F324540

General Info

Members Datasets Scaffolds Average Seq Length
213 145 207 252

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0237872|Ga0501081_0237872_17_889
Length 290
Sequence LDPVVEPEQAAMDALQEVNSVIPGIYVGNQVRPESEYRQALELIEAGINDCEVGRRLGIPRGTIRDWRVGLASASGGRTKLWSGERPLPTCFRCDGGWVDEKAYTYLLGQYLGDGCLSEMPRQVYRLRIACDLKYPDIINEIASCIVVTRGAEMVGFVLCPGCVEVYSYWKHWPCLFPQHGPGRKHERLIELLPWQSEIVATHPRALVRGLIHSDGCRHINPITRRLPSGIKHYEYTRYMFTNVSTDILTIFTDALDLLEVHWTQTTARDIAVSRRDDVAFLDSFVGPKS

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
3 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
4 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.47
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 9.39
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10030302 3300003203 Bacteria 2037
2 Ga0070683_100246802 3300005329 Bacteria 1698
3 Ga0070683_100421884 3300005329 Bacteria 1273
4 Ga0070683_100514349 3300005329 Bacteria 1144
5 Ga0070680_100040735 3300005336 Bacteria 3763
6 Ga0070660_100041886 3300005339 Bacteria 3493
7 Ga0070689_100387834 3300005340 Bacteria 1178
8 Ga0070668_100122435 3300005347 Unclassified 2080
9 Ga0070668_100514753 3300005347 Bacteria 1037
10 Ga0070714_100012181 3300005435 Bacteria 6855
11 Ga0070714_100349699 3300005435 Bacteria 1388
12 Ga0070714_100510300 3300005435 Bacteria 1147
13 Ga0070714_100676562 3300005435 Bacteria 995
14 Ga0070713_100106615 3300005436 Bacteria 2436
15 Ga0070713_100519878 3300005436 Bacteria 1125
16 Ga0070711_100069805 3300005439 Bacteria 2473
17 Ga0070700_100005873 3300005441 Bacteria 6522
18 Ga0070681_10006486 3300005458 Bacteria 11387
19 Ga0070681_10414088 3300005458 Bacteria 1259
20 Ga0070706_100058089 3300005467 Bacteria 3570
21 Ga0070698_100010478 3300005471 Bacteria 9887
22 Ga0070679_100002003 3300005530 Bacteria 18279
23 Ga0070679_100068906 3300005530 Bacteria 3529
24 Ga0070679_100189864 3300005530 Bacteria 2024
25 Ga0070684_100012768 3300005535 Bacteria 6746
26 Ga0070684_100086341 3300005535 Bacteria 2784
27 Ga0068855_100040807 3300005563 Bacteria 5505
28 Ga0068859_100142614 3300005617 Bacteria 2469
29 Ga0068864_100234188 3300005618 Bacteria 1699
30 Ga0068861_100018303 3300005719 Bacteria 4989
31 Ga0068858_100079790 3300005842 Bacteria 3040
32 Ga0068860_100283176 3300005843 Bacteria 1621
33 Ga0081540_1054721 3300005983 Bacteria 1948
34 Ga0081539_10001427 3300005985 Bacteria 41045
35 Ga0070717_10112826 3300006028 Bacteria 2320
36 Ga0070717_10280651 3300006028 Bacteria 1477
37 Ga0070712_100422144 3300006175 Bacteria 1105
38 Ga0075430_100232403 3300006846 Bacteria 1529
39 Ga0075431_100000088 3300006847 Bacteria 56098
40 Ga0075431_100193239 3300006847 Bacteria 2085
41 Ga0075431_100341817 3300006847 Bacteria 1506
42 Ga0075433_10246250 3300006852 Bacteria 1586
43 Ga0075436_100222197 3300006914 Bacteria 1340
44 Ga0097620_100142604 3300006931 Bacteria 2469
45 Ga0075435_100228841 3300007076 Bacteria 1579
46 Ga0105245_10041414 3300009098 Bacteria 4106
47 Ga0105245_10282880 3300009098 Bacteria 1622
48 Ga0105241_10141817 3300009174 Bacteria 1957
49 Ga0105249_10194969 3300009553 Unclassified 1979
50 Ga0105239_10542471 3300010375 Bacteria 1324
