F324401

General Info

Members Datasets Scaffolds Average Seq Length
213 131 213 251

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0279835|Ga0495628_0279835_103_936
Length 277
Sequence MVRCPGIAKRGELEKAPLFSGLPSIIYLRPFNMNSALIIVPTYNERENIRLLTQRLLNLPVSVDLLVVDGNSTDGTSQLADELASKDPTIHVLHEKEKKGLGRAYIAGFKWALERGYEFIFEMDGDLSHNPDDVPAFLKAAENADLVLGTRYSNGSVRVVNWPLKRLILSRGAGYYVRIITGMPFSDPTGGYKCFRRRALQAIALDKIQSNGYSFQIEMTHRLWRQGLKVAEVPIVFTDREHGQSKMSKAIVREALWMVWRLWLQNGMRRWPRVRAK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
82 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
89 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.53
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10124927 3300003323 Bacteria 4523
2 Ga0065707_10125126 3300005295 Bacteria 2030
3 Ga0065707_10247199 3300005295 Bacteria 1131
4 Ga0070670_100306738 3300005331 Unclassified 1389
5 Ga0070680_100386300 3300005336 Bacteria 1192
6 Ga0068868_100109068 3300005338 Bacteria 2248
7 Ga0070689_100005026 3300005340 Bacteria 8990
8 Ga0070689_100021287 3300005340 Bacteria 4825
9 Ga0070689_100071574 3300005340 Bacteria 2709
10 Ga0070689_100268681 3300005340 Unclassified 1411
11 Ga0070688_100011494 3300005365 Bacteria 4918
12 Ga0070688_100311301 3300005365 Bacteria 1141
13 Ga0070714_100005217 3300005435 Bacteria 9889
14 Ga0070713_100265879 3300005436 Bacteria 1569
15 Ga0070711_100008141 3300005439 Bacteria 6410
16 Ga0070700_100111612 3300005441 Unclassified 1819
17 Ga0070694_100426836 3300005444 Bacteria 1042
18 Ga0070708_100058291 3300005445 Bacteria 3440
19 Ga0070685_10116006 3300005466 Bacteria 1657
20 Ga0070706_100384958 3300005467 Bacteria 1306
21 Ga0068853_100408937 3300005539 Unclassified 1271
22 Ga0070686_100009924 3300005544 Bacteria 5355
23 Ga0070686_100322780 3300005544 Bacteria 1152
24 Ga0068855_100047676 3300005563 Bacteria 5061
25 Ga0068855_100092607 3300005563 Bacteria 3485
26 Ga0068855_100252299 3300005563 Unclassified 1967
27 Ga0068857_100047335 3300005577 Unclassified 3818
28 Ga0068857_100144079 3300005577 Bacteria 2155
29 Ga0068856_100001157 3300005614 Bacteria 27739
30 Ga0068859_100244987 3300005617 Bacteria 1882
31 Ga0068859_100588404 3300005617 Bacteria 1206
32 Ga0068859_100667147 3300005617 Bacteria 1131
33 Ga0068864_100367056 3300005618 Unclassified 1361
34 Ga0068863_100128811 3300005841 Bacteria 2415
35 Ga0068863_100459522 3300005841 Bacteria 1250
36 Ga0068858_100413147 3300005842 Bacteria 1297
37 Ga0075428_100034960 3300006844 Bacteria 5540
38 Ga0075431_100063096 3300006847 Bacteria 3823
39 Ga0075431_100189445 3300006847 Unclassified 2108
40 Ga0075429_100126154 3300006880 Bacteria 2238
41 Ga0075436_100501544 3300006914 Bacteria 888
42 Ga0097620_100244986 3300006931 Bacteria 1882
43 Ga0097620_100588506 3300006931 Bacteria 1206
44 Ga0097620_100667133 3300006931 Bacteria 1131
45 Ga0105240_10041167 3300009093 Bacteria 5900
46 Ga0105240_10395684 3300009093 Bacteria 1557
47 Ga0111539_10004377 3300009094 Bacteria 18480
48 Ga0111539_10032852 3300009094 Bacteria 6301
49 Ga0111539_10647376 3300009094 Bacteria 1231
50 Ga0114129_10498174 3300009147 Bacteria 1591
51 Ga0105242_10111825 3300009176 Bacteria 2330
