F324970

General Info

Members Datasets Scaffolds Average Seq Length
214 118 428 248

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100344702|Ga0070684_1003447022
Length 277
Sequence MRAAPDWTMPIRSLCRASPARRGSMPNFDNAIILVTGAASGIGAATATRLAADGARKLILADLDEDRLRDFAFSLPCERQVLIGDVADESFWASADLTGLTHAVVNAGIGAGGPIADTDLAEWRRVMSPNLDGAFLTLQAAMRAIKSGGQGGAIVLTASVAGLKAEPGIAAYGASKAAVIHLARIAAKEGGPDRIRVNSIAPGGVETPIWNAVPFFQDLVKSAGSEEAAFAAMGSAAGPAGRFARPDEIAAQIAFLLSDDCGFVTGSCFVSDGGYSL

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
118 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 1.87
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100344702 3300005535 Bacteria 1370
2 LJQas_1002321 3300000549 Bacteria 2668
3 JGI24736J21556_1000356 3300001904 Bacteria 8594
4 JGI24741J21665_1004667 3300001915 Bacteria 2992
5 JGI24741J21665_1013362 3300001915 Bacteria 1394
6 JGI24740J21852_10004247 3300001979 Bacteria 6175
7 JGI24740J21852_10008799 3300001979 Bacteria 4002
8 JGI24739J22299_10005653 3300001989 Bacteria 4738
9 JGI24737J22298_10021035 3300001990 Bacteria 2080
10 JGI24735J21928_10006097 3300002067 Bacteria 3980
11 JGI24735J21928_10010877 3300002067 Bacteria 2892
12 JGI24738J21930_10005101 3300002075 Bacteria 3174
13 Ga0065707_10156243 3300005295 Bacteria 1606
14 Ga0070658_10000013 3300005327 Bacteria 267776
15 Ga0070658_10013161 3300005327 Bacteria 6636
16 Ga0070658_10056331 3300005327 Bacteria 3194
17 Ga0070658_10217569 3300005327 Bacteria 1615
18 Ga0070683_100027182 3300005329 Bacteria 5159
19 Ga0070683_100069487 3300005329 Bacteria 3284
20 Ga0068869_100139940 3300005334 Bacteria 1868
21 Ga0070680_100023744 3300005336 Bacteria 4894
22 Ga0070682_100219147 3300005337 Bacteria 1353
23 Ga0070682_100430878 3300005337 Bacteria 1005
24 Ga0068868_100000042 3300005338 Bacteria 68731
25 Ga0070660_100000810 3300005339 Bacteria 20717
26 Ga0070660_100005009 3300005339 Bacteria 9159
27 Ga0070660_100007816 3300005339 Bacteria 7457
28 Ga0070660_100049579 3300005339 Bacteria 3228
29 Ga0070660_100205206 3300005339 Bacteria 1599
30 Ga0070660_100255410 3300005339 Bacteria 1430
31 Ga0070661_100000133 3300005344 Bacteria 62182
32 Ga0070661_100009967 3300005344 Bacteria 6592
33 Ga0070661_100340712 3300005344 Bacteria 1174
34 Ga0070692_10004981 3300005345 Bacteria 5611
35 Ga0070692_10109671 3300005345 Bacteria 1524
36 Ga0070675_100057564 3300005354 Bacteria 3205
37 Ga0070675_100086294 3300005354 Bacteria 2623
38 Ga0070659_100000011 3300005366 Bacteria 185903
39 Ga0070659_100001626 3300005366 Bacteria 16174
40 Ga0070659_100006181 3300005366 Bacteria 8649
41 Ga0070659_100024575 3300005366 Bacteria 4619
42 Ga0070659_100107238 3300005366 Bacteria 2252
43 Ga0070714_100186775 3300005435 Bacteria 1889
44 Ga0070663_100078562 3300005455 Bacteria 2419
45 Ga0070681_10078637 3300005458 Bacteria 3255
46 Ga0070679_100000002 3300005530 Bacteria 312066
47 Ga0070679_100076835 3300005530 Bacteria 3328
48 Ga0070679_100305569 3300005530 Bacteria 1541
49 Ga0070684_100061221 3300005535 Bacteria 3294
50 Ga0070684_100218485 3300005535 Bacteria 1739
51 Ga0068853_100057537 3300005539 Bacteria 3355
52 Ga0070686_100000284 3300005544 Bacteria 34135
53 Ga0070693_100080957 3300005547 Bacteria 1936
54 Ga0070665_100000089 3300005548 Bacteria 177659
55 Ga0068855_100235665 3300005563 Bacteria 2047
56 Ga0068855_100495945 3300005563 Bacteria 1327
57 Ga0068855_100787710 3300005563 Unclassified 1011