51 Ga0105246_10561059 3300011119 Bacteria 980
52 Ga0157370_10145606 3300013104 Bacteria 2206
53 Ga0157369_10029821 3300013105 Bacteria 6025
54 Ga0157369_10103712 3300013105 Bacteria 3029
55 Ga0157372_10321277 3300013307 Bacteria 1802
56 Ga0197907_10357171 3300020069 Bacteria 977
57 Ga0213875_10053767 3300021388 Bacteria 1886
58 Ga0207705_10001935 3300025909 Bacteria 16168
59 Ga0207684_10106686 3300025910 Bacteria 2396
60 Ga0207684_10545261 3300025910 Bacteria 992
61 Ga0207707_10077049 3300025912 Bacteria 2910
62 Ga0207707_10249283 3300025912 Bacteria 1543
63 Ga0207693_10024906 3300025915 Bacteria 4746
64 Ga0207663_10055042 3300025916 Bacteria 2494
65 Ga0207660_10323484 3300025917 Bacteria 1232
66 Ga0207657_10029172 3300025919 Bacteria 5026
67 Ga0207646_10311347 3300025922 Bacteria 1423
68 Ga0207700_10457844 3300025928 Bacteria 1125
69 Ga0207700_10542716 3300025928 Bacteria 1031
70 Ga0207664_10425867 3300025929 Bacteria 1183
71 Ga0207664_10454925 3300025929 Bacteria 1143
72 Ga0207644_10438932 3300025931 Bacteria 1071
73 Ga0207706_10009797 3300025933 Bacteria 8792
74 Ga0207661_10195913 3300025944 Bacteria 1774
75 Ga0207661_10258020 3300025944 Bacteria 1552
76 Ga0207661_10448207 3300025944 Bacteria 1175
77 Ga0207712_10026405 3300025961 Bacteria 3869
78 Ga0207712_10161736 3300025961 Bacteria 1741
79 Ga0207668_10036744 3300025972 Bacteria 3272
80 Ga0207639_10255090 3300026041 Bacteria 1531
81 Ga0207676_10245827 3300026095 Bacteria 1608
82 Ga0207674_10096689 3300026116 Bacteria 2938
83 Ga0268264_10832909 3300028381 Bacteria 923
84 Ga0307405_10114365 3300031731 Bacteria 1834
85 Ga0307410_10412071 3300031852 Bacteria 1094
86 Ga0307409_100269423 3300031995 Bacteria 1567
87 Ga0307416_100203055 3300032002 Bacteria 1882
88 Ga0307415_100321547 3300032126 Bacteria 1290
89 Ga0373956_0027910 3300035119 Bacteria 2454
90 Ga0373924_0013238 3300035410 Bacteria 3097
91 Ga0373925_0000010 3300037068 Bacteria 229059
92 Ga0373925_0066630 3300037068 Bacteria 2714
93 Ga0373925_0368625 3300037068 Bacteria 1168
94 Ga0373925_0529402 3300037068 Bacteria 968
95 Ga0395900_0026020 3300037418 Bacteria 5991
96 Ga0395905_0370667 3300037471 Bacteria 1325
97 Ga0436364_0890681 3300037853 Bacteria 1699
98 Ga0436364_1092251 3300037853 Bacteria 3335
99 Ga0395901_0005418 3300038443 Bacteria 12912
100 Ga0395901_0006340 3300038443 Bacteria 11982
101 Ga0436362_0068107 3300039453 Bacteria 1776
102 Ga0466966_0108737 3300044684 Bacteria 1710
103 Ga0466961_0016232 3300044693 Bacteria 4782
104 Ga0466961_0169618 3300044693 Bacteria 1358
105 Ga0466960_0034877 3300044901 Bacteria 2347
106 Ga0466959_0008323 3300045049 Bacteria 7326
107 Ga0466959_0058038 3300045049 Bacteria 2820
108 Ga0466959_0322000 3300045049 Bacteria 1057
109 Ga0466958_0192704 3300045836 Bacteria 1296
110 Ga0495603_0124764 3300046455 Bacteria 1500
111 Ga0495629_0023315 3300046459 Bacteria 4411
112 Ga0495653_0159770 3300046463 Bacteria 1565
113 Ga0495582_0044994 3300046473 Bacteria 2431
114 Ga0495640_0119128 3300046533 Bacteria 1718
115 Ga0495586_0015966 3300046535 Bacteria 3995
116 Ga0495586_0061354 3300046535 Bacteria 2046
117 Ga0495587_0147065 3300046536 Bacteria 1343
