F324535

General Info

Members Datasets Scaffolds Average Seq Length
213 157 201 222

Family's Representative Sequence

Representative Sequence 3300049688|Ga0501259_003727|Ga0501259_003727_1615_2370
Length 251
Sequence MRSSVISQMRGRAWGWRRDIRLPIAAAMPTIEASSPAERLAAVRSGIAHAAKLAGRDPASVALIAISKTKAAEEIAPLIAAGHRLFGENRVQEAETKWPALKAATPDVRVHLVGQLQSNKAEAAVALFDAIHSVDRLSLVEALGRAMAKTGRRPDCFLQVNIGEEEQKGGCAIGELPGLIDAARAADLPLAGLMCVPPLDDEPAPYFALLAKLARRHGLVGLSMGMSGDYETAVMLGATHVRVGTALFGER

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
6 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
7 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
8 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
12 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
120 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
121 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
125 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
126 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
127 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
128 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
129 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
132 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
135 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
136 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
137 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
140 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
141 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
142 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
143 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
144 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 1.41
Bulb 0
Endosphere 22.54
Nodule 0
Rhizoplane 5.16
Rhizosphere 55.4
Stem 0
Stem Tuber 0
Unclassified 15.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_672559 2162886007 Bacteria 10234
2 JGI24740J21852_10043376 3300001979 Bacteria 1341
3 JGI25150J39212_1000189 3300002774 Bacteria 34828
4 JGI25151J46595_10019372 3300003187 Bacteria 2892
5 JGI25153J46596_10000125 3300003215 Bacteria 86065
6 Ga0055536_1001297 3300003781 Bacteria 15384
7 Ga0055536_1002780 3300003781 Bacteria 9686
8 Ga0055536_1005046 3300003781 Bacteria 6557
9 Ga0055530_10000691 3300003791 Bacteria 28513
10 Ga0055530_10010246 3300003791 Bacteria 3491
11 Ga0055530_10014007 3300003791 Bacteria 2701
12 Ga0055530_10018772 3300003791 Bacteria 2118
13 Ga0055540_1001895 3300003792 Bacteria 11716
14 Ga0055531_10007708 3300003794 Bacteria 5815
15 Ga0055531_10010049 3300003794 Bacteria 4756
16 Ga0055531_10025632 3300003794 Bacteria 2134
17 Ga0055531_10025636 3300003794 Bacteria 2134
18 Ga0070668_100005738 3300005347 Bacteria 9204
19 Ga0070669_100000143 3300005353 Bacteria 64072
20 Ga0070671_100382890 3300005355 Bacteria 1202
21 Ga0070667_100000210 3300005367 Bacteria 68040
22 Ga0070681_10531939 3300005458 Bacteria 1089
23 Ga0070684_100652495 3300005535 Bacteria 980
24 Ga0068853_100149977 3300005539 Bacteria 2098
25 Ga0068853_100519434 3300005539 Bacteria 1126
26 Ga0070665_100044607 3300005548 Bacteria 4452
27 Ga0070665_100553885 3300005548 Bacteria 1162
28 Ga0068855_100052489 3300005563 Bacteria 4800
29 Ga0068854_100230388 3300005578 Bacteria 1470
