F324463

General Info

Members Datasets Scaffolds Average Seq Length
213 136 426 360

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0133136|Ga0496114_0133136_463_1596
Length 377
Sequence MTPTSPPPAATTRPIAERHLFGPGPCNPYPEATVALASPLLGHLDPDFLAIMDETCDLLRHVWGTGNRRTLPLSATGSAGMEAAFVNMVEPGDVVVVAVNGLFGERMVDVAGRHGAEVVRVDHEWGRPVDVDRVAAAHPSPKIIAAVHAETSTGVRSDIAALGAAKGGALLLVDAVTSIGGIELRADDWGIDIGYAGTQKCLGVAPGLAPFTISDDAFARRVEKPSSWYLDLGLLGGYVGEASGAGKRTYHHTAPTAMVASLHAGLRRIADEGLEKVWDRHAEAGRLLQDGLEDMGLALFAEEGSRLPELTTVRVPDGVDSAAVRGYLLERHNVEIGAGAGAFASSVWRIGLMGHNARPDRAALVLATLKDALDHAA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
13 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
18 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
21 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
30 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
45 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
46 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
47 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
61 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
109 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
110 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
111 2643221561 Nocardioides sp. Root151 Isolate Unclassified
112 2643221696 Nocardioides sp. Root140 Isolate Unclassified
113 2643221711 Terrabacter sp. Root85 Isolate Unclassified
114 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
115 2739367653 Kocuria sp. OV113 Isolate Unclassified
116 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
117 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
118 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
119 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
120 2857727296 Kocuria sp. R-72562 Isolate Unclassified
121 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
122 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
123 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
124 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
125 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
126 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
127 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
128 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
129 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
130 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
131 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
132 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
133 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
134 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
135 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
136 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.45
Metatranscriptomes 1.41
Isolates 13.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 10.33
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0133136 3300048917 Bacteria 2148
2 JGI25152J39213_1002937 3300002773 Bacteria 6073
3 Ga0070658_10420753 3300005327 Bacteria 1149
4 Ga0070714_100105172 3300005435 Bacteria 2492
5 Ga0070700_100101684 3300005441 Bacteria 1895
6 Ga0070679_100108001 3300005530 Bacteria 2768
7 Ga0070696_100251187 3300005546 Bacteria 1337