118 Ga0495645_0485234 3300046543 Bacteria 775
119 Ga0495634_0018070 3300046642 Bacteria 5024
120 Ga0495634_0025427 3300046642 Bacteria 4142
121 Ga0495635_0188621 3300046663 Bacteria 1400
122 Ga0495635_0379949 3300046663 Bacteria 940
123 Ga0495657_0206612 3300046675 Bacteria 1195
124 Ga0495599_0002873 3300046678 Bacteria 10033
125 Ga0495599_0058172 3300046678 Bacteria 2418
126 Ga0495613_0007908 3300046689 Bacteria 7909
127 Ga0495613_0169130 3300046689 Bacteria 1552
128 Ga0495674_0119704 3300047319 Bacteria 2225
129 Ga0495676_0037684 3300047321 Bacteria 4021
130 Ga0495680_0053490 3300047322 Bacteria 3141
131 Ga0495684_0192123 3300047471 Bacteria 1509
132 Ga0495602_0081856 3300048088 Bacteria 2712
133 Ga0496100_0050003 3300048903 Bacteria 2706
134 Ga0496101_0309783 3300048904 Bacteria 1238
135 Ga0496102_0167594 3300048905 Bacteria 2067
136 Ga0496103_0130254 3300048906 Bacteria 1606
137 Ga0496104_0000009 3300048907 Bacteria 488055
138 Ga0496104_1029251 3300048907 Bacteria 727
139 Ga0496105_0000007 3300048908 Bacteria 339658
140 Ga0496106_0024266 3300048909 Bacteria 4506
141 Ga0496106_0655955 3300048909 Bacteria 838
142 Ga0496108_0081565 3300048911 Bacteria 2741
143 Ga0496108_0569565 3300048911 Bacteria 987
144 Ga0496109_0025615 3300048912 Bacteria 5257
145 Ga0496109_0178784 3300048912 Bacteria 1992
146 Ga0496109_0209876 3300048912 Bacteria 1831
147 Ga0496110_0065028 3300048913 Bacteria 3224
148 Ga0496111_0028786 3300048914 Unclassified 3939
149 Ga0496111_0031496 3300048914 Bacteria 3778
150 Ga0496112_0085265 3300048915 Bacteria 3125
151 Ga0496113_0159553 3300048916 Bacteria 1782
152 Ga0496113_0463831 3300048916 Unclassified 1018
153 Ga0496126_0034831 3300048929 Bacteria 4724
154 Ga0496126_0079050 3300048929 Bacteria 2913
155 Ga0501031_0055336 3300049568 Bacteria 2585
156 Ga0501031_0128130 3300049568 Bacteria 1658
157 Ga0501031_0329785 3300049568 Unclassified 988
158 Ga0501036_0003139 3300049572 Bacteria 13179
159 Ga0501036_0154155 3300049572 Bacteria 1938
160 Ga0501038_0008981 3300049574 Bacteria 9171
161 Ga0501039_0007028 3300049575 Bacteria 8568
162 Ga0501039_0076668 3300049575 Bacteria 2599
163 Ga0501039_0218073 3300049575 Unclassified 1500
164 Ga0501040_0005159 3300049576 Bacteria 8450
165 Ga0501040_0018107 3300049576 Unclassified 4678
166 Ga0501041_0060605 3300049577 Bacteria 2316
167 Ga0501041_0115071 3300049577 Unclassified 1670
168 Ga0501042_0189836 3300049578 Bacteria 1482
169 Ga0501042_0380258 3300049578 Unclassified 1022
170 Ga0501046_0141665 3300049580 Bacteria 1819
171 Ga0501069_0069526 3300049585 Bacteria 1971
172 Ga0501071_0027537 3300049587 Unclassified 3999
173 Ga0501072_0000649 3300049588 Bacteria 25023
174 Ga0501072_0118675 3300049588 Bacteria 2108
175 Ga0501074_0074354 3300049590 Bacteria 2440
176 Ga0501075_0059356 3300049591 Bacteria 2881
177 Ga0501075_0089971 3300049591 Unclassified 2328
178 Ga0501075_0134523 3300049591 Bacteria 1883
179 Ga0501076_0043622 3300049592 Bacteria 3535
180 Ga0501077_0001509 3300049593 Bacteria 14036
181 Ga0501079_0139455 3300049741 Bacteria 1888
182 Ga0501079_0159384 3300049741 Bacteria 1759
183 Ga0501080_0517208 3300049742 Bacteria 1065
184 Ga0501081_0013574 3300049743 Bacteria 5358