30 Ga0068852_100066332 3300005616 Bacteria 3151
31 Ga0068863_100019279 3300005841 Bacteria 6524
32 Ga0068863_100053532 3300005841 Bacteria 3826
33 Ga0068863_100070319 3300005841 Bacteria 3310
34 Ga0068860_100025953 3300005843 Bacteria 5653
35 Ga0068860_100062744 3300005843 Bacteria 3531
36 Ga0068862_100017202 3300005844 Bacteria 6016
37 Ga0068862_100066587 3300005844 Bacteria 3104
38 Ga0075362_10029392 3300006177 Bacteria 2368
39 Ga0075369_10159631 3300006186 Bacteria 1033
40 Ga0075370_10059857 3300006353 Bacteria 2169
41 Ga0105250_10016914 3300009092 Bacteria 2967
42 Ga0105240_10236927 3300009093 Bacteria 2117
43 Ga0105248_10306649 3300009177 Bacteria 1788
44 Ga0105237_10134042 3300009545 Bacteria 2472
45 Ga0105238_10229842 3300009551 Bacteria 1832
46 Ga0157370_10956409 3300013104 Bacteria 776
47 Ga0157369_10345098 3300013105 Bacteria 1547
48 Ga0163161_10355019 3300017792 Bacteria 1166
49 Ga0213873_10000016 3300021358 Bacteria 124829
50 Ga0213876_10000056 3300021384 Bacteria 135017
51 Ga0207425_1000005 3300025245 Bacteria 900502
52 Ga0209129_1000345 3300025258 Bacteria 39677
53 Ga0209675_1000104 3300025291 Bacteria 121249
54 Ga0209676_1000435 3300025292 Bacteria 72233
55 Ga0209676_1000512 3300025292 Bacteria 61167
56 Ga0209676_1002411 3300025292 Bacteria 13359
57 Ga0209025_1001007 3300025294 Bacteria 41722
58 Ga0209758_1000002 3300025297 Bacteria 1400310
59 Ga0209758_1076873 3300025297 Bacteria 1025
60 Ga0209050_1000001 3300025298 Bacteria 3563507
61 Ga0209050_1000254 3300025298 Bacteria 114395
62 Ga0209050_1000286 3300025298 Bacteria 106566
63 Ga0209050_1003173 3300025298 Bacteria 12496
64 Ga0209050_1023371 3300025298 Bacteria 2178
65 Ga0209051_1000472 3300025303 Bacteria 52350
66 Ga0209257_1000321 3300025304 Bacteria 100476
67 Ga0209257_1007348 3300025304 Bacteria 6680
68 Ga0209257_1008326 3300025304 Bacteria 5936
69 Ga0207696_1010736 3300025711 Bacteria 3340
70 Ga0207713_1022652 3300025735 Bacteria 2975
71 Ga0207705_10025218 3300025909 Bacteria 4245
72 Ga0207671_10000924 3300025914 Bacteria 36861
73 Ga0207649_10000016 3300025920 Bacteria 243843
74 Ga0207681_10000252 3300025923 Bacteria 40749
75 Ga0207687_10324377 3300025927 Bacteria 1247
76 Ga0207644_10014697 3300025931 Bacteria 5246
77 Ga0207644_10660429 3300025931 Bacteria 870
78 Ga0207711_10008027 3300025941 Bacteria 8834
79 Ga0207667_10060424 3300025949 Bacteria 3967
80 Ga0207667_10140874 3300025949 Bacteria 2483
81 Ga0207668_10015379 3300025972 Bacteria 4754
82 Ga0207640_10051263 3300025981 Bacteria 2682
83 Ga0207640_10461368 3300025981 Bacteria 1049
84 Ga0207658_10000333 3300025986 Bacteria 47363
85 Ga0207641_10015101 3300026088 Bacteria 6328
86 Ga0207641_10048212 3300026088 Bacteria 3595
87 Ga0268266_10004966 3300028379 Bacteria 12588
88 Ga0268266_10494512 3300028379 Bacteria 1167
89 Ga0268265_10067984 3300028380 Bacteria 2760
90 Ga0268264_10031068 3300028381 Bacteria 4379
91 Ga0268264_10066167 3300028381 Bacteria 3047
92 Ga0307405_10376504 3300031731 Bacteria 1104
93 Ga0307413_10208529 3300031824 Bacteria 1417
94 Ga0307413_10264624 3300031824 Bacteria 1284
95 Ga0307406_10057152 3300031901 Bacteria 2502
96 Ga0307412_10011691 3300031911 Bacteria 5092
