Bacteria 1815
40 Ga0105242_10109470 3300009176 Bacteria 2352
41 Ga0105242_11101249 3300009176 Bacteria 808
42 Ga0105237_10000143 3300009545 Bacteria 101515
43 Ga0105238_10067723 3300009551 Bacteria 3571
44 Ga0105239_10004079 3300010375 Bacteria 17596
45 Ga0157373_10069765 3300013100 Bacteria 2484
46 Ga0157370_10008834 3300013104 Bacteria 10831
47 Ga0157370_10168677 3300013104 Bacteria 2035
48 Ga0157369_10000158 3300013105 Bacteria 96395
49 Ga0157374_10180824 3300013296 Bacteria 2060
50 Ga0157374_10879398 3300013296 Bacteria 913
51 Ga0163162_10954926 3300013306 Bacteria 968
52 Ga0157372_11544635 3300013307 Bacteria 764
53 Ga0182008_10025172 3300014497 Bacteria 3024
54 Ga0182006_1000729 3300015261 Bacteria 22667
55 Ga0182007_10000008 3300015262 Bacteria 332953
56 Ga0182007_10021416 3300015262 Bacteria 2297
57 Ga0213872_10055808 3300021361 Bacteria 1790
58 Ga0209436_100249 3300025208 Bacteria 24709
59 Ga0207425_1000003 3300025245 Bacteria 1145342
60 Ga0209129_1000022 3300025258 Bacteria 440876
61 Ga0209130_1001185 3300025284 Bacteria 18625
62 Ga0209025_1000007 3300025294 Bacteria 1145109
63 Ga0209758_1000012 3300025297 Bacteria 949866
64 Ga0207426_1000415 3300025302 Bacteria 70247
65 Ga0207685_10304815 3300025905 Bacteria 789
66 Ga0207705_10039365 3300025909 Bacteria 3388
67 Ga0207705_10741095 3300025909 Bacteria 763
68 Ga0207654_10003364 3300025911 Bacteria 8099
69 Ga0207695_10000183 3300025913 Bacteria 181350
70 Ga0207671_10000968 3300025914 Bacteria 35551
71 Ga0207693_10431473 3300025915 Unclassified 1030
72 Ga0207663_11493825 3300025916 Bacteria 544
73 Ga0207657_10148359 3300025919 Bacteria 1912
74 Ga0207694_10403659 3300025924 Bacteria 1136
75 Ga0207644_10064113 3300025931 Bacteria 2670
76 Ga0207690_10000632 3300025932 Bacteria 22645
77 Ga0207709_10105294 3300025935 Bacteria 1874
78 Ga0207709_11604700 3300025935 Bacteria 540
79 Ga0207704_10426433 3300025938 Bacteria 1053
80 Ga0207704_10482071 3300025938 Bacteria 996
81 Ga0207640_10491059 3300025981 Bacteria 1020
82 Ga0207428_10394263 3300027907 Bacteria 1014
83 Ga0265334_10093510 3300028573 Unclassified 1095
84 Ga0265318_10104105 3300028577 Bacteria 1044
85 Ga0265323_10060996 3300028653 Bacteria 1312
86 Ga0265322_10003057 3300028654 Bacteria 5099
87 Ga0265336_10142232 3300028666 Bacteria 714
88 Ga0307515_10067220 3300028794 Bacteria 4948
89 Ga0265338_10007452 3300028800 Bacteria 13579
90 Ga0307512_10188143 3300030522 Bacteria 1145
91 Ga0265330_10038972 3300031235 Unclassified 2112
92 Ga0265332_10364475 3300031238 Unclassified 596
93 Ga0265325_10011650 3300031241 Bacteria 5049
94 Ga0265329_10010815 3300031242 Bacteria 3337
95 Ga0265340_10158967 3300031247 Bacteria 1027
96 Ga0265339_10028529 3300031249 Unclassified 3173
97 Ga0265327_10007278 3300031251 Bacteria 8586
98 Ga0265316_10031810 3300031344 Bacteria 4311
99 Ga0265313_10071792 3300031595 Unclassified 1592