8 Ga0068861_100082571 3300005719 Bacteria 2519
9 Ga0081455_10002964 3300005937 Bacteria 19846
10 Ga0081455_10087001 3300005937 Bacteria 2544
11 Ga0105243_10052231 3300009148 Bacteria 3237
12 Ga0105243_10063741 3300009148 Bacteria 2954
13 Ga0105246_10005070 3300011119 Bacteria 8010
14 Ga0105246_10032964 3300011119 Bacteria 3439
15 Ga0157370_10027264 3300013104 Bacteria 5633
16 Ga0163162_10175253 3300013306 Bacteria 2270
17 Ga0157372_10083347 3300013307 Bacteria 3622
18 Ga0157372_10336416 3300013307 Bacteria 1758
19 Ga0157372_10461805 3300013307 Bacteria 1480
20 Ga0157375_10106366 3300013308 Bacteria 2897
21 Ga0163163_10285584 3300014325 Bacteria 1702
22 Ga0157380_10090089 3300014326 Bacteria 2529
23 Ga0206354_10659008 3300020081 Bacteria 2670
24 Ga0206353_10740375 3300020082 Bacteria 2665
25 Ga0206353_11475471 3300020082 Bacteria 3793
26 Ga0209129_1000100 3300025258 Bacteria 162353
27 Ga0209025_1000340 3300025294 Bacteria 102910
28 Ga0209051_1016125 3300025303 Bacteria 3404
29 Ga0207697_10002793 3300025315 Bacteria 8897
30 Ga0207655_1025533 3300025728 Bacteria 2864
31 Ga0207705_10085371 3300025909 Bacteria 2306
32 Ga0207652_10076830 3300025921 Bacteria 2913
33 Ga0207675_100034096 3300026118 Bacteria 4744
34 Ga0207683_10147497 3300026121 Bacteria 2122
35 Ga0307511_10000826 3300030521 Bacteria 33021
36 Ga0307408_100200182 3300031548 Bacteria 1616
37 Ga0307408_100279695 3300031548 Bacteria 1389
38 Ga0307405_10034322 3300031731 Bacteria 3018
39 Ga0307405_10041703 3300031731 Bacteria 2789
40 Ga0307413_10000098 3300031824 Bacteria 22283
41 Ga0307410_10012478 3300031852 Bacteria 4918
42 Ga0307410_10071938 3300031852 Bacteria 2400
43 Ga0307410_10128561 3300031852 Bacteria 1858
44 Ga0307406_10028758 3300031901 Bacteria 3360
45 Ga0307406_10030867 3300031901 Bacteria 3258
46 Ga0307406_10090568 3300031901 Bacteria 2058
47 Ga0307412_10098759 3300031911 Bacteria 2060
48 Ga0307412_10155533 3300031911 Bacteria 1692
49 Ga0307412_10378223 3300031911 Bacteria 1146
50 Ga0307409_100008889 3300031995 Bacteria 6132
51 Ga0307409_100044200 3300031995 Bacteria 3353
52 Ga0307409_100109972 3300031995 Bacteria 2309
53 Ga0307416_100033906 3300032002 Bacteria 3878
54 Ga0307416_100151320 3300032002 Bacteria 2128
55 Ga0307416_100340217 3300032002 Bacteria 1513
56 Ga0307415_100090770 3300032126 Bacteria 2211
57 Ga0307415_100126649 3300032126 Bacteria 1926
58 Ga0307415_100170051 3300032126 Bacteria 1698
59 Ga0307415_100253776 3300032126 Bacteria 1431
60 Ga0307415_100295929 3300032126 Bacteria 1338
61 Ga0395900_0009746 3300037418 Bacteria 9839
62 Ga0395900_0117260 3300037418 Bacteria 2732
63 Ga0395900_0120165 3300037418 Bacteria 2696
64 Ga0395900_0318287 3300037418 Bacteria 1537
65 Ga0395898_0003330 3300037466 Bacteria 18045
66 Ga0395898_0049704 3300037466 Bacteria 4108
67 Ga0395898_0180951 3300037466 Bacteria 2015
68 Ga0395898_0389893 3300037466 Bacteria 1328
69 Ga0395898_0435484 3300037466 Bacteria 1249
70 Ga0395905_0051486 3300037471 Bacteria 3857
71 Ga0436364_0237930 3300037853 Bacteria 6384
72 Ga0395901_0008782 3300038443 Bacteria 10222
73 Ga0395901_0222440 3300038443 Bacteria 1973
74 Ga0451793_1031933 3300041452 Bacteria 4659
75 Ga0451833_1165934 3300041491 Bacteria 5726