97 Ga0307412_10045906 3300031911 Bacteria 2859
98 Ga0307409_100062792 3300031995 Bacteria 2910
99 Ga0307414_10000172 3300032004 Bacteria 43715
100 Ga0307414_10042897 3300032004 Bacteria 3077
101 Ga0307414_10133041 3300032004 Bacteria 1934
102 Ga0307414_10133723 3300032004 Bacteria 1930
103 Ga0307414_10453271 3300032004 Bacteria 1125
104 Ga0307411_10138011 3300032005 Bacteria 1794
105 Ga0307415_100891275 3300032126 Bacteria 819
106 Ga0395905_0046291 3300037471 Bacteria 4079
107 Ga0395901_0043371 3300038443 Bacteria 4667
108 Ga0436365_0320457 3300039437 Bacteria 1963
109 Ga0436365_0869628 3300039437 Bacteria 66366
110 Ga0436363_0700871 3300039450 Bacteria 918
111 Ga0436362_0580304 3300039453 Bacteria 124869
112 Ga0451795_0577763 3300041456 Bacteria 865
113 Ga0466968_0243389 3300044735 Bacteria 852
114 Ga0451576_0000017 3300045051 Bacteria 558261
115 Ga0495638_0002459 3300046460 Bacteria 15100
116 Ga0495583_0056307 3300046506 Bacteria 1774
117 Ga0495631_0122941 3300046518 Bacteria 1116
118 Ga0495632_0057616 3300046519 Bacteria 1896
119 Ga0495643_0068164 3300046522 Bacteria 1873
120 Ga0495625_0001622 3300046660 Bacteria 26509
121 Ga0495625_0174104 3300046660 Bacteria 1435
122 Ga0495686_0000100 3300047472 Bacteria 180492
123 Ga0495686_0022109 3300047472 Bacteria 4210
124 Ga0495615_0000377 3300048090 Bacteria 6969
125 Ga0496100_0266930 3300048903 Bacteria 1271
126 Ga0496100_0727017 3300048903 Bacteria 775
127 Ga0496102_0000170 3300048905 Bacteria 88149
128 Ga0496103_0000097 3300048906 Bacteria 97276
129 Ga0496104_0000047 3300048907 Bacteria 148896
130 Ga0496105_0006315 3300048908 Bacteria 9104
131 Ga0496107_0197216 3300048910 Bacteria 1496
132 Ga0496112_0009708 3300048915 Bacteria 8689
133 Ga0496113_0000714 3300048916 Bacteria 16985
134 Ga0496115_0333913 3300048918 Bacteria 1238
135 Ga0496116_0000045 3300048919 Bacteria 324307
136 Ga0496117_0010116 3300048920 Bacteria 8660
137 Ga0496117_0035498 3300048920 Bacteria 3741
138 Ga0496118_0008503 3300048921 Bacteria 10597
139 Ga0496118_0020152 3300048921 Bacteria 5926
140 Ga0496119_0000699 3300048922 Bacteria 44963
141 Ga0496120_0006829 3300048923 Bacteria 8642
142 Ga0496120_0104426 3300048923 Bacteria 1491
143 Ga0496121_0000190 3300048924 Bacteria 136607
144 Ga0496122_0001260 3300048925 Bacteria 42389
145 Ga0496122_0001787 3300048925 Bacteria 32925
146 Ga0496122_0068094 3300048925 Bacteria 2558
147 Ga0496122_0172827 3300048925 Bacteria 1299
148 Ga0496123_0000362 3300048926 Bacteria 85587
149 Ga0496123_0000785 3300048926 Bacteria 51254
150 Ga0496123_0000944 3300048926 Bacteria 45323
151 Ga0496124_0025712 3300048927 Bacteria 5324
152 Ga0496125_0000555 3300048928 Bacteria 64263
153 Ga0496125_0267042 3300048928 Bacteria 1069
154 Ga0496125_0346578 3300048928 Bacteria 889
155 Ga0496126_0001266 3300048929 Bacteria 40672
156 Ga0496126_0001290 3300048929 Bacteria 40086
157 Ga0496126_0043243 3300048929 Bacteria 4156
158 Ga0496126_0071271 3300048929 Bacteria 3094
159 Ga0496126_0186695 3300048929 Bacteria 1758
160 Ga0495682_0075342 3300049460 Bacteria 1214
161 Ga0501290_000855 3300049513 Bacteria 4452
162 Ga0501292_000013 3300049515 Bacteria 65866
163 Ga0501294_000619 3300049517 Bacteria 4034