58 Ga0068857_100432235 3300005577 Bacteria 1229
59 Ga0068854_100032240 3300005578 Bacteria 3644
60 Ga0068854_100217966 3300005578 Bacteria 1508
61 Ga0068856_100079152 3300005614 Bacteria 3259
62 Ga0068856_100500718 3300005614 Bacteria 1236
63 Ga0068861_100420871 3300005719 Bacteria 1190
64 Ga0068863_100024013 3300005841 Bacteria 5819
65 Ga0111539_10300415 3300009094 Bacteria 1868
66 Ga0105245_10062001 3300009098 Bacteria 3373
67 Ga0157373_10077675 3300013100 Bacteria 2342
68 Ga0157373_10110675 3300013100 Bacteria 1931
69 Ga0157373_10342697 3300013100 Bacteria 1065
70 Ga0157371_10007758 3300013102 Bacteria 8628
71 Ga0157370_10028095 3300013104 Bacteria 5539
72 Ga0157370_10049597 3300013104 Bacteria 4017
73 Ga0157370_10186965 3300013104 Bacteria 1923
74 Ga0157369_10028118 3300013105 Bacteria 6225
75 Ga0157369_10061167 3300013105 Bacteria 4061
76 Ga0157369_10084644 3300013105 Bacteria 3389
77 Ga0157369_10159677 3300013105 Bacteria 2380
78 Ga0157369_10300930 3300013105 Bacteria 1668
79 Ga0157372_10096721 3300013307 Bacteria 3366
80 Ga0157375_10083267 3300013308 Bacteria 3244
81 Ga0157380_10000229 3300014326 Bacteria 33592
82 Ga0157380_10043579 3300014326 Bacteria 3513
83 Ga0157380_10423735 3300014326 Bacteria 1270
84 Ga0157380_10426055 3300014326 Bacteria 1267
85 Ga0206356_11780902 3300020070 Bacteria 3062
86 Ga0206354_10607483 3300020081 Bacteria 5199
87 Ga0206353_11089745 3300020082 Bacteria 5455
88 Ga0213873_10000007 3300021358 Bacteria 309961
89 Ga0213876_10000005 3300021384 Bacteria 727326
90 Ga0213876_10001457 3300021384 Bacteria 14727
91 Ga0213876_10003902 3300021384 Bacteria 8429
92 Ga0207656_10033959 3300025321 Bacteria 2127
93 Ga0207647_10007713 3300025904 Bacteria 7748
94 Ga0207645_10147599 3300025907 Bacteria 1534
95 Ga0207705_10000002 3300025909 Bacteria 2046852
96 Ga0207705_10060664 3300025909 Bacteria 2732
97 Ga0207705_10249241 3300025909 Bacteria 1354
98 Ga0207705_10280034 3300025909 Bacteria 1276
99 Ga0207654_10029141 3300025911 Bacteria 3018
100 Ga0207707_10024490 3300025912 Bacteria 5282
101 Ga0207707_10047289 3300025912 Bacteria 3747
102 Ga0207707_10365572 3300025912 Bacteria 1242
103 Ga0207707_10503723 3300025912 Bacteria 1032
104 Ga0207695_10009458 3300025913 Bacteria 12058
105 Ga0207671_10002436 3300025914 Bacteria 19904
106 Ga0207660_10003819 3300025917 Bacteria 9817
107 Ga0207660_10003946 3300025917 Bacteria 9667
108 Ga0207660_10035304 3300025917 Bacteria 3471
109 Ga0207662_10087584 3300025918 Bacteria 1910
110 Ga0207657_10004480 3300025919 Bacteria 14767
111 Ga0207657_10010403 3300025919 Bacteria 9287
112 Ga0207657_10019082 3300025919 Bacteria 6524
113 Ga0207657_10050862 3300025919 Bacteria 3603
114 Ga0207657_10150083 3300025919 Bacteria 1899
115 Ga0207657_10202174 3300025919 Bacteria 1597
116 Ga0207657_10240510 3300025919 Bacteria 1445
117 Ga0207649_10000247 3300025920 Bacteria 43791
118 Ga0207649_10114557 3300025920 Bacteria 1807
119 Ga0207652_10000001 3300025921 Bacteria 1006643
120 Ga0207652_10000002 3300025921 Bacteria 878035
121 Ga0207652_10140794 3300025921 Bacteria 2157
122 Ga0207694_10002459 3300025924 Bacteria 15117
123 Ga0207659_10031541 3300025926 Bacteria 3629
124 Ga0207659_10303743 3300025926 Bacteria 1311
125 Ga0207664_10037781 3300025929 Bacteria 3740
126 Ga0207690_10000005 3300025932 Bacteria 581199
127 Ga0207690_10001534 3300025932 Bacteria 14447