76 Ga0451839_0247161 3300041496 Bacteria 2159
77 Ga0466969_0001225 3300044656 Bacteria 13874
78 Ga0466969_0044881 3300044656 Bacteria 2196
79 Ga0466969_0081233 3300044656 Bacteria 1547
80 Ga0466972_0036610 3300044658 Bacteria 2400
81 Ga0466972_0070578 3300044658 Bacteria 1667
82 Ga0466965_0052246 3300044683 Bacteria 2029
83 Ga0466966_0004538 3300044684 Bacteria 9149
84 Ga0466961_0005421 3300044693 Bacteria 8038
85 Ga0466961_0084763 3300044693 Bacteria 2004
86 Ga0466964_0062511 3300044706 Bacteria 1553
87 Ga0466971_0050846 3300044719 Bacteria 1865
88 Ga0466970_0004098 3300044765 Bacteria 7167
89 Ga0466970_0004494 3300044765 Bacteria 6876
90 Ga0466970_0014160 3300044765 Bacteria 4090
91 Ga0466970_0020167 3300044765 Bacteria 3461
92 Ga0466970_0021035 3300044765 Bacteria 3396
93 Ga0466970_0029614 3300044765 Bacteria 2884
94 Ga0466970_0171937 3300044765 Bacteria 1201
95 Ga0466970_0193456 3300044765 Bacteria 1131
96 Ga0466957_0016336 3300044842 Bacteria 4341
97 Ga0466957_0026888 3300044842 Bacteria 3416
98 Ga0466957_0047678 3300044842 Bacteria 2603
99 Ga0466959_0036182 3300045049 Bacteria 3648
100 Ga0466959_0126644 3300045049 Bacteria 1812
101 Ga0466958_0039006 3300045836 Bacteria 2852
102 Ga0466958_0241620 3300045836 Bacteria 1154
103 Ga0466967_0009607 3300045976 Bacteria 7189
104 Ga0466967_0165359 3300045976 Bacteria 2079
105 Ga0495653_0064711 3300046463 Bacteria 2754
106 Ga0495581_0055868 3300047315 Bacteria 2278
107 Ga0496100_0018542 3300048903 Bacteria 4130
108 Ga0496101_0006016 3300048904 Bacteria 7782
109 Ga0496102_0003370 3300048905 Bacteria 13549
110 Ga0496103_0001868 3300048906 Bacteria 13682
111 Ga0496104_0002147 3300048907 Bacteria 17120
112 Ga0496105_0005192 3300048908 Bacteria 9865
113 Ga0496105_0057951 3300048908 Bacteria 3197
114 Ga0496106_0075142 3300048909 Bacteria 2588
115 Ga0496106_0115503 3300048909 Bacteria 2093
116 Ga0496107_0025886 3300048910 Bacteria 4157
117 Ga0496108_0085696 3300048911 Bacteria 2674
118 Ga0496109_0018239 3300048912 Bacteria 6164
119 Ga0496109_0161403 3300048912 Bacteria 2100
120 Ga0496110_0041158 3300048913 Bacteria 4031
121 Ga0496113_0052488 3300048916 Bacteria 3045
122 Ga0496114_0004700 3300048917 Bacteria 10621
123 Ga0496114_0005510 3300048917 Bacteria 9912
124 Ga0496114_0010563 3300048917 Bacteria 7347
125 Ga0496114_0090777 3300048917 Bacteria 2593
126 Ga0496114_0138278 3300048917 Bacteria 2107
127 Ga0501031_0000115 3300049568 Bacteria 43139
128 Ga0501032_0000052 3300049569 Bacteria 101001
129 Ga0501032_0032375 3300049569 Bacteria 3583
130 Ga0501032_0179754 3300049569 Bacteria 1385
131 Ga0501033_0001762 3300049570 Bacteria 18926
132 Ga0501034_0000066 3300049571 Bacteria 184727
133 Ga0501034_0003912 3300049571 Bacteria 16734
134 Ga0501034_0159024 3300049571 Bacteria 2232
135 Ga0501036_0004954 3300049572 Bacteria 10765
136 Ga0501037_0000046 3300049573 Bacteria 116524
137 Ga0501037_0006745 3300049573 Bacteria 8399
138 Ga0501038_0000068 3300049574 Bacteria 84886
139 Ga0501038_0053510 3300049574 Bacteria 3475
140 Ga0501038_0117475 3300049574 Bacteria 2197
141 Ga0501039_0000362 3300049575 Bacteria 32461
142 Ga0501039_0070234 3300049575 Bacteria 2721