164 Ga0501043_0206489 3300049579 Bacteria 1523
165 Ga0501047_0303232 3300049581 Bacteria 1439
166 Ga0501047_0410595 3300049581 Bacteria 1186
167 Ga0501206_000806 3300049653 Bacteria 3825
168 Ga0501207_021268 3300049654 Bacteria 1041
169 Ga0501222_000834 3300049662 Bacteria 4446
170 Ga0501223_000447 3300049663 Bacteria 9956
171 Ga0501224_000373 3300049664 Bacteria 5284
172 Ga0501227_004185 3300049665 Bacteria 3103
173 Ga0501233_010624 3300049668 Bacteria 1817
174 Ga0501235_003337 3300049669 Bacteria 3470
175 Ga0501236_044436 3300049670 Bacteria 745
176 Ga0501249_005187 3300049679 Bacteria 2661
177 Ga0501257_000010 3300049686 Bacteria 53242
178 Ga0501259_003727 3300049688 Bacteria 2422
179 Ga0501261_000272 3300049690 Bacteria 7118
180 Ga0501221_021196 3300049704 Bacteria 1277
181 Ga0501225_0002623 3300049705 Bacteria 5521
182 Ga0501245_002112 3300049708 Bacteria 2638
183 Ga0501241_007518 3300049758 Bacteria 1994
184 Ga0501279_000004 3300049775 Bacteria 175612
185 Ga0501280_000054 3300049776 Bacteria 33149
186 Ga0501281_00271 3300049777 Bacteria 5401
187 Ga0501282_001207 3300049778 Bacteria 2898
188 Ga0501035_0092956 3300049822 Bacteria 2654
189 Ga0501044_0151686 3300049823 Bacteria 2299
190 nmdc:mga03n38_289563_c1 3300050490 Bacteria 876
191 Ga0500643_000654 3300053087 Bacteria 23285
192 Ga0500643_003125 3300053087 Bacteria 8112
193 Ga0500643_011367 3300053087 Bacteria 3252
194 Ga0500641_0001329 3300053096 Bacteria 8784
195 Ga0500556_0007181 3300053104 Bacteria 3182
196 Ga0500595_002588 3300053119 Bacteria 8836
197 Ga0500642_0000001 3300053130 Bacteria 1468402
198 Ga0500658_0000189 3300053134 Bacteria 29335
199 Ga0500568_0000977 3300053139 Bacteria 19696
200 Ga0500636_0039550 3300053177 Bacteria 2790
201 Ga0500645_062362 3300053730 Bacteria 1076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_000654 Ga0500643_000654_13939_14556 205
2 3300031824 Ga0307413_10208529 Ga0307413_102085292 211
3 3300032004 Ga0307414_10042897 Ga0307414_100428973 211
4 3300049579 Ga0501043_0206489 Ga0501043_0206489_443_1102 212
5 iso_pu_bacteria 8054302542 8054305386 212
6 iso_pu_bacteria 2928027323 2928029334 215
7 iso_pu_bacteria 2984555340 2984556531 215
8 iso_pu_bacteria 2984564862 2984565298 215
9 iso_pu_bacteria 2993356040 2993356371 215
10 iso_pu_bacteria 3000865235 3000867288 215
11 3300005458 Ga0070681_10531939 Ga0070681_105319392 216
12 3300005535 Ga0070684_100652495 Ga0070684_1006524951 216
13 3300005539 Ga0068853_100149977 Ga0068853_1001499774 216
14 3300005539 Ga0068853_100519434 Ga0068853_1005194342 216
15 3300005548 Ga0070665_100553885 Ga0070665_1005538851 216
16 3300005616 Ga0068852_100066332 Ga0068852_1000663324 216
17 3300005841 Ga0068863_100019279 Ga0068863_1000192797 216
18 3300009093 Ga0105240_10236927 Ga0105240_102369273 216
19 3300013105 Ga0157369_10345098 Ga0157369_103450982 216
20 3300025927 Ga0207687_10324377 Ga0207687_103243772 216
21 3300025981 Ga0207640_10461368 Ga0207640_104613682 216
22 3300026088 Ga0207641_10048212 Ga0207641_100482122 216
23 3300028379 Ga0268266_10494512 Ga0268266_104945122 216
24 3300046506 Ga0495583_0056307 Ga0495583_0056307_504_1166 216
25 3300048090 Ga0495615_0000377 Ga0495615_0000377_2675_3337 216