100 Ga0265314_10010645 3300031711 Bacteria 7653
101 Ga0307405_10000014 3300031731 Bacteria 226733
102 Ga0307407_10000002 3300031903 Bacteria 323084
103 Ga0307407_10776298 3300031903 Bacteria 727
104 Ga0307409_100487992 3300031995 Bacteria 1197
105 Ga0307409_100612696 3300031995 Bacteria 1077
106 Ga0307416_100000005 3300032002 Bacteria 477728
107 Ga0307414_10039467 3300032004 Bacteria 3180
108 Ga0307414_10618550 3300032004 Bacteria 973
109 Ga0307414_10793491 3300032004 Bacteria 863
110 Ga0307414_11353051 3300032004 Bacteria 661
111 Ga0307414_11729768 3300032004 Bacteria 583
112 Ga0307411_11630130 3300032005 Bacteria 596
113 Ga0373944_0107772 3300035089 Bacteria 948
114 Ga0373945_0198060 3300035116 Bacteria 833
115 Ga0373943_0013571 3300035170 Bacteria 3681
116 Ga0373935_1141440 3300035692 Bacteria 580
117 Ga0373947_0096099 3300035725 Bacteria 1854
118 Ga0373937_1379357 3300036401 Bacteria 653
119 Ga0373925_0130615 3300037068 Bacteria 1958
120 Ga0395899_0006582 3300037312 Bacteria 9001
121 Ga0395900_0037259 3300037418 Bacteria 5015
122 Ga0395900_1100771 3300037418 Bacteria 712
123 Ga0395898_0184060 3300037466 Bacteria 1996
124 Ga0395898_1340956 3300037466 Bacteria 644
125 Ga0395905_0003628 3300037471 Bacteria 16398
126 Ga0395901_0004726 3300038443 Bacteria 13750
127 Ga0451793_0521153 3300041452 Unclassified 671
128 Ga0451837_0996379 3300041494 Unclassified 654
129 Ga0451855_1048314 3300041511 Unclassified 1378
130 Ga0451577_0000072 3300042876 Bacteria 237934
131 Ga0451577_0866231 3300042876 Bacteria 814
132 Ga0453683_0000604 3300044673 Bacteria 39525
133 Ga0453683_0193839 3300044673 Bacteria 1289
134 Ga0453683_0261630 3300044673 Bacteria 1103
135 Ga0453683_0295063 3300044673 Bacteria 1036
136 Ga0453684_0000186 3300044712 Bacteria 273302
137 Ga0453684_0070847 3300044712 Bacteria 4412
138 Ga0453684_0082642 3300044712 Bacteria 4000
139 Ga0453684_1431819 3300044712 Bacteria 715
140 Ga0451576_0000065 3300045051 Bacteria 274445
141 Ga0451576_0013524 3300045051 Bacteria 9129
142 Ga0451576_0546220 3300045051 Bacteria 1217
143 Ga0451576_0815308 3300045051 Bacteria 980
144 Ga0466967_0267068 3300045976 Bacteria 1638
145 Ga0495627_027473 3300046453 Bacteria 1825
146 Ga0495641_0105263 3300046461 Bacteria 1259
147 Ga0495651_0938996 3300046462 Unclassified 527
148 Ga0495580_0406896 3300046472 Bacteria 917
149 Ga0495639_0505653 3300046475 Bacteria 617
150 Ga0495639_0668442 3300046475 Unclassified 536
151 Ga0495607_0120546 3300046501 Bacteria 1378
152 Ga0495606_0060162 3300046507 Bacteria 2434
153 Ga0495610_0000878 3300046512 Bacteria 27958
154 Ga0495616_0027231 3300046513 Bacteria 3035
155 Ga0495630_1139400 3300046517 Bacteria 591
156 Ga0495631_0286619 3300046518 Bacteria 701
157 Ga0495637_0006850 3300046520 Bacteria 5695
158 Ga0495643_0000308 3300046522 Bacteria 67404
159 Ga0495663_0190718 3300046525 Bacteria 712
160 Ga0495665_0603063 3300046531 Unclassified 549