143 Ga0501039_0111863 3300049575 Bacteria 2135
144 Ga0501040_0060618 3300049576 Bacteria 2600
145 Ga0501040_0214959 3300049576 Bacteria 1367
146 Ga0501041_0102343 3300049577 Bacteria 1774
147 Ga0501041_0305639 3300049577 Bacteria 1002
148 Ga0501042_0018124 3300049578 Bacteria 4871
149 Ga0501043_0000783 3300049579 Bacteria 28276
150 Ga0501043_0321602 3300049579 Bacteria 1179
151 Ga0501046_0000102 3300049580 Bacteria 89938
152 Ga0501047_0005305 3300049581 Bacteria 12108
153 Ga0501048_0000006 3300049582 Bacteria 93252
154 Ga0501048_0191129 3300049582 Bacteria 1451
155 Ga0501068_0013989 3300049584 Bacteria 4579
156 Ga0501069_0000146 3300049585 Bacteria 31605
157 Ga0501070_0002259 3300049586 Bacteria 16929
158 Ga0501071_0018230 3300049587 Bacteria 4856
159 Ga0501071_0056007 3300049587 Bacteria 2847
160 Ga0501072_0043765 3300049588 Bacteria 3520
161 Ga0501073_0001270 3300049589 Bacteria 18521
162 Ga0501074_0000916 3300049590 Bacteria 18891
163 Ga0501074_0061094 3300049590 Bacteria 2715
164 Ga0501074_0128859 3300049590 Bacteria 1811
165 Ga0501075_0050871 3300049591 Bacteria 3115
166 Ga0501076_0070678 3300049592 Bacteria 2791
167 Ga0501076_0073439 3300049592 Bacteria 2739
168 Ga0501076_0218596 3300049592 Bacteria 1557
169 Ga0501077_0064068 3300049593 Bacteria 2332
170 Ga0501079_0038408 3300049741 Bacteria 3692
171 Ga0501080_0000051 3300049742 Bacteria 75804
172 Ga0501080_0231248 3300049742 Bacteria 1690
173 Ga0501081_0080941 3300049743 Bacteria 2274
174 Ga0501083_0035629 3300049744 Bacteria 3398
175 Ga0501035_0008657 3300049822 Bacteria 9472
176 Ga0501044_0000137 3300049823 Bacteria 89352
177 Ga0501044_0153912 3300049823 Bacteria 2280
178 Ga0501045_0053127 3300049824 Bacteria 2960
179 Ga0501045_0154844 3300049824 Bacteria 1705
180 Ga0501084_0000567 3300054114 Bacteria 28265
181 Ga0501084_0322084 3300054114 Bacteria 1306
182 Ga0501082_0149795 3300060353 Bacteria 2026
183 Ga0466962_0008166 3300061719 Bacteria 5019
184 Ga0466962_0060954 3300061719 Bacteria 1801
185 Ga0530510_0022618 3300061734 Bacteria 4479
186 2555230683 2554235227 Bacteria 3637389
187 2623500223 2622736605 Bacteria 4992138
188 2643826613 2643221561 Bacteria 4984412
189 2644532968 2643221696 Bacteria 5431823
190 2644607563 2643221711 Bacteria 4865335
191 2655031935 2654587600 Bacteria 3911798
192 2739604054 2739367653 Bacteria 2780952
193 2795796212 2795385472 Bacteria 6627535
194 2817509919 2816332305 Bacteria 2697803
195 2819426304 2818991318 Bacteria 5266538
196 2844850250 2844849076 Bacteria 4091819
197 2857729733 2857727296 Bacteria 2745552
198 2857742979 2857740372 Bacteria 4782044
199 2891327460 2891326441 Bacteria 6439512
200 2904500865 2904497146 Bacteria 4731781
201 2904779738 2904776348 Bacteria 4658726
202 2910813080 2910809715 Bacteria 4982797
203 2919037306 2919034639 Bacteria 4763403
204 2919051885 2919051321 Bacteria 4210889
205 2919061392 2919059106 Bacteria 4991624
206 2919542818 2919538618 Bacteria 4677069
207 2932429888 2932426870 Bacteria 4547726
208 2933419329 2933418574 Bacteria 4476724
209 2939650725 2939647034 Bacteria 4681660
210 2939675828 2939674588 Bacteria 4844420
211 8004025264 8004021418 Bacteria 4313954
212 8004026823 8004025490 Bacteria 4327753