26 3300048925 Ga0496122_0001787 Ga0496122_0001787_23949_24611 216
27 3300048926 Ga0496123_0000944 Ga0496123_0000944_9731_10393 216
28 3300048928 Ga0496125_0346578 Ga0496125_0346578_26_688 216
29 iso_pu_bacteria 2643221563 2643834968 216
30 iso_pu_bacteria 2643221608 2644055895 216
31 iso_pu_bacteria 2852653556 2852655833 216
32 iso_pu_bacteria 2946787523 2946790332 216
33 iso_pu_bacteria 2896253425 2896253754 217
34 3300031995 Ga0307409_100062792 Ga0307409_1000627923 218
35 3300050490 nmdc:mga03n38_289563_c1 nmdc:mga03n38_289563_c1_132_800 218
36 iso_pu_bacteria 2751185897 2753766565 218
37 3300003794 Ga0055531_10010049 Ga0055531_100100495 219
38 3300005844 Ga0068862_100017202 Ga0068862_1000172024 219
39 3300028380 Ga0268265_10067984 Ga0268265_100679843 219
40 3300031824 Ga0307413_10264624 Ga0307413_102646242 219
41 3300032004 Ga0307414_10000172 Ga0307414_1000017235 219
42 3300037471 Ga0395905_0046291 Ga0395905_0046291_1840_2499 219
43 3300038443 Ga0395901_0043371 Ga0395901_0043371_3444_4103 219
44 3300003781 Ga0055536_1001297 Ga0055536_100129712 220
45 3300003781 Ga0055536_1002780 Ga0055536_10027804 220
46 3300003791 Ga0055530_10000691 Ga0055530_100006913 220
47 3300003791 Ga0055530_10014007 Ga0055530_100140072 220
48 3300003794 Ga0055531_10007708 Ga0055531_100077083 220
49 3300005563 Ga0068855_100052489 Ga0068855_1000524892 220
50 3300025291 Ga0209675_1000104 Ga0209675_100010450 220
51 3300025292 Ga0209676_1000435 Ga0209676_100043552 220
52 3300025292 Ga0209676_1000512 Ga0209676_100051235 220
53 3300025297 Ga0209758_1076873 Ga0209758_10768732 220
54 3300025298 Ga0209050_1000254 Ga0209050_100025478 220
55 3300025298 Ga0209050_1000286 Ga0209050_100028667 220
56 3300025298 Ga0209050_1003173 Ga0209050_10031735 220
57 3300025304 Ga0209257_1000321 Ga0209257_100032125 220
58 3300025909 Ga0207705_10025218 Ga0207705_100252183 220
59 3300025949 Ga0207667_10060424 Ga0207667_100604243 220
60 3300025949 Ga0207667_10140874 Ga0207667_101408742 220
61 3300031731 Ga0307405_10376504 Ga0307405_103765042 220
62 3300031901 Ga0307406_10057152 Ga0307406_100571521 220
63 3300031911 Ga0307412_10011691 Ga0307412_100116915 220
64 3300031911 Ga0307412_10045906 Ga0307412_100459062 220
65 3300032004 Ga0307414_10133041 Ga0307414_101330413 220
66 3300032004 Ga0307414_10133723 Ga0307414_101337233 220
67 3300032004 Ga0307414_10453271 Ga0307414_104532711 220
68 3300032005 Ga0307411_10138011 Ga0307411_101380112 220
69 3300044735 Ga0466968_0243389 Ga0466968_0243389_105_770 220
70 3300045051 Ga0451576_0000017 Ga0451576_0000017_28328_28990 220
71 3300046518 Ga0495631_0122941 Ga0495631_0122941_62_724 220
72 3300046660 Ga0495625_0001622 Ga0495625_0001622_2194_2856 220
73 3300046660 Ga0495625_0174104 Ga0495625_0174104_270_932 220
74 3300048903 Ga0496100_0266930 Ga0496100_0266930_486_1148 220
75 3300048919 Ga0496116_0000045 Ga0496116_0000045_244695_245357 220
76 3300048920 Ga0496117_0035498 Ga0496117_0035498_2503_3165 220
77 3300048921 Ga0496118_0020152 Ga0496118_0020152_2733_3395 220
78 3300048925 Ga0496122_0068094 Ga0496122_0068094_1879_2541 220
79 3300048925 Ga0496122_0172827 Ga0496122_0172827_611_1282 220
80 3300048926 Ga0496123_0000785 Ga0496123_0000785_38554_39216 220