52 Ga0105242_10147887 3300009176 Unclassified 2045
53 Ga0105248_10088592 3300009177 Bacteria 3483
54 Ga0105248_10949507 3300009177 Unclassified 971
55 Ga0105238_10015736 3300009551 Bacteria 7659
56 Ga0105249_10187418 3300009553 Bacteria 2017
57 Ga0157374_10130837 3300013296 Bacteria 2429
58 Ga0157375_10000421 3300013308 Bacteria 38383
59 Ga0163163_10000067 3300014325 Bacteria 114831
60 Ga0163163_10020232 3300014325 Bacteria 6264
61 Ga0157379_10340086 3300014968 Unclassified 1372
62 Ga0207654_10267284 3300025911 Unclassified 1152
63 Ga0207695_10039795 3300025913 Bacteria 5049
64 Ga0207695_10622197 3300025913 Unclassified 961
65 Ga0207663_10028887 3300025916 Bacteria 3251
66 Ga0207694_10015567 3300025924 Bacteria 5735
67 Ga0207694_10025236 3300025924 Bacteria 4517
68 Ga0207694_10068752 3300025924 Unclassified 2766
69 Ga0207694_10077346 3300025924 Bacteria 2607
70 Ga0207700_10493636 3300025928 Unclassified 1083
71 Ga0207664_10002691 3300025929 Bacteria 11789
72 Ga0207686_10091929 3300025934 Bacteria 2005
73 Ga0207670_10002543 3300025936 Bacteria 9575
74 Ga0207670_10270668 3300025936 Bacteria 1320
75 Ga0207667_10023109 3300025949 Bacteria 6849
76 Ga0207667_10090372 3300025949 Bacteria 3164
77 Ga0207667_10101593 3300025949 Bacteria 2966
78 Ga0207677_10084706 3300026023 Bacteria 2286
79 Ga0207639_10083445 3300026041 Bacteria 2536
80 Ga0207708_10675101 3300026075 Unclassified 881
81 Ga0207702_10001093 3300026078 Bacteria 27743
82 Ga0207702_10134096 3300026078 Bacteria 2232
83 Ga0207702_10260978 3300026078 Bacteria 1631
84 Ga0207641_10369604 3300026088 Bacteria 1371
85 Ga0207674_10055429 3300026116 Unclassified 4030
86 Ga0207428_10114028 3300027907 Unclassified 2077
87 Ga0265337_1000269 3300028556 Bacteria 28329
88 Ga0265337_1003214 3300028556 Bacteria 7157
89 Ga0265337_1022020 3300028556 Unclassified 1979
90 Ga0265337_1028612 3300028556 Bacteria 1671
91 Ga0265326_10049027 3300028558 Unclassified 1197
92 Ga0265319_1036451 3300028563 Bacteria 1682
93 Ga0265334_10050809 3300028573 Unclassified 1591
94 Ga0265318_10039671 3300028577 Unclassified 1796
95 Ga0265322_10034401 3300028654 Bacteria 1444
96 Ga0265338_10000008 3300028800 Bacteria 481542
97 Ga0265338_10000305 3300028800 Bacteria 88659
98 Ga0265338_10016994 3300028800 Bacteria 7871
99 Ga0265338_10017923 3300028800 Bacteria 7605
100 Ga0265338_10022306 3300028800 Bacteria 6560
101 Ga0265338_10030818 3300028800 Bacteria 5271
102 Ga0265338_10041153 3300028800 Bacteria 4326
103 Ga0265338_10057472 3300028800 Bacteria 3441
104 Ga0265338_10057706 3300028800 Bacteria 3432
105 Ga0265338_10060127 3300028800 Unclassified 3341
106 Ga0265338_10074951 3300028800 Bacteria 2874
107 Ga0265338_10078094 3300028800 Bacteria 2794
108 Ga0265338_10215662 3300028800 Bacteria 1437
109 Ga0265338_10412508 3300028800 Bacteria 961
110 Ga0265324_10000727 3300029957 Bacteria 21946
111 Ga0265324_10009177 3300029957 Bacteria 3876
112 Ga0265324_10011710 3300029957 Unclassified 3335
113 Ga0265324_10027934 3300029957 Bacteria 1991
114 Ga0265324_10054910 3300029957 Bacteria 1366
115 Ga0265320_10008373 3300031240 Bacteria 6332
116 Ga0265329_10001611 3300031242 Bacteria 10830
117 Ga0265340_10030152 3300031247 Bacteria 2720