161 Ga0495625_0549695 3300046660 Bacteria 699
162 Ga0495625_0814375 3300046660 Bacteria 542
163 Ga0495658_0103057 3300046683 Bacteria 1706
164 Ga0495676_0173113 3300047321 Bacteria 1518
165 Ga0495676_0451457 3300047321 Unclassified 848
166 Ga0495681_0148284 3300047470 Bacteria 986
167 Ga0495614_0188976 3300048089 Bacteria 929
168 Ga0496100_0037431 3300048903 Bacteria 3067
169 Ga0496100_0313101 3300048903 Unclassified 1177
170 Ga0496101_0051489 3300048904 Bacteria 2967
171 Ga0496101_0451165 3300048904 Bacteria 1014
172 Ga0496102_0694636 3300048905 Bacteria 940
173 Ga0496103_0345740 3300048906 Bacteria 956
174 Ga0496103_0745520 3300048906 Unclassified 619
175 Ga0496106_0422522 3300048909 Bacteria 1071
176 Ga0496106_0543592 3300048909 Bacteria 932
177 Ga0496107_0028393 3300048910 Bacteria 3975
178 Ga0496107_0033527 3300048910 Bacteria 3674
179 Ga0496114_0011984 3300048917 Bacteria 6935
180 Ga0496114_1030779 3300048917 Unclassified 706
181 Ga0496115_1297532 3300048918 Bacteria 542
182 Ga0501031_0435892 3300049568 Bacteria 847
183 Ga0501047_0165447 3300049581 Bacteria 2082
184 Ga0501069_0063937 3300049585 Bacteria 2056
185 Ga0501070_0053855 3300049586 Bacteria 3336
186 Ga0501070_0629479 3300049586 Bacteria 853
187 Ga0501074_0019904 3300049590 Bacteria 4875
188 Ga0501076_1238990 3300049592 Unclassified 614
189 Ga0501249_010496 3300049679 Bacteria 1939
190 Ga0501079_0359755 3300049741 Bacteria 1141
191 Ga0501081_0840076 3300049743 Bacteria 692
192 Ga0501083_1134884 3300049744 Bacteria 509
193 Ga0501280_008636 3300049776 Bacteria 1419
194 Ga0501044_0831369 3300049823 Bacteria 801
195 nmdc:mga05p37_1246765_c1 3300050507 Bacteria 763
196 nmdc:mga08y16_50271_c1 3300050511 Bacteria 4363
197 nmdc:mga0n895_801993_c1 3300050512 Bacteria 932
198 nmdc:mga0rr50_71772_c1 3300050513 Bacteria 2643
199 nmdc:mga0a205_1084525_c1 3300050515 Bacteria 648
200 Ga0500646_0329409 3300053090 Unclassified 553
201 Ga0500641_0190114 3300053096 Bacteria 879
202 Ga0500642_0001071 3300053130 Bacteria 7891
203 Ga0500616_0093372 3300053153 Bacteria 1485
204 Ga0500634_0111369 3300053161 Bacteria 1350
205 Ga0501084_1444849 3300054114 Unclassified 576
206 2738764210 2738541284 Bacteria 5199923
207 2739586636 2739367651 Bacteria 6359826
208 2842727177 2842722452 Bacteria 6263924
209 2842910820 2842909656 Bacteria 6185908
210 2849284032 2849281842 Bacteria 6065644
211 2919188819 2919186247 Bacteria 6244071
212 2939667026 2939664404 Bacteria 6364494
213 2945998089 2945997725 Bacteria 6404843
214 Ga0436364_0631372
215 JGI24735J21928_10193312
216 JGI24033J26618_1049663
217 JGI25152J39213_1000028
218 JGI25150J39212_1000006
219 JGI25151J46595_10000024
220 JGI25153J46596_10000026
221 rootH2_10046647
222 JGI25160J50197_1006884
223 Ga0065714_10305542
224 Ga0065704_10585971
225 Ga0070658_10050737
226 Ga0070658_10097721
227 Ga0070677_10758431