81 3300048927 Ga0496124_0025712 Ga0496124_0025712_2179_2850 220
82 3300048929 Ga0496126_0001266 Ga0496126_0001266_23368_24030 220
83 3300048929 Ga0496126_0071271 Ga0496126_0071271_982_1644 220
84 3300049581 Ga0501047_0303232 Ga0501047_0303232_354_1016 220
85 3300049822 Ga0501035_0092956 Ga0501035_0092956_591_1253 220
86 3300049823 Ga0501044_0151686 Ga0501044_0151686_1122_1784 220
87 3300053087 Ga0500643_011367 Ga0500643_011367_2176_2862 220
88 3300053139 Ga0500568_0000977 Ga0500568_0000977_4161_4823 220
89 3300053730 Ga0500645_062362 Ga0500645_062362_26_691 220
90 3300006177 Ga0075362_10029392 Ga0075362_100293922 221
91 3300053096 Ga0500641_0001329 Ga0500641_0001329_3281_3946 221
92 3300053104 Ga0500556_0007181 Ga0500556_0007181_1494_2159 221
93 3300053119 Ga0500595_002588 Ga0500595_002588_2194_2859 221
94 3300002774 JGI25150J39212_1000189 JGI25150J39212_10001894 222
95 3300003187 JGI25151J46595_10019372 JGI25151J46595_100193722 222
96 3300003215 JGI25153J46596_10000125 JGI25153J46596_1000012572 222
97 3300003781 Ga0055536_1005046 Ga0055536_10050466 222
98 3300003791 Ga0055530_10010246 Ga0055530_100102464 222
99 3300003791 Ga0055530_10018772 Ga0055530_100187721 222
100 3300003792 Ga0055540_1001895 Ga0055540_10018957 222
101 3300003794 Ga0055531_10025632 Ga0055531_100256321 222
102 3300003794 Ga0055531_10025636 Ga0055531_100256361 222
103 3300006186 Ga0075369_10159631 Ga0075369_101596312 222
104 3300021358 Ga0213873_10000016 Ga0213873_1000001615 222
105 3300021384 Ga0213876_10000056 Ga0213876_10000056123 222
106 3300025245 Ga0207425_1000005 Ga0207425_1000005841 222
107 3300025258 Ga0209129_1000345 Ga0209129_10003454 222
108 3300025292 Ga0209676_1002411 Ga0209676_100241114 222
109 3300025294 Ga0209025_1001007 Ga0209025_100100744 222
110 3300025297 Ga0209758_1000002 Ga0209758_1000002504 222
111 3300025298 Ga0209050_1000001 Ga0209050_1000001455 222
112 3300025298 Ga0209050_1023371 Ga0209050_10233713 222
113 3300025303 Ga0209051_1000472 Ga0209051_100047249 222
114 3300025304 Ga0209257_1007348 Ga0209257_10073483 222
115 3300025304 Ga0209257_1008326 Ga0209257_10083263 222
116 3300025920 Ga0207649_10000016 Ga0207649_10000016137 222
117 3300032126 Ga0307415_100891275 Ga0307415_1008912751 222
118 3300039437 Ga0436365_0320457 Ga0436365_0320457_540_1208 222
119 3300039437 Ga0436365_0869628 Ga0436365_0869628_13867_14535 222
120 3300039450 Ga0436363_0700871 Ga0436363_0700871_194_862 222
121 3300039453 Ga0436362_0580304 Ga0436362_0580304_13867_14535 222
122 3300046460 Ga0495638_0002459 Ga0495638_0002459_14414_15082 222
123 3300046522 Ga0495643_0068164 Ga0495643_0068164_1056_1724 222
124 3300047472 Ga0495686_0022109 Ga0495686_0022109_872_1540 222
125 3300048928 Ga0496125_0267042 Ga0496125_0267042_378_1046 222
126 3300049460 Ga0495682_0075342 Ga0495682_0075342_54_737 222
127 3300049581 Ga0501047_0410595 Ga0501047_0410595_339_1007 222
128 3300049758 Ga0501241_007518 Ga0501241_007518_984_1652 222
129 3300053134 Ga0500658_0000189 Ga0500658_0000189_14610_15278 222
130 3300049686 Ga0501257_000010 Ga0501257_000010_27592_28263 223
131 3300001979 JGI24740J21852_10043376 JGI24740J21852_100433762 224
132 3300013104 Ga0157370_10956409 Ga0157370_109564091 224