118 Ga0265340_10041403 3300031247 Unclassified 2265
119 Ga0265339_10035754 3300031249 Bacteria 2784
120 Ga0265339_10172056 3300031249 Unclassified 1083
121 Ga0265331_10047483 3300031250 Bacteria 2066
122 Ga0265331_10135048 3300031250 Bacteria 1124
123 Ga0265327_10003925 3300031251 Bacteria 13635
124 Ga0265316_10064815 3300031344 Bacteria 2830
125 Ga0265316_10163568 3300031344 Unclassified 1663
126 Ga0265316_10242077 3300031344 Bacteria 1326
127 Ga0265314_10000020 3300031711 Bacteria 307052
128 Ga0265314_10024304 3300031711 Bacteria 4596
129 Ga0265342_10216876 3300031712 Unclassified 1032
130 Ga0316576_10192811 3300031727 Bacteria 1536
131 Ga0316578_10071824 3300031728 Bacteria 2050
132 Ga0307405_10268677 3300031731 Unclassified 1278
133 Ga0307409_100062800 3300031995 Bacteria 2910
134 Ga0307414_10302454 3300032004 Unclassified 1354
135 Ga0307411_10224517 3300032005 Unclassified 1460
136 Ga0373930_0029106 3300034816 Unclassified 1127
137 Ga0373938_0039256 3300034957 Bacteria 1046
138 Ga0373928_0000017 3300035084 Bacteria 29049
139 Ga0373929_0000620 3300035085 Bacteria 6836
140 Ga0373949_0001183 3300035090 Bacteria 7740
141 Ga0373932_0000003 3300035112 Bacteria 459351
142 Ga0373941_0148162 3300035115 Bacteria 859
143 Ga0373946_0039210 3300035171 Bacteria 1933
144 Ga0373942_0109698 3300035207 Unclassified 852
145 Ga0373962_0000829 3300035242 Bacteria 7055
146 Ga0373931_0000054 3300035691 Bacteria 58930
147 Ga0373935_0101083 3300035692 Bacteria 1901
148 Ga0373935_0197929 3300035692 Bacteria 1387
149 Ga0373927_0031774 3300035695 Bacteria 3439
150 Ga0373927_0037642 3300035695 Bacteria 3143
151 Ga0373927_0209422 3300035695 Bacteria 1280
152 Ga0373947_0055622 3300035725 Bacteria 2390
153 Ga0373947_0108533 3300035725 Bacteria 1751
154 Ga0373937_0063912 3300036401 Bacteria 3385
155 Ga0373937_0287508 3300036401 Bacteria 1553
156 Ga0373925_0003667 3300037068 Bacteria 11820
157 Ga0373925_0046204 3300037068 Bacteria 3237
158 Ga0451577_0016174 3300042876 Bacteria 6915
159 Ga0451577_0021455 3300042876 Bacteria 5912
160 Ga0451577_0092993 3300042876 Bacteria 2693
161 Ga0451577_0349372 3300042876 Bacteria 1342
162 Ga0453684_0005584 3300044712 Bacteria 24781
163 Ga0453684_0010752 3300044712 Bacteria 15551
164 Ga0453684_0015647 3300044712 Bacteria 11963
165 Ga0453684_0034368 3300044712 Bacteria 7038
166 Ga0453684_0090576 3300044712 Unclassified 3779
167 Ga0451576_0047335 3300045051 Viruses 4522
168 Ga0451576_0118102 3300045051 Bacteria 2761
169 Ga0451576_0163896 3300045051 Bacteria 2320
170 Ga0451576_0257850 3300045051 Unclassified 1822
171 Ga0451576_0492046 3300045051 Bacteria 1288
172 Ga0495651_0120762 3300046462 Bacteria 1926
173 Ga0495653_0110440 3300046463 Bacteria 1976
174 Ga0495582_0018509 3300046473 Bacteria 3809
175 Ga0495618_0011197 3300046514 Bacteria 5436
176 Ga0495628_0279835 3300046516 Unclassified 1239
177 Ga0495630_0000045 3300046517 Bacteria 102985
178 Ga0495630_0012283 3300046517 Bacteria 6214
179 Ga0495640_0078747 3300046533 Bacteria 2195
180 Ga0495586_0000005 3300046535 Bacteria 171839
181 Ga0495586_0032625 3300046535 Bacteria 2792
182 Ga0495587_0110760 3300046536 Unclassified 1577