128 Ga0207690_10009247 3300025932 Bacteria 5853
129 Ga0207690_10023352 3300025932 Bacteria 3858
130 Ga0207690_10032543 3300025932 Bacteria 3346
131 Ga0207706_10001464 3300025933 Bacteria 23592
132 Ga0207706_10148207 3300025933 Bacteria 2064
133 Ga0207669_10511238 3300025937 Bacteria 963
134 Ga0207689_10095290 3300025942 Bacteria 2444
135 Ga0207661_10037047 3300025944 Bacteria 3811
136 Ga0207661_10049843 3300025944 Bacteria 3335
137 Ga0207661_10250619 3300025944 Bacteria 1574
138 Ga0207667_10062619 3300025949 Bacteria 3889
139 Ga0207667_10192124 3300025949 Bacteria 2095
140 Ga0207640_10062801 3300025981 Bacteria 2466
141 Ga0207677_10000029 3300026023 Bacteria 121521
142 Ga0207639_10134076 3300026041 Bacteria 2054
143 Ga0207639_10444316 3300026041 Bacteria 1176
144 Ga0207678_10078417 3300026067 Bacteria 2829
145 Ga0207708_10097352 3300026075 Bacteria 2274
146 Ga0207702_10003270 3300026078 Bacteria 14958
147 Ga0207702_10004428 3300026078 Bacteria 12490
148 Ga0207702_10286730 3300026078 Bacteria 1558
149 Ga0207702_10443326 3300026078 Bacteria 1259
150 Ga0207641_10010047 3300026088 Bacteria 7784
151 Ga0207674_10114100 3300026116 Bacteria 2674
152 Ga0207674_10481165 3300026116 Bacteria 1200
153 Ga0207675_100540566 3300026118 Bacteria 1163
154 Ga0268266_10000083 3300028379 Bacteria 202393
155 Ga0307513_10185768 3300031456 Bacteria 1936
156 Ga0307408_100242791 3300031548 Bacteria 1481
157 Ga0307413_10125165 3300031824 Bacteria 1749
158 Ga0307413_10186230 3300031824 Bacteria 1486
159 Ga0307413_10298261 3300031824 Bacteria 1221
160 Ga0307412_10727097 3300031911 Bacteria 855
161 Ga0307409_100116104 3300031995 Bacteria 2255
162 Ga0307409_100381765 3300031995 Bacteria 1340
163 Ga0307411_10403502 3300032005 Bacteria 1131
164 Ga0307415_100253940 3300032126 Bacteria 1430
165 Ga0307415_100337136 3300032126 Bacteria 1264
166 Ga0373923_0037739 3300035111 Bacteria 1978
167 Ga0373954_0030922 3300035118 Bacteria 2470
168 Ga0373957_0093502 3300035120 Bacteria 1197
169 Ga0373962_0006774 3300035242 Unclassified 2784
170 Ga0373931_0035298 3300035691 Unclassified 2599
171 Ga0373933_0034212 3300035724 Bacteria 2960
172 Ga0373937_0005312 3300036401 Bacteria 11008
173 Ga0395900_0025405 3300037418 Bacteria 6064
174 Ga0395900_0036533 3300037418 Bacteria 5064
175 Ga0395900_0084451 3300037418 Bacteria 3262
176 Ga0395900_0140134 3300037418 Bacteria 2477
177 Ga0395900_0221823 3300037418 Bacteria 1905
178 Ga0395900_0509944 3300037418 Bacteria 1152
179 Ga0395898_0106532 3300037466 Bacteria 2688
180 Ga0395898_0114008 3300037466 Bacteria 2590
181 Ga0395905_0002782 3300037471 Bacteria 19152
182 Ga0395905_0213229 3300037471 Bacteria 1809
183 Ga0395905_0407284 3300037471 Bacteria 1255
184 Ga0395901_0008268 3300038443 Bacteria 10510
185 Ga0395901_0082169 3300038443 Bacteria 3366
186 Ga0395901_0326979 3300038443 Bacteria 1586
187 Ga0436365_0097396 3300039437 Bacteria 4248
188 Ga0436365_0687780 3300039437 Bacteria 92990
189 Ga0436365_0689373 3300039437 Bacteria 73333
190 Ga0436365_1127686 3300039437 Bacteria 20335
191 Ga0436363_0200595 3300039450 Bacteria 1109
192 Ga0436363_1455826 3300039450 Bacteria 1690
193 Ga0436362_0451893 3300039453 Bacteria 163419
194 Ga0466963_0025291 3300044694 Bacteria 3785
195 Ga0466963_0054434 3300044694 Bacteria 2659
196 Ga0466963_0161095 3300044694 Bacteria 1561
197 Ga0466963_0316651 3300044694 Bacteria 1098