133 3300049513 Ga0501290_000855 Ga0501290_000855_2584_3258 224
134 3300049515 Ga0501292_000013 Ga0501292_000013_46076_46750 224
135 3300049517 Ga0501294_000619 Ga0501294_000619_1225_1899 224
136 3300049653 Ga0501206_000806 Ga0501206_000806_740_1414 224
137 3300049654 Ga0501207_021268 Ga0501207_021268_183_857 224
138 3300049662 Ga0501222_000834 Ga0501222_000834_1382_2056 224
139 3300049663 Ga0501223_000447 Ga0501223_000447_5446_6120 224
140 3300049664 Ga0501224_000373 Ga0501224_000373_3737_4411 224
141 3300049665 Ga0501227_004185 Ga0501227_004185_981_1655 224
142 3300049668 Ga0501233_010624 Ga0501233_010624_860_1534 224
143 3300049669 Ga0501235_003337 Ga0501235_003337_918_1592 224
144 3300049670 Ga0501236_044436 Ga0501236_044436_51_725 224
145 3300049688 Ga0501259_003727 Ga0501259_003727_1615_2370 224
146 3300049690 Ga0501261_000272 Ga0501261_000272_2563_3237 224
147 3300049704 Ga0501221_021196 Ga0501221_021196_544_1218 224
148 3300049705 Ga0501225_0002623 Ga0501225_0002623_2723_3397 224
149 3300049708 Ga0501245_002112 Ga0501245_002112_1357_2031 224
150 3300049775 Ga0501279_000004 Ga0501279_000004_77977_78651 224
151 3300049776 Ga0501280_000054 Ga0501280_000054_23033_23707 224
152 3300049777 Ga0501281_00271 Ga0501281_00271_1041_1715 224
153 3300049778 Ga0501282_001207 Ga0501282_001207_1759_2433 224
154 3300053087 Ga0500643_003125 Ga0500643_003125_3171_3845 224
155 3300005578 Ga0068854_100230388 Ga0068854_1002303882 225
156 3300009177 Ga0105248_10306649 Ga0105248_103066492 225
157 3300009545 Ga0105237_10134042 Ga0105237_101340423 225
158 3300009551 Ga0105238_10229842 Ga0105238_102298421 225
159 3300025914 Ga0207671_10000924 Ga0207671_1000092424 225
160 3300025941 Ga0207711_10008027 Ga0207711_100080278 225
161 3300025981 Ga0207640_10051263 Ga0207640_100512632 225
162 3300046519 Ga0495632_0057616 Ga0495632_0057616_454_1131 225
163 3300047472 Ga0495686_0000100 Ga0495686_0000100_29852_30529 225
164 3300048923 Ga0496120_0104426 Ga0496120_0104426_50_733 225
165 3300048924 Ga0496121_0000190 Ga0496121_0000190_1563_2240 225
166 3300048929 Ga0496126_0043243 Ga0496126_0043243_1453_2130 225
167 3300048929 Ga0496126_0186695 Ga0496126_0186695_1058_1735 225
168 3300049679 Ga0501249_005187 Ga0501249_005187_1735_2415 225
169 2162886007 SwRhRL2b_contig_672559 SwRhRL2b_0040.00002820 226
170 3300005347 Ga0070668_100005738 Ga0070668_1000057384 226
171 3300005353 Ga0070669_100000143 Ga0070669_10000014332 226
172 3300005355 Ga0070671_100382890 Ga0070671_1003828902 226
173 3300005367 Ga0070667_100000210 Ga0070667_10000021016 226
174 3300005548 Ga0070665_100044607 Ga0070665_1000446074 226
175 3300005841 Ga0068863_100053532 Ga0068863_1000535323 226
176 3300005841 Ga0068863_100070319 Ga0068863_1000703193 226
177 3300005843 Ga0068860_100025953 Ga0068860_1000259535 226
178 3300005843 Ga0068860_100062744 Ga0068860_1000627443 226
179 3300005844 Ga0068862_100066587 Ga0068862_1000665872 226
180 3300006353 Ga0075370_10059857 Ga0075370_100598572 226
181 3300009092 Ga0105250_10016914 Ga0105250_100169143 226
182 3300017792 Ga0163161_10355019 Ga0163161_103550192 226
183 3300025711 Ga0207696_1010736 Ga0207696_10107363 226
184 3300025735 Ga0207713_1022652 Ga0207713_10226521 226