213 8056065002 8056060235 Bacteria 7259403
214 Ga0496114_0133136
215 JGI25152J39213_1002937
216 Ga0070658_10420753
217 Ga0070714_100105172
218 Ga0070700_100101684
219 Ga0070679_100108001
220 Ga0070696_100251187
221 Ga0068861_100082571
222 Ga0081455_10002964
223 Ga0081455_10087001
224 Ga0105243_10052231
225 Ga0105243_10063741
226 Ga0105246_10005070
227 Ga0105246_10032964
228 Ga0157370_10027264
229 Ga0163162_10175253
230 Ga0157372_10083347
231 Ga0157372_10336416
232 Ga0157372_10461805
233 Ga0157375_10106366
234 Ga0163163_10285584
235 Ga0157380_10090089
236 Ga0206354_10659008
237 Ga0206353_10740375
238 Ga0206353_11475471
239 Ga0209129_1000100
240 Ga0209025_1000340
241 Ga0209051_1016125
242 Ga0207697_10002793
243 Ga0207655_1025533
244 Ga0207705_10085371
245 Ga0207652_10076830
246 Ga0207675_100034096
247 Ga0207683_10147497
248 Ga0307511_10000826
249 Ga0307408_100200182
250 Ga0307408_100279695
251 Ga0307405_10034322
252 Ga0307405_10041703
253 Ga0307413_10000098
254 Ga0307410_10012478
255 Ga0307410_10071938
256 Ga0307410_10128561
257 Ga0307406_10028758
258 Ga0307406_10030867
259 Ga0307406_10090568
260 Ga0307412_10098759
261 Ga0307412_10155533
262 Ga0307412_10378223
263 Ga0307409_100008889
264 Ga0307409_100044200
265 Ga0307409_100109972
266 Ga0307416_100033906
267 Ga0307416_100151320
268 Ga0307416_100340217
269 Ga0307415_100090770
270 Ga0307415_100126649
271 Ga0307415_100170051
272 Ga0307415_100253776
273 Ga0307415_100295929
274 Ga0395900_0009746
275 Ga0395900_0117260
276 Ga0395900_0120165
277 Ga0395900_0318287
278 Ga0395898_0003330
279 Ga0395898_0049704
280 Ga0395898_0180951
281 Ga0395898_0389893
282 Ga0395898_0435484
283 Ga0395905_0051486
284 Ga0436364_0237930
285 Ga0395901_0008782
286 Ga0395901_0222440
287 Ga0451793_1031933
288 Ga0451833_1165934
289 Ga0451839_0247161
290 Ga0466969_0001225
291 Ga0466969_0044881
292 Ga0466969_0081233
293 Ga0466972_0036610
294 Ga0466972_0070578
295 Ga0466965_0052246
296 Ga0466966_0004538
297 Ga0466961_0005421
298 Ga0466961_0084763
299 Ga0466964_0062511
300 Ga0466971_0050846
301 Ga0466970_0004098
302 Ga0466970_0004494
303 Ga0466970_0014160
304 Ga0466970_0020167
305 Ga0466970_0021035
306 Ga0466970_0029614
307 Ga0466970_0171937
308 Ga0466970_0193456
309 Ga0466957_0016336
310 Ga0466957_0026888
311 Ga0466957_0047678
312 Ga0466959_0036182
313 Ga0466959_0126644
314 Ga0466958_0039006
315 Ga0466958_0241620
316 Ga0466967_0009607
317 Ga0466967_0165359
318 Ga0495653_0064711
319 Ga0495581_0055868
320 Ga0496100_0018542
321 Ga0496101_0006016
322 Ga0496102_0003370
323 Ga0496103_0001868
324 Ga0496104_0002147
325 Ga0496105_0005192
326 Ga0496105_0057951
327 Ga0496106_0075142
328 Ga0496106_0115503
329 Ga0496107_0025886
330 Ga0496108_0085696
331 Ga0496109_0018239
332 Ga0496109_0161403
333 Ga0496110_0041158
334 Ga0496113_0052488
335 Ga0496114_0004700
336 Ga0496114_0005510
337 Ga0496114_0010563
338 Ga0496114_0090777
339 Ga0496114_0138278
340 Ga0501031_0000115
341 Ga0501032_0000052
342 Ga0501032_0032375
343 Ga0501032_0179754
344 Ga0501033_0001762
345 Ga0501034_0000066
346 Ga0501034_0003912
347 Ga0501034_0159024
348 Ga0501036_0004954
349 Ga0501037_0000046
350 Ga0501037_0006745
351 Ga0501038_0000068
352 Ga0501038_0053510