183 Ga0495634_0178824 3300046642 Bacteria 1329
184 Ga0495657_0039028 3300046675 Bacteria 3265
185 Ga0495657_0276145 3300046675 Unclassified 1007
186 Ga0495599_0149171 3300046678 Bacteria 1449
187 Ga0495658_0029215 3300046683 Bacteria 2982
188 Ga0495613_0046351 3300046689 Bacteria 3215
189 Ga0495624_0106544 3300046690 Bacteria 1725
190 Ga0495581_0258680 3300047315 Bacteria 1018
191 Ga0495674_0001441 3300047319 Bacteria 23322
192 Ga0495674_0099910 3300047319 Unclassified 2470
193 Ga0495676_0005209 3300047321 Bacteria 11895
194 Ga0495676_0182845 3300047321 Bacteria 1468
195 Ga0495675_0010305 3300047444 Bacteria 5841
196 Ga0495675_0054595 3300047444 Bacteria 2535
197 Ga0495684_0100582 3300047471 Bacteria 2186
198 Ga0495684_0192139 3300047471 Unclassified 1509
199 Ga0495602_0138977 3300048088 Unclassified 1926
200 Ga0501032_0109653 3300049569 Bacteria 1827
201 Ga0501033_0100653 3300049570 Bacteria 2109
202 Ga0501034_0298224 3300049571 Bacteria 1549
203 Ga0501037_0118119 3300049573 Bacteria 1908
204 Ga0501043_0152077 3300049579 Bacteria 1811
205 Ga0501035_0383688 3300049822 Bacteria 1171
206 Ga0501044_0010636 3300049823 Bacteria 9982
207 nmdc:mga09592_136214_c1 3300050508 Bacteria 2115
208 nmdc:mga06r32_24955_c1 3300050510 Bacteria 5554
209 nmdc:mga08y16_104423_c1 3300050511 Bacteria 2949
210 nmdc:mga08y16_154994_c1 3300050511 Unclassified 2380
211 nmdc:mga08y16_7652_c1 3300050511 Bacteria 11307
212 nmdc:mga0rr50_88105_c1 3300050513 Bacteria 2410
213 nmdc:mga08x19_235509_c1 3300050514 Bacteria 1261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0110760 Ga0495587_0110760_329_1006 223
2 3300005338 Ga0068868_100109068 Ga0068868_1001090682 234
3 3300005340 Ga0070689_100071574 Ga0070689_1000715742 234
4 3300005841 Ga0068863_100459522 Ga0068863_1004595222 234
5 3300026023 Ga0207677_10084706 Ga0207677_100847062 234
6 3300026088 Ga0207641_10369604 Ga0207641_103696042 234
7 3300005445 Ga0070708_100058291 Ga0070708_1000582912 236
8 3300045051 Ga0451576_0257850 Ga0451576_0257850_971_1747 240
9 3300046675 Ga0495657_0039028 Ga0495657_0039028_1206_1961 240
10 3300005435 Ga0070714_100005217 Ga0070714_1000052174 241
11 3300009176 Ga0105242_10147887 Ga0105242_101478872 241
12 3300025929 Ga0207664_10002691 Ga0207664_100026917 241
13 3300031249 Ga0265339_10035754 Ga0265339_100357542 241
14 3300034957 Ga0373938_0039256 Ga0373938_0039256_262_987 241
15 3300035115 Ga0373941_0148162 Ga0373941_0148162_81_806 241
16 3300005340 Ga0070689_100268681 Ga0070689_1002686812 242
17 3300006847 Ga0075431_100189445 Ga0075431_1001894452 242
18 3300028800 Ga0265338_10041153 Ga0265338_100411533 242
19 3300028800 Ga0265338_10057706 Ga0265338_100577061 242
20 3300028800 Ga0265338_10215662 Ga0265338_102156621 242
21 3300028800 Ga0265338_10412508 Ga0265338_104125081 242
22 3300031240 Ga0265320_10008373 Ga0265320_100083733 242
23 3300031344 Ga0265316_10064815 Ga0265316_100648152 242
24 3300031712 Ga0265342_10216876 Ga0265342_102168761 242
25 3300036401 Ga0373937_0287508 Ga0373937_0287508_438_1196 242
26 3300042876 Ga0451577_0021455 Ga0451577_0021455_1773_2537 242
27 3300042876 Ga0451577_0349372 Ga0451577_0349372_213_977 242
28 3300046462 Ga0495651_0120762 Ga0495651_0120762_65_823 242