185 Ga0501081_0094274 3300049743 Unclassified 2109
186 Ga0501081_0237872 3300049743 Unclassified 1327
187 Ga0501045_0002618 3300049824 Bacteria 12255
188 Ga0501045_0071873 3300049824 Bacteria 2547
189 nmdc:mga00v17_157602_c1 3300050491 Bacteria 1460
190 nmdc:mga0qj67_329368_c1 3300050509 Bacteria 1236
191 nmdc:mga0qj67_87445_c1 3300050509 Bacteria 2501
192 nmdc:mga06r32_1652_c1 3300050510 Bacteria 20136
193 nmdc:mga06r32_509808_c1 3300050510 Bacteria 1179
194 nmdc:mga0rr50_13449_c1 3300050513 Bacteria 5328
195 nmdc:mga0sz30_12914_c1 3300050516 Bacteria 3259
196 Ga0495601_0221871 3300053077 Bacteria 1235
197 Ga0495619_0487967 3300053085 Unclassified 848
198 Ga0500643_006984 3300053087 Bacteria 4632
199 Ga0500616_0000398 3300053153 Bacteria 59666
200 Ga0501084_0002302 3300054114 Bacteria 15350
201 Ga0501084_0029948 3300054114 Unclassified 4553
202 Ga0501084_0039007 3300054114 Unclassified 3973
203 Ga0501082_0022265 3300060353 Bacteria 5461
204 Ga0501082_0063870 3300060353 Unclassified 3170
205 Ga0501082_0333462 3300060353 Bacteria 1322
206 Ga0530510_0002915 3300061734 Bacteria 11731
207 Ga0530510_0266071 3300061734 Bacteria 1279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1029251 Ga0496104_1029251_88_684 188
2 3300049591 Ga0501075_0059356 Ga0501075_0059356_2180_2857 202
3 3300025929 Ga0207664_10454925 Ga0207664_104549251 208
4 3300046663 Ga0495635_0379949 Ga0495635_0379949_241_882 208
5 3300037068 Ga0373925_0368625 Ga0373925_0368625_387_1064 211
6 3300006847 Ga0075431_100341817 Ga0075431_1003418173 213
7 3300035119 Ga0373956_0027910 Ga0373956_0027910_359_1054 217
8 3300035410 Ga0373924_0013238 Ga0373924_0013238_424_1119 217
9 3300046463 Ga0495653_0159770 Ga0495653_0159770_772_1467 217
10 3300046536 Ga0495587_0147065 Ga0495587_0147065_252_947 217
11 3300046543 Ga0495645_0485234 Ga0495645_0485234_47_742 217
12 3300046642 Ga0495634_0025427 Ga0495634_0025427_2918_3613 217
13 3300046663 Ga0495635_0188621 Ga0495635_0188621_409_1104 217
14 3300046675 Ga0495657_0206612 Ga0495657_0206612_288_983 217
15 3300046678 Ga0495599_0058172 Ga0495599_0058172_502_1197 217
16 3300048088 Ga0495602_0081856 Ga0495602_0081856_695_1390 217
17 3300053077 Ga0495601_0221871 Ga0495601_0221871_414_1109 217
18 3300053085 Ga0495619_0487967 Ga0495619_0487967_85_780 217
19 3300013104 Ga0157370_10145606 Ga0157370_101456063 218
20 3300013105 Ga0157369_10029821 Ga0157369_100298217 218
21 3300025944 Ga0207661_10195913 Ga0207661_101959131 220
22 3300025909 Ga0207705_10001935 Ga0207705_100019355 221
23 3300005329 Ga0070683_100246802 Ga0070683_1002468022 222
24 3300049568 Ga0501031_0055336 Ga0501031_0055336_1753_2493 223
25 3300049588 Ga0501072_0000649 Ga0501072_0000649_2695_3435 223
26 3300046678 Ga0495599_0002873 Ga0495599_0002873_1090_1803 224
27 3300037068 Ga0373925_0000010 Ga0373925_0000010_190463_191173 227
28 3300005530 Ga0070679_100068906 Ga0070679_1000689064 229
29 3300044684 Ga0466966_0108737 Ga0466966_0108737_443_1168 230
30 3300045049 Ga0466959_0008323 Ga0466959_0008323_2168_2893 230
31 3300044693 Ga0466961_0169618 Ga0466961_0169618_206_952 231
32 3300005618 Ga0068864_100234188 Ga0068864_1002341883 232