185 3300025923 Ga0207681_10000252 Ga0207681_1000025234 226
186 3300025931 Ga0207644_10014697 Ga0207644_100146973 226
187 3300025931 Ga0207644_10660429 Ga0207644_106604291 226
188 3300025972 Ga0207668_10015379 Ga0207668_100153792 226
189 3300025986 Ga0207658_10000333 Ga0207658_1000033314 226
190 3300026088 Ga0207641_10015101 Ga0207641_100151013 226
191 3300028379 Ga0268266_10004966 Ga0268266_100049669 226
192 3300028381 Ga0268264_10031068 Ga0268264_100310682 226
193 3300028381 Ga0268264_10066167 Ga0268264_100661672 226
194 3300041456 Ga0451795_0577763 Ga0451795_0577763_159_851 226
195 3300048903 Ga0496100_0727017 Ga0496100_0727017_76_756 226
196 3300048905 Ga0496102_0000170 Ga0496102_0000170_9116_9796 226
197 3300048906 Ga0496103_0000097 Ga0496103_0000097_90854_91534 226
198 3300048907 Ga0496104_0000047 Ga0496104_0000047_95630_96310 226
199 3300048908 Ga0496105_0006315 Ga0496105_0006315_6240_6920 226
200 3300048910 Ga0496107_0197216 Ga0496107_0197216_248_928 226
201 3300048915 Ga0496112_0009708 Ga0496112_0009708_1440_2120 226
202 3300048916 Ga0496113_0000714 Ga0496113_0000714_10575_11255 226
203 3300048918 Ga0496115_0333913 Ga0496115_0333913_481_1161 226
204 3300048920 Ga0496117_0010116 Ga0496117_0010116_2866_3546 226
205 3300048921 Ga0496118_0008503 Ga0496118_0008503_4803_5483 226
206 3300048922 Ga0496119_0000699 Ga0496119_0000699_14661_15341 226
207 3300048923 Ga0496120_0006829 Ga0496120_0006829_2313_2993 226
208 3300048925 Ga0496122_0001260 Ga0496122_0001260_6132_6812 226
209 3300048926 Ga0496123_0000362 Ga0496123_0000362_16401_17081 226
210 3300048928 Ga0496125_0000555 Ga0496125_0000555_6599_7279 226
211 3300048929 Ga0496126_0001290 Ga0496126_0001290_28063_28743 226
212 3300053130 Ga0500642_0000001 Ga0500642_0000001_1200809_1201492 226
213 3300053177 Ga0500636_0039550 Ga0500636_0039550_1951_2637 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

39

251

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9793 14 224
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9792 14 225
7uax-assembly1.cif.gz_A the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp 0.9384 14 223
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9369 14 223
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9352 14 224
ID Description Score Start End Superfamily
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9723 14 224 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9262 14 224 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9169 14 226 3.20.20.10
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9154 14 224 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9114 14 226 3.20.20.10
ID Description Score Start End GO Terms
AF-Q2GB92-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.997 35 225 GO:0030170
AF-A0A6H2DPQ1-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9963 14 225 GO:0030170
AF-A0A7W6GQK4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9955 14 225 GO:0030170
AF-A0A2N3DP75-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9949 82 226 GO:0030170
AF-A0A494TBT3-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9948 14 226 GO:0030170

Feature Viewer

pLDDT pTM Quality
92.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map