29 3300046463 Ga0495653_0110440 Ga0495653_0110440_248_1006 242
30 3300046516 Ga0495628_0279835 Ga0495628_0279835_103_936 242
31 3300046642 Ga0495634_0178824 Ga0495634_0178824_97_855 242
32 3300047319 Ga0495674_0099910 Ga0495674_0099910_1641_2378 242
33 3300047444 Ga0495675_0054595 Ga0495675_0054595_207_1040 242
34 3300047471 Ga0495684_0100582 Ga0495684_0100582_1406_2164 242
35 3300047471 Ga0495684_0192139 Ga0495684_0192139_200_1033 242
36 3300050510 nmdc:mga06r32_24955_c1 nmdc:mga06r32_24955_c1_4024_4758 242
37 3300003323 rootH1_10124927 rootH1_101249273 243
38 3300005295 Ga0065707_10125126 Ga0065707_101251262 243
39 3300005295 Ga0065707_10247199 Ga0065707_102471992 243
40 3300005331 Ga0070670_100306738 Ga0070670_1003067382 243
41 3300005336 Ga0070680_100386300 Ga0070680_1003863001 243
42 3300005340 Ga0070689_100005026 Ga0070689_1000050262 243
43 3300005340 Ga0070689_100021287 Ga0070689_1000212873 243
44 3300005365 Ga0070688_100011494 Ga0070688_1000114942 243
45 3300005365 Ga0070688_100311301 Ga0070688_1003113012 243
46 3300005436 Ga0070713_100265879 Ga0070713_1002658791 243
47 3300005439 Ga0070711_100008141 Ga0070711_1000081415 243
48 3300005441 Ga0070700_100111612 Ga0070700_1001116123 243
49 3300005444 Ga0070694_100426836 Ga0070694_1004268361 243
50 3300005466 Ga0070685_10116006 Ga0070685_101160062 243
51 3300005467 Ga0070706_100384958 Ga0070706_1003849582 243
52 3300005539 Ga0068853_100408937 Ga0068853_1004089372 243
53 3300005544 Ga0070686_100009924 Ga0070686_1000099244 243
54 3300005544 Ga0070686_100322780 Ga0070686_1003227802 243
55 3300005563 Ga0068855_100047676 Ga0068855_1000476763 243
56 3300005563 Ga0068855_100092607 Ga0068855_1000926073 243
57 3300005563 Ga0068855_100252299 Ga0068855_1002522992 243
58 3300005577 Ga0068857_100047335 Ga0068857_1000473353 243
59 3300005577 Ga0068857_100144079 Ga0068857_1001440792 243
60 3300005614 Ga0068856_100001157 Ga0068856_10000115720 243
61 3300005617 Ga0068859_100244987 Ga0068859_1002449873 243
62 3300005617 Ga0068859_100588404 Ga0068859_1005884041 243
63 3300005617 Ga0068859_100667147 Ga0068859_1006671472 243
64 3300005618 Ga0068864_100367056 Ga0068864_1003670562 243
65 3300005841 Ga0068863_100128811 Ga0068863_1001288112 243
66 3300005842 Ga0068858_100413147 Ga0068858_1004131471 243
67 3300006844 Ga0075428_100034960 Ga0075428_1000349605 243
68 3300006847 Ga0075431_100063096 Ga0075431_1000630963 243
69 3300006880 Ga0075429_100126154 Ga0075429_1001261542 243
70 3300006914 Ga0075436_100501544 Ga0075436_1005015441 243
71 3300006931 Ga0097620_100244986 Ga0097620_1002449863 243
72 3300006931 Ga0097620_100588506 Ga0097620_1005885061 243
73 3300006931 Ga0097620_100667133 Ga0097620_1006671332 243
74 3300009093 Ga0105240_10041167 Ga0105240_100411677 243
75 3300009093 Ga0105240_10395684 Ga0105240_103956841 243
76 3300009094 Ga0111539_10004377 Ga0111539_1000437714 243
77 3300009094 Ga0111539_10032852 Ga0111539_100328523 243
78 3300009094 Ga0111539_10647376 Ga0111539_106473762 243
79 3300009147 Ga0114129_10498174 Ga0114129_104981741 243
80 3300009176 Ga0105242_10111825 Ga0105242_101118253 243
81 3300009177 Ga0105248_10088592 Ga0105248_100885924 243