33 3300021388 Ga0213875_10053767 Ga0213875_100537674 232
34 3300037853 Ga0436364_1092251 Ga0436364_1092251_314_1072 232
35 iso_pu_bacteria 2984576629 2984579856 232
36 iso_pu_bacteria 2990256926 2990257462 232
37 3300049575 Ga0501039_0076668 Ga0501039_0076668_1068_1817 233
38 3300049824 Ga0501045_0071873 Ga0501045_0071873_1646_2395 233
39 3300005329 Ga0070683_100421884 Ga0070683_1004218843 234
40 3300048911 Ga0496108_0081565 Ga0496108_0081565_1166_1900 234
41 3300048913 Ga0496110_0065028 Ga0496110_0065028_1959_2693 234
42 3300005535 Ga0070684_100086341 Ga0070684_1000863413 235
43 3300009098 Ga0105245_10282880 Ga0105245_102828802 235
44 3300039453 Ga0436362_0068107 Ga0436362_0068107_41_781 235
45 3300046459 Ga0495629_0023315 Ga0495629_0023315_3295_4065 235
46 3300046473 Ga0495582_0044994 Ga0495582_0044994_489_1259 235
47 3300046535 Ga0495586_0061354 Ga0495586_0061354_410_1180 235
48 3300046642 Ga0495634_0018070 Ga0495634_0018070_155_925 235
49 3300046689 Ga0495613_0007908 Ga0495613_0007908_1880_2650 235
50 3300046689 Ga0495613_0169130 Ga0495613_0169130_596_1366 235
51 3300048903 Ga0496100_0050003 Ga0496100_0050003_1714_2454 235
52 3300048904 Ga0496101_0309783 Ga0496101_0309783_314_1054 235
53 3300048905 Ga0496102_0167594 Ga0496102_0167594_951_1691 235
54 3300048906 Ga0496103_0130254 Ga0496103_0130254_790_1530 235
55 3300048909 Ga0496106_0024266 Ga0496106_0024266_3506_4246 235
56 3300048911 Ga0496108_0569565 Ga0496108_0569565_163_903 235
57 3300048912 Ga0496109_0209876 Ga0496109_0209876_839_1579 235
58 3300048914 Ga0496111_0031496 Ga0496111_0031496_2558_3298 235
59 3300048916 Ga0496113_0159553 Ga0496113_0159553_992_1732 235
60 3300049575 Ga0501039_0007028 Ga0501039_0007028_6095_6874 235
61 3300049575 Ga0501039_0218073 Ga0501039_0218073_15_761 235
62 3300049576 Ga0501040_0005159 Ga0501040_0005159_118_897 235
63 3300049593 Ga0501077_0001509 Ga0501077_0001509_5626_6405 235
64 3300049741 Ga0501079_0159384 Ga0501079_0159384_501_1280 235
65 3300049743 Ga0501081_0013574 Ga0501081_0013574_828_1607 235
66 3300049824 Ga0501045_0002618 Ga0501045_0002618_10456_11235 235
67 3300054114 Ga0501084_0002302 Ga0501084_0002302_2126_2905 235
68 3300061734 Ga0530510_0002915 Ga0530510_0002915_855_1634 235
69 3300044901 Ga0466960_0034877 Ga0466960_0034877_1405_2130 236
70 3300045049 Ga0466959_0322000 Ga0466959_0322000_194_937 236
71 3300045836 Ga0466958_0192704 Ga0466958_0192704_341_1066 236
72 3300005563 Ga0068855_100040807 Ga0068855_1000408073 237
73 3300050491 nmdc:mga00v17_157602_c1 nmdc:mga00v17_157602_c1_694_1434 237
74 3300006846 Ga0075430_100232403 Ga0075430_1002324034 238
75 3300006847 Ga0075431_100193239 Ga0075431_1001932394 238
76 3300009174 Ga0105241_10141817 Ga0105241_101418173 238
77 3300048909 Ga0496106_0655955 Ga0496106_0655955_74_817 238
78 3300048912 Ga0496109_0025615 Ga0496109_0025615_3029_3766 238
79 3300048916 Ga0496113_0463831 Ga0496113_0463831_119_856 238
80 3300050509 nmdc:mga0qj67_329368_c1 nmdc:mga0qj67_329368_c1_25_828 238
81 3300050509 nmdc:mga0qj67_87445_c1 nmdc:mga0qj67_87445_c1_183_965 238
82 3300050510 nmdc:mga06r32_509808_c1 nmdc:mga06r32_509808_c1_107_889 238