228 Ga0070660_100039211
229 Ga0070691_10705143
230 Ga0070671_100165399
231 Ga0070659_100000134
232 Ga0070711_100548357
233 Ga0070686_100223387
234 Ga0068854_100569286
235 Ga0081455_10340666
236 Ga0070717_10631166
237 Ga0070712_100467449
238 Ga0097621_100716841
239 Ga0068871_101523692
240 Ga0075433_10123123
241 Ga0075434_101672138
242 Ga0068865_101079666
243 Ga0068865_101827730
244 Ga0075435_100216124
245 Ga0105240_10000573
246 Ga0111539_10194673
247 Ga0105245_10442281
248 Ga0114129_12306898
249 Ga0105243_10385543
250 Ga0105243_10838033
251 Ga0105243_13093707
252 Ga0105241_10166836
253 Ga0105242_10109470
254 Ga0105242_11101249
255 Ga0105237_10000143
256 Ga0105238_10067723
257 Ga0105239_10004079
258 Ga0157373_10069765
259 Ga0157370_10008834
260 Ga0157370_10168677
261 Ga0157369_10000158
262 Ga0157374_10180824
263 Ga0157374_10879398
264 Ga0163162_10954926
265 Ga0157372_11544635
266 Ga0182008_10025172
267 Ga0182006_1000729
268 Ga0182007_10000008
269 Ga0182007_10021416
270 Ga0213872_10055808
271 Ga0209436_100249
272 Ga0207425_1000003
273 Ga0209129_1000022
274 Ga0209130_1001185
275 Ga0209025_1000007
276 Ga0209758_1000012
277 Ga0207426_1000415
278 Ga0207685_10304815
279 Ga0207705_10039365
280 Ga0207705_10741095
281 Ga0207654_10003364
282 Ga0207695_10000183
283 Ga0207671_10000968
284 Ga0207693_10431473
285 Ga0207663_11493825
286 Ga0207657_10148359
287 Ga0207694_10403659
288 Ga0207644_10064113
289 Ga0207690_10000632
290 Ga0207709_10105294
291 Ga0207709_11604700
292 Ga0207704_10426433
293 Ga0207704_10482071
294 Ga0207640_10491059
295 Ga0207428_10394263
296 Ga0265334_10093510
297 Ga0265318_10104105
298 Ga0265323_10060996
299 Ga0265322_10003057
300 Ga0265336_10142232
301 Ga0307515_10067220
302 Ga0265338_10007452
303 Ga0307512_10188143
304 Ga0265330_10038972
305 Ga0265332_10364475
306 Ga0265325_10011650
307 Ga0265329_10010815
308 Ga0265340_10158967
309 Ga0265339_10028529
310 Ga0265327_10007278
311 Ga0265316_10031810
312 Ga0265313_10071792
313 Ga0265314_10010645
314 Ga0307405_10000014
315 Ga0307407_10000002
316 Ga0307407_10776298
317 Ga0307409_100487992
318 Ga0307409_100612696
319 Ga0307416_100000005
320 Ga0307414_10039467
321 Ga0307414_10618550
322 Ga0307414_10793491
323 Ga0307414_11353051
324 Ga0307414_11729768
325 Ga0307411_11630130
326 Ga0373944_0107772
327 Ga0373945_0198060
328 Ga0373943_0013571
329 Ga0373935_1141440
330 Ga0373947_0096099
331 Ga0373937_1379357
332 Ga0373925_0130615
333 Ga0395899_0006582
334 Ga0395900_0037259
335 Ga0395900_1100771
336 Ga0395898_0184060
337 Ga0395898_1340956
338 Ga0395905_0003628
339 Ga0395901_0004726
340 Ga0451793_0521153
341 Ga0451837_0996379
342 Ga0451855_1048314
343 Ga0451577_0000072
344 Ga0451577_0866231
345 Ga0453683_0000604
346 Ga0453683_0193839
347 Ga0453683_0261630
348 Ga0453683_0295063
349 Ga0453684_0000186
350 Ga0453684_0070847
351 Ga0453684_0082642
352 Ga0453684_1431819
353 Ga0451576_0000065