82 3300009177 Ga0105248_10949507 Ga0105248_109495072 243
83 3300009551 Ga0105238_10015736 Ga0105238_100157365 243
84 3300009553 Ga0105249_10187418 Ga0105249_101874182 243
85 3300013296 Ga0157374_10130837 Ga0157374_101308371 243
86 3300013308 Ga0157375_10000421 Ga0157375_100004218 243
87 3300014325 Ga0163163_10000067 Ga0163163_1000006777 243
88 3300014325 Ga0163163_10020232 Ga0163163_100202324 243
89 3300014968 Ga0157379_10340086 Ga0157379_103400862 243
90 3300025911 Ga0207654_10267284 Ga0207654_102672842 243
91 3300025913 Ga0207695_10039795 Ga0207695_100397952 243
92 3300025913 Ga0207695_10622197 Ga0207695_106221971 243
93 3300025916 Ga0207663_10028887 Ga0207663_100288872 243
94 3300025924 Ga0207694_10015567 Ga0207694_100155674 243
95 3300025924 Ga0207694_10025236 Ga0207694_100252365 243
96 3300025924 Ga0207694_10068752 Ga0207694_100687522 243
97 3300025924 Ga0207694_10077346 Ga0207694_100773461 243
98 3300025928 Ga0207700_10493636 Ga0207700_104936362 243
99 3300025934 Ga0207686_10091929 Ga0207686_100919291 243
100 3300025936 Ga0207670_10002543 Ga0207670_100025435 243
101 3300025936 Ga0207670_10270668 Ga0207670_102706681 243
102 3300025949 Ga0207667_10023109 Ga0207667_100231096 243
103 3300025949 Ga0207667_10090372 Ga0207667_100903723 243
104 3300025949 Ga0207667_10101593 Ga0207667_101015932 243
105 3300026041 Ga0207639_10083445 Ga0207639_100834452 243
106 3300026075 Ga0207708_10675101 Ga0207708_106751011 243
107 3300026078 Ga0207702_10001093 Ga0207702_1000109320 243
108 3300026078 Ga0207702_10134096 Ga0207702_101340961 243
109 3300026078 Ga0207702_10260978 Ga0207702_102609782 243
110 3300026116 Ga0207674_10055429 Ga0207674_100554293 243
111 3300027907 Ga0207428_10114028 Ga0207428_101140281 243
112 3300028556 Ga0265337_1000269 Ga0265337_10002692 243
113 3300028556 Ga0265337_1003214 Ga0265337_10032147 243
114 3300028556 Ga0265337_1022020 Ga0265337_10220202 243
115 3300028556 Ga0265337_1028612 Ga0265337_10286123 243
116 3300028558 Ga0265326_10049027 Ga0265326_100490272 243
117 3300028563 Ga0265319_1036451 Ga0265319_10364512 243
118 3300028573 Ga0265334_10050809 Ga0265334_100508091 243
119 3300028577 Ga0265318_10039671 Ga0265318_100396712 243
120 3300028654 Ga0265322_10034401 Ga0265322_100344012 243
121 3300028800 Ga0265338_10000008 Ga0265338_1000000871 243
122 3300028800 Ga0265338_10000305 Ga0265338_1000030546 243
123 3300028800 Ga0265338_10016994 Ga0265338_100169943 243
124 3300028800 Ga0265338_10017923 Ga0265338_100179237 243
125 3300028800 Ga0265338_10022306 Ga0265338_100223064 243
126 3300028800 Ga0265338_10030818 Ga0265338_100308184 243
127 3300028800 Ga0265338_10057472 Ga0265338_100574724 243
128 3300028800 Ga0265338_10060127 Ga0265338_100601272 243
129 3300028800 Ga0265338_10074951 Ga0265338_100749512 243
130 3300028800 Ga0265338_10078094 Ga0265338_100780944 243
131 3300029957 Ga0265324_10000727 Ga0265324_1000072712 243
132 3300029957 Ga0265324_10009177 Ga0265324_100091774 243
133 3300029957 Ga0265324_10011710 Ga0265324_100117102 243
134 3300029957 Ga0265324_10027934 Ga0265324_100279342 243
135 3300029957 Ga0265324_10054910 Ga0265324_100549102 243
136 3300031242 Ga0265329_10001611 Ga0265329_100016113 243