83 3300053153 Ga0500616_0000398 Ga0500616_0000398_36278_37051 238
84 iso_pu_bacteria 2515154155 2515850921 238
85 3300031852 Ga0307410_10412071 Ga0307410_104120712 239
86 3300032126 Ga0307415_100321547 Ga0307415_1003215472 239
87 3300037418 Ga0395900_0026020 Ga0395900_0026020_1564_2310 239
88 3300037471 Ga0395905_0370667 Ga0395905_0370667_298_1044 239
89 3300038443 Ga0395901_0005418 Ga0395901_0005418_10776_11522 239
90 3300005336 Ga0070680_100040735 Ga0070680_1000407352 240
91 3300005458 Ga0070681_10414088 Ga0070681_104140881 240
92 3300005530 Ga0070679_100002003 Ga0070679_10000200310 240
93 3300006847 Ga0075431_100000088 Ga0075431_10000008832 240
94 3300025912 Ga0207707_10249283 Ga0207707_102492833 240
95 3300031731 Ga0307405_10114365 Ga0307405_101143652 240
96 3300031995 Ga0307409_100269423 Ga0307409_1002694234 240
97 3300032002 Ga0307416_100203055 Ga0307416_1002030552 240
98 3300038443 Ga0395901_0006340 Ga0395901_0006340_8148_8891 240
99 3300050510 nmdc:mga06r32_1652_c1 nmdc:mga06r32_1652_c1_17745_18530 240
100 3300053087 Ga0500643_006984 Ga0500643_006984_3115_3846 240
101 iso_pu_bacteria 2816332119 2816425457 240
102 3300005329 Ga0070683_100514349 Ga0070683_1005143492 241
103 3300005436 Ga0070713_100106615 Ga0070713_1001066154 241
104 3300005530 Ga0070679_100189864 Ga0070679_1001898642 241
105 3300005535 Ga0070684_100012768 Ga0070684_1000127687 241
106 3300006028 Ga0070717_10112826 Ga0070717_101128264 241
107 3300013105 Ga0157369_10103712 Ga0157369_101037122 241
108 3300013307 Ga0157372_10321277 Ga0157372_103212772 241
109 3300025915 Ga0207693_10024906 Ga0207693_100249064 241
110 3300025917 Ga0207660_10323484 Ga0207660_103234843 241
111 3300025944 Ga0207661_10258020 Ga0207661_102580202 241
112 3300025944 Ga0207661_10448207 Ga0207661_104482073 241
113 3300037853 Ga0436364_0890681 Ga0436364_0890681_22_789 241
114 3300046533 Ga0495640_0119128 Ga0495640_0119128_897_1664 241
115 3300047319 Ga0495674_0119704 Ga0495674_0119704_1135_1953 241
116 3300047322 Ga0495680_0053490 Ga0495680_0053490_349_1167 241
117 3300047471 Ga0495684_0192123 Ga0495684_0192123_476_1243 241
118 3300049588 Ga0501072_0118675 Ga0501072_0118675_1217_1987 241
119 3300005339 Ga0070660_100041886 Ga0070660_1000418864 242
120 3300005347 Ga0070668_100122435 Ga0070668_1001224352 242
121 3300005439 Ga0070711_100069805 Ga0070711_1000698053 242
122 3300005441 Ga0070700_100005873 Ga0070700_1000058736 242
123 3300005458 Ga0070681_10006486 Ga0070681_100064865 242
124 3300005719 Ga0068861_100018303 Ga0068861_1000183037 242
125 3300009098 Ga0105245_10041414 Ga0105245_100414147 242
126 3300009553 Ga0105249_10194969 Ga0105249_101949694 242
127 3300020069 Ga0197907_10357171 Ga0197907_103571711 242
128 3300025912 Ga0207707_10077049 Ga0207707_100770493 242
129 3300025916 Ga0207663_10055042 Ga0207663_100550421 242
130 3300025919 Ga0207657_10029172 Ga0207657_100291722 242
131 3300025961 Ga0207712_10026405 Ga0207712_100264051 242
132 3300025972 Ga0207668_10036744 Ga0207668_100367443 242
133 3300046455 Ga0495603_0124764 Ga0495603_0124764_340_1101 242
134 3300046535 Ga0495586_0015966 Ga0495586_0015966_2334_3089 242
135 3300047321 Ga0495676_0037684 Ga0495676_0037684_444_1205 242