353 Ga0501038_0117475
354 Ga0501039_0000362
355 Ga0501039_0070234
356 Ga0501039_0111863
357 Ga0501040_0060618
358 Ga0501040_0214959
359 Ga0501041_0102343
360 Ga0501041_0305639
361 Ga0501042_0018124
362 Ga0501043_0000783
363 Ga0501043_0321602
364 Ga0501046_0000102
365 Ga0501047_0005305
366 Ga0501048_0000006
367 Ga0501048_0191129
368 Ga0501068_0013989
369 Ga0501069_0000146
370 Ga0501070_0002259
371 Ga0501071_0018230
372 Ga0501071_0056007
373 Ga0501072_0043765
374 Ga0501073_0001270
375 Ga0501074_0000916
376 Ga0501074_0061094
377 Ga0501074_0128859
378 Ga0501075_0050871
379 Ga0501076_0070678
380 Ga0501076_0073439
381 Ga0501076_0218596
382 Ga0501077_0064068
383 Ga0501079_0038408
384 Ga0501080_0000051
385 Ga0501080_0231248
386 Ga0501081_0080941
387 Ga0501083_0035629
388 Ga0501035_0008657
389 Ga0501044_0000137
390 Ga0501044_0153912
391 Ga0501045_0053127
392 Ga0501045_0154844
393 Ga0501084_0000567
394 Ga0501084_0322084
395 Ga0501082_0149795
396 Ga0466962_0008166
397 Ga0466962_0060954
398 Ga0530510_0022618
399 2555230683
400 2623500223
401 2643826613
402 2644532968
403 2644607563
404 2655031935
405 2739604054
406 2795796212
407 2817509919
408 2819426304
409 2844850250
410 2857729733
411 2857742979
412 2891327460
413 2904500865
414 2904779738
415 2910813080
416 2919037306
417 2919051885
418 2919061392
419 2919542818
420 2932429888
421 2933419329
422 2939650725
423 2939675828
424 8004025264
425 8004026823
426 8056065002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

29

362

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yob-assembly1.cif.gz_B high resolution agxt_m structure 0.9652 1 363
4cbs-assembly1.cif.gz_A-2 x-ray structure of quintuple mutant of human alanine glyoxylate aminotransferase, agxt_rheam 0.9638 1 362
1vjo-assembly1.cif.gz_A-2 crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. at 1.70 a resolution 0.9629 1 361
6rv0-assembly1.cif.gz_A human alanine:glyoxylate aminotransferase major allele (agt-ma); with pmp in the active site 0.9615 1 362
4cbr-assembly1.cif.gz_A-2 x-ray structure of the more stable human agxt triple mutant (agxt_hem) 0.9609 1 362
ID Description Score Start End Superfamily
af_Q58369_270_367_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9853 268 363 3.90.1150.10
3nnkA02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9852 267 363 3.90.1150.10
1vjoA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9758 261 361 3.90.1150.10
2hufA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9649 261 363 3.90.1150.10
af_P21549_286_389_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9624 268 362 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7W4ISY5-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9862 279 363 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A090R9J2-F1-model_v4 deleted 0.9856 260 363
AF-A0A521TG87-F1-model_v4 Alanine--glyoxylate aminotransferase family protein 0.9827 254 363 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A2V3I3E7-F1-model_v4 Aminotransferase 0.9793 268 363 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A7Y3LJV0-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9776 57 361 GO:0004760
GO:0005777
GO:0008453
GO:0019265

Map