137 3300031247 Ga0265340_10030152 Ga0265340_100301524 243
138 3300031247 Ga0265340_10041403 Ga0265340_100414031 243
139 3300031249 Ga0265339_10172056 Ga0265339_101720562 243
140 3300031250 Ga0265331_10047483 Ga0265331_100474833 243
141 3300031250 Ga0265331_10135048 Ga0265331_101350481 243
142 3300031251 Ga0265327_10003925 Ga0265327_100039257 243
143 3300031344 Ga0265316_10163568 Ga0265316_101635682 243
144 3300031344 Ga0265316_10242077 Ga0265316_102420771 243
145 3300031711 Ga0265314_10000020 Ga0265314_1000002014 243
146 3300031711 Ga0265314_10024304 Ga0265314_100243042 243
147 3300031727 Ga0316576_10192811 Ga0316576_101928111 243
148 3300031728 Ga0316578_10071824 Ga0316578_100718242 243
149 3300031731 Ga0307405_10268677 Ga0307405_102686772 243
150 3300031995 Ga0307409_100062800 Ga0307409_1000628002 243
151 3300032004 Ga0307414_10302454 Ga0307414_103024542 243
152 3300032005 Ga0307411_10224517 Ga0307411_102245172 243
153 3300034816 Ga0373930_0029106 Ga0373930_0029106_260_991 243
154 3300035084 Ga0373928_0000017 Ga0373928_0000017_17646_18377 243
155 3300035085 Ga0373929_0000620 Ga0373929_0000620_2593_3324 243
156 3300035090 Ga0373949_0001183 Ga0373949_0001183_1890_2621 243
157 3300035112 Ga0373932_0000003 Ga0373932_0000003_245466_246197 243
158 3300035171 Ga0373946_0039210 Ga0373946_0039210_1142_1873 243
159 3300035207 Ga0373942_0109698 Ga0373942_0109698_94_825 243
160 3300035242 Ga0373962_0000829 Ga0373962_0000829_1246_1977 243
161 3300035691 Ga0373931_0000054 Ga0373931_0000054_23759_24490 243
162 3300035692 Ga0373935_0101083 Ga0373935_0101083_265_996 243
163 3300035692 Ga0373935_0197929 Ga0373935_0197929_439_1308 243
164 3300035695 Ga0373927_0031774 Ga0373927_0031774_108_839 243
165 3300035695 Ga0373927_0037642 Ga0373927_0037642_310_1065 243
166 3300035695 Ga0373927_0209422 Ga0373927_0209422_198_1067 243
167 3300035725 Ga0373947_0055622 Ga0373947_0055622_1332_2063 243
168 3300035725 Ga0373947_0108533 Ga0373947_0108533_198_1067 243
169 3300036401 Ga0373937_0063912 Ga0373937_0063912_1113_1916 243
170 3300037068 Ga0373925_0003667 Ga0373925_0003667_7126_7857 243
171 3300037068 Ga0373925_0046204 Ga0373925_0046204_1979_2734 243
172 3300042876 Ga0451577_0016174 Ga0451577_0016174_574_1371 243
173 3300042876 Ga0451577_0092993 Ga0451577_0092993_1208_1966 243
174 3300044712 Ga0453684_0005584 Ga0453684_0005584_12698_13495 243
175 3300044712 Ga0453684_0010752 Ga0453684_0010752_929_1696 243
176 3300044712 Ga0453684_0015647 Ga0453684_0015647_5656_6399 243
177 3300044712 Ga0453684_0034368 Ga0453684_0034368_5128_5901 243
178 3300044712 Ga0453684_0090576 Ga0453684_0090576_261_1037 243
179 3300045051 Ga0451576_0047335 Ga0451576_0047335_503_1321 243
180 3300045051 Ga0451576_0118102 Ga0451576_0118102_497_1273 243
181 3300045051 Ga0451576_0163896 Ga0451576_0163896_721_1464 243
182 3300045051 Ga0451576_0492046 Ga0451576_0492046_26_814 243
183 3300046473 Ga0495582_0018509 Ga0495582_0018509_1915_2736 243
184 3300046514 Ga0495618_0011197 Ga0495618_0011197_3158_3988 243
185 3300046517 Ga0495630_0000045 Ga0495630_0000045_2877_3698 243
186 3300046517 Ga0495630_0012283 Ga0495630_0012283_1119_1988 243
187 3300046533 Ga0495640_0078747 Ga0495640_0078747_260_1081 243