136 3300048929 Ga0496126_0034831 Ga0496126_0034831_1532_2302 242
137 3300048929 Ga0496126_0079050 Ga0496126_0079050_93_863 242
138 3300050513 nmdc:mga0rr50_13449_c1 nmdc:mga0rr50_13449_c1_3334_4089 242
139 3300050516 nmdc:mga0sz30_12914_c1 nmdc:mga0sz30_12914_c1_840_1610 242
140 3300005340 Ga0070689_100387834 Ga0070689_1003878343 243
141 3300005347 Ga0070668_100514753 Ga0070668_1005147532 243
142 3300005435 Ga0070714_100349699 Ga0070714_1003496992 243
143 3300005435 Ga0070714_100510300 Ga0070714_1005103001 243
144 3300005436 Ga0070713_100106615 Ga0070713_1001066153 243
145 3300005436 Ga0070713_100519878 Ga0070713_1005198781 243
146 3300005617 Ga0068859_100142614 Ga0068859_1001426143 243
147 3300005842 Ga0068858_100079790 Ga0068858_1000797904 243
148 3300005843 Ga0068860_100283176 Ga0068860_1002831763 243
149 3300006028 Ga0070717_10112826 Ga0070717_101128263 243
150 3300006028 Ga0070717_10280651 Ga0070717_102806513 243
151 3300006175 Ga0070712_100422144 Ga0070712_1004221443 243
152 3300006931 Ga0097620_100142604 Ga0097620_1001426044 243
153 3300010375 Ga0105239_10542471 Ga0105239_105424713 243
154 3300011119 Ga0105246_10561059 Ga0105246_105610591 243
155 3300025928 Ga0207700_10457844 Ga0207700_104578441 243
156 3300025929 Ga0207664_10425867 Ga0207664_104258671 243
157 3300025931 Ga0207644_10438932 Ga0207644_104389322 243
158 3300025933 Ga0207706_10009797 Ga0207706_100097972 243
159 3300025961 Ga0207712_10161736 Ga0207712_101617363 243
160 3300026041 Ga0207639_10255090 Ga0207639_102550902 243
161 3300026116 Ga0207674_10096689 Ga0207674_100966893 243
162 3300028381 Ga0268264_10832909 Ga0268264_108329091 243
163 3300048907 Ga0496104_0000009 Ga0496104_0000009_315394_316152 243
164 3300048908 Ga0496105_0000007 Ga0496105_0000007_171904_172662 243
165 3300048912 Ga0496109_0178784 Ga0496109_0178784_235_1008 243
166 3300048915 Ga0496112_0085265 Ga0496112_0085265_1526_2299 243
167 3300025928 Ga0207700_10542716 Ga0207700_105427162 244
168 3300026095 Ga0207676_10245827 Ga0207676_102458273 244
169 3300048914 Ga0496111_0028786 Ga0496111_0028786_594_1355 244
170 3300049592 Ga0501076_0043622 Ga0501076_0043622_1718_2497 244
171 3300005435 Ga0070714_100012181 Ga0070714_1000121813 245
172 3300005435 Ga0070714_100676562 Ga0070714_1006765621 245
173 3300005467 Ga0070706_100058089 Ga0070706_1000580893 245
174 3300025910 Ga0207684_10106686 Ga0207684_101066863 245
175 3300037068 Ga0373925_0066630 Ga0373925_0066630_67_831 245
176 3300037068 Ga0373925_0529402 Ga0373925_0529402_67_831 245
177 3300049572 Ga0501036_0003139 Ga0501036_0003139_173_940 245
178 3300049574 Ga0501038_0008981 Ga0501038_0008981_852_1619 245
179 3300049585 Ga0501069_0069526 Ga0501069_0069526_160_927 245
180 3300005471 Ga0070698_100010478 Ga0070698_1000104782 246
181 3300006852 Ga0075433_10246250 Ga0075433_102462503 246
182 3300006914 Ga0075436_100222197 Ga0075436_1002221973 246
183 3300007076 Ga0075435_100228841 Ga0075435_1002288413 246
184 3300025910 Ga0207684_10545261 Ga0207684_105452611 246
185 3300025922 Ga0207646_10311347 Ga0207646_103113472 246
186 3300049568 Ga0501031_0128130 Ga0501031_0128130_243_1022 246
187 3300049577 Ga0501041_0060605 Ga0501041_0060605_468_1247 246