354 Ga0451576_0013524
355 Ga0451576_0546220
356 Ga0451576_0815308
357 Ga0466967_0267068
358 Ga0495627_027473
359 Ga0495641_0105263
360 Ga0495651_0938996
361 Ga0495580_0406896
362 Ga0495639_0505653
363 Ga0495639_0668442
364 Ga0495607_0120546
365 Ga0495606_0060162
366 Ga0495610_0000878
367 Ga0495616_0027231
368 Ga0495630_1139400
369 Ga0495631_0286619
370 Ga0495637_0006850
371 Ga0495643_0000308
372 Ga0495663_0190718
373 Ga0495665_0603063
374 Ga0495625_0549695
375 Ga0495625_0814375
376 Ga0495658_0103057
377 Ga0495676_0173113
378 Ga0495676_0451457
379 Ga0495681_0148284
380 Ga0495614_0188976
381 Ga0496100_0037431
382 Ga0496100_0313101
383 Ga0496101_0051489
384 Ga0496101_0451165
385 Ga0496102_0694636
386 Ga0496103_0345740
387 Ga0496103_0745520
388 Ga0496106_0422522
389 Ga0496106_0543592
390 Ga0496107_0028393
391 Ga0496107_0033527
392 Ga0496114_0011984
393 Ga0496114_1030779
394 Ga0496115_1297532
395 Ga0501031_0435892
396 Ga0501047_0165447
397 Ga0501069_0063937
398 Ga0501070_0053855
399 Ga0501070_0629479
400 Ga0501074_0019904
401 Ga0501076_1238990
402 Ga0501249_010496
403 Ga0501079_0359755
404 Ga0501081_0840076
405 Ga0501083_1134884
406 Ga0501280_008636
407 Ga0501044_0831369
408 nmdc:mga05p37_1246765_c1
409 nmdc:mga08y16_50271_c1
410 nmdc:mga0n895_801993_c1
411 nmdc:mga0rr50_71772_c1
412 nmdc:mga0a205_1084525_c1
413 Ga0500646_0329409
414 Ga0500641_0190114
415 Ga0500642_0001071
416 Ga0500616_0093372
417 Ga0500634_0111369
418 Ga0501084_1444849
419 2738764210
420 2739586636
421 2842727177
422 2842910820
423 2849284032
424 2919188819
425 2939667026
426 2945998089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

13

67

0.95

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

12

73

0.93

PF13560

HTH_31

Helix-turn-helix domain

8

70

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9726 3 63
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9716 3 63
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9626 5 57
1utx-assembly1.cif.gz_B regulation of cytolysin expression by enterococcus faecalis: role of cylr2 0.9594 3 63
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9548 1 63
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9716 1 64 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9668 5 57 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9656 5 57 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9471 5 57 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9466 5 56 1.10.260.40
ID Description Score Start End GO Terms
AF-H1YYI5-F1-model_v4 Transcriptional regulator, XRE family 1.003 1 63 GO:0003677
AF-A0A1G5W2S8-F1-model_v4 Putative transcriptional regulator 1 2 64 GO:0003677
AF-A0A845DML7-F1-model_v4 Helix-turn-helix domain-containing protein 1 1 62 GO:0003677
AF-A0A2D7MB73-F1-model_v4 Transcriptional regulator 0.9996 2 63 GO:0003677
AF-A0A806GAJ9-F1-model_v4 deleted 0.9993 1 62

Map