188 3300046535 Ga0495586_0000005 Ga0495586_0000005_75068_75889 243
189 3300046535 Ga0495586_0032625 Ga0495586_0032625_879_1640 243
190 3300046675 Ga0495657_0276145 Ga0495657_0276145_103_840 243
191 3300046678 Ga0495599_0149171 Ga0495599_0149171_88_831 243
192 3300046683 Ga0495658_0029215 Ga0495658_0029215_524_1345 243
193 3300046689 Ga0495613_0046351 Ga0495613_0046351_718_1539 243
194 3300046690 Ga0495624_0106544 Ga0495624_0106544_250_1011 243
195 3300047315 Ga0495581_0258680 Ga0495581_0258680_73_942 243
196 3300047319 Ga0495674_0001441 Ga0495674_0001441_3079_3900 243
197 3300047321 Ga0495676_0005209 Ga0495676_0005209_9671_10492 243
198 3300047321 Ga0495676_0182845 Ga0495676_0182845_422_1183 243
199 3300047444 Ga0495675_0010305 Ga0495675_0010305_3607_4344 243
200 3300048088 Ga0495602_0138977 Ga0495602_0138977_355_1092 243
201 3300049569 Ga0501032_0109653 Ga0501032_0109653_1035_1796 243
202 3300049570 Ga0501033_0100653 Ga0501033_0100653_128_868 243
203 3300049571 Ga0501034_0298224 Ga0501034_0298224_722_1477 243
204 3300049573 Ga0501037_0118119 Ga0501037_0118119_95_913 243
205 3300049579 Ga0501043_0152077 Ga0501043_0152077_791_1552 243
206 3300049822 Ga0501035_0383688 Ga0501035_0383688_137_898 243
207 3300049823 Ga0501044_0010636 Ga0501044_0010636_260_1021 243
208 3300050508 nmdc:mga09592_136214_c1 nmdc:mga09592_136214_c1_898_1638 243
209 3300050511 nmdc:mga08y16_104423_c1 nmdc:mga08y16_104423_c1_871_1620 243
210 3300050511 nmdc:mga08y16_154994_c1 nmdc:mga08y16_154994_c1_99_914 243
211 3300050511 nmdc:mga08y16_7652_c1 nmdc:mga08y16_7652_c1_5543_6289 243
212 3300050513 nmdc:mga0rr50_88105_c1 nmdc:mga0rr50_88105_c1_417_1160 243
213 3300050514 nmdc:mga08x19_235509_c1 nmdc:mga08x19_235509_c1_165_908 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

37

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8806 4 235
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8798 4 234
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8386 4 203
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8221 4 234
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8086 4 235
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9519 1 235 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9176 1 235 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8717 4 226 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8603 4 223 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8537 4 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4G0G2-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9857 2 207 GO:0004582
GO:0009247
GO:0016020
AF-A0A348TT88-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9832 58 202 GO:0004582
GO:0009247
GO:0016020
AF-A0A660ZDY2-F1-model_v4 Polyprenol monophosphomannose synthase 0.983 1 235 GO:0004582
GO:0009247
GO:0016020
AF-A0A1H4RIJ4-F1-model_v4 Dolichol-phosphate mannosyltransferase 0.9782 1 232 GO:0004582
GO:0009247
GO:0016020
AF-A0A511T1F8-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9757 1 231 GO:0004582
GO:0005543
GO:0008915
GO:0009245
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.03 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map