188 3300049578 Ga0501042_0189836 Ga0501042_0189836_461_1240 246
189 3300049580 Ga0501046_0141665 Ga0501046_0141665_218_997 246
190 3300049590 Ga0501074_0074354 Ga0501074_0074354_505_1284 246
191 3300049591 Ga0501075_0134523 Ga0501075_0134523_799_1578 246
192 3300049741 Ga0501079_0139455 Ga0501079_0139455_689_1468 246
193 3300049742 Ga0501080_0517208 Ga0501080_0517208_224_1003 246
194 3300044693 Ga0466961_0016232 Ga0466961_0016232_1694_2479 247
195 3300045049 Ga0466959_0058038 Ga0466959_0058038_1189_1974 247
196 3300049568 Ga0501031_0329785 Ga0501031_0329785_127_909 247
197 3300049572 Ga0501036_0154155 Ga0501036_0154155_74_856 247
198 3300049576 Ga0501040_0018107 Ga0501040_0018107_2901_3740 247
199 3300049577 Ga0501041_0115071 Ga0501041_0115071_726_1508 247
200 3300049578 Ga0501042_0380258 Ga0501042_0380258_106_888 247
201 3300049587 Ga0501071_0027537 Ga0501071_0027537_2881_3663 247
202 3300049591 Ga0501075_0089971 Ga0501075_0089971_560_1342 247
203 3300049743 Ga0501081_0094274 Ga0501081_0094274_866_1648 247
204 3300049743 Ga0501081_0237872 Ga0501081_0237872_17_889 247
205 3300054114 Ga0501084_0029948 Ga0501084_0029948_1873_2712 247
206 3300054114 Ga0501084_0039007 Ga0501084_0039007_2453_3235 247
207 3300060353 Ga0501082_0022265 Ga0501082_0022265_3283_4122 247
208 3300060353 Ga0501082_0063870 Ga0501082_0063870_103_885 247
209 3300061734 Ga0530510_0266071 Ga0530510_0266071_287_1069 247
210 3300060353 Ga0501082_0333462 Ga0501082_0333462_395_1177 248
211 3300003203 JGI25406J46586_10030302 JGI25406J46586_100303022 251
212 3300005983 Ga0081540_1054721 Ga0081540_10547211 251
213 3300005985 Ga0081539_10001427 Ga0081539_1000142720 251

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r0q-assembly1.cif.gz_E crystal structure of a serine recombinase- dna regulatory complex 0.9526 4 40
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.8982 1 42
2r0q-assembly1.cif.gz_F crystal structure of a serine recombinase- dna regulatory complex 0.8129 4 43
5lkq-assembly1.cif.gz_B protease domain of rada 0.7571 185 204
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.7391 1 42
ID Description Score Start End Superfamily
1u78A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9223 1 39 1.10.10.60
1tc3C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8982 1 42 1.10.10.60
af_P24610_34_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8439 1 42 1.10.10.10
af_Q20551_91_164_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8273 1 40 1.10.10.10
af_Q06710_1_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8258 1 40 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Y5P1B2-F1-model_v4 DOD-type homing endonuclease domain-containing protein 0.9672 67 251 GO:0004519
AF-A0A7W0H3K8-F1-model_v4 Homing endonuclease LAGLIDADG domain-containing protein 0.9639 76 251
AF-A0A537WJ24-F1-model_v4 Helix-turn-helix domain-containing protein 0.9607 81 248
AF-A0A2V6YFS9-F1-model_v4 DOD-type homing endonuclease domain-containing protein 0.9599 71 251
AF-G4I9Q5-F1-model_v4 deleted 0.9599 92 251

Feature Viewer

pLDDT pTM Quality
88.51 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map