198 Ga0466957_0007648 3300044842 Bacteria 6111
199 Ga0466957_0081079 3300044842 Bacteria 2021
200 Ga0451576_0000007 3300045051 Bacteria 782228
201 Ga0466958_0001114 3300045836 Bacteria 12379
202 Ga0466967_0015650 3300045976 Bacteria 5953
203 Ga0466967_0099998 3300045976 Bacteria 2649
204 Ga0495672_0000265 3300047320 Bacteria 72657
205 Ga0496102_0144883 3300048905 Bacteria 2229
206 Ga0496110_0422902 3300048913 Bacteria 1215
207 Ga0496111_0097058 3300048914 Bacteria 2163
208 Ga0496112_0111344 3300048915 Bacteria 2707
209 Ga0501070_0149229 3300049586 Bacteria 1929
210 Ga0501073_0154062 3300049589 Bacteria 1593
211 nmdc:mga08y16_663937_c1 3300050511 Bacteria 1045
212 nmdc:mga0n895_168334_c1 3300050512 Bacteria 2223
213 Ga0500592_000669 3300053116 Bacteria 5647
214 Ga0500573_0104164 3300053140 Bacteria 1594
215 Ga0070684_100344702
216 LJQas_1002321
217 JGI24736J21556_1000356
218 JGI24741J21665_1004667
219 JGI24741J21665_1013362
220 JGI24740J21852_10004247
221 JGI24740J21852_10008799
222 JGI24739J22299_10005653
223 JGI24737J22298_10021035
224 JGI24735J21928_10006097
225 JGI24735J21928_10010877
226 JGI24738J21930_10005101
227 Ga0065707_10156243
228 Ga0070658_10000013
229 Ga0070658_10013161
230 Ga0070658_10056331
231 Ga0070658_10217569
232 Ga0070683_100027182
233 Ga0070683_100069487
234 Ga0068869_100139940
235 Ga0070680_100023744
236 Ga0070682_100219147
237 Ga0070682_100430878
238 Ga0068868_100000042
239 Ga0070660_100000810
240 Ga0070660_100005009
241 Ga0070660_100007816
242 Ga0070660_100049579
243 Ga0070660_100205206
244 Ga0070660_100255410
245 Ga0070661_100000133
246 Ga0070661_100009967
247 Ga0070661_100340712
248 Ga0070692_10004981
249 Ga0070692_10109671
250 Ga0070675_100057564
251 Ga0070675_100086294
252 Ga0070659_100000011
253 Ga0070659_100001626
254 Ga0070659_100006181
255 Ga0070659_100024575
256 Ga0070659_100107238
257 Ga0070714_100186775
258 Ga0070663_100078562
259 Ga0070681_10078637
260 Ga0070679_100000002
261 Ga0070679_100076835
262 Ga0070679_100305569
263 Ga0070684_100061221
264 Ga0070684_100218485
265 Ga0068853_100057537
266 Ga0070686_100000284
267 Ga0070693_100080957
268 Ga0070665_100000089
269 Ga0068855_100235665
270 Ga0068855_100495945
271 Ga0068855_100787710
272 Ga0068857_100432235
273 Ga0068854_100032240
274 Ga0068854_100217966
275 Ga0068856_100079152
276 Ga0068856_100500718
277 Ga0068861_100420871
278 Ga0068863_100024013
279 Ga0111539_10300415
280 Ga0105245_10062001
281 Ga0157373_10077675
282 Ga0157373_10110675
283 Ga0157373_10342697
284 Ga0157371_10007758
285 Ga0157370_10028095
286 Ga0157370_10049597
287 Ga0157370_10186965
288 Ga0157369_10028118
289 Ga0157369_10061167
290 Ga0157369_10084644
291 Ga0157369_10159677
292 Ga0157369_10300930
293 Ga0157372_10096721
294 Ga0157375_10083267
295 Ga0157380_10000229
296 Ga0157380_10043579
297 Ga0157380_10423735
298 Ga0157380_10426055
299 Ga0206356_11780902
300 Ga0206354_10607483
301 Ga0206353_11089745
302 Ga0213873_10000007
303 Ga0213876_10000005
304 Ga0213876_10001457
305 Ga0213876_10003902
306 Ga0207656_10033959
307 Ga0207647_10007713
308 Ga0207645_10147599
309 Ga0207705_10000002
310 Ga0207705_10060664
311 Ga0207705_10249241
312 Ga0207705_10280034
313 Ga0207654_10029141
314 Ga0207707_10024490
315 Ga0207707_10047289
316 Ga0207707_10365572
317 Ga0207707_10503723
318 Ga0207695_10009458
319 Ga0207671_10002436
320 Ga0207660_10003819
321 Ga0207660_10003946
322 Ga0207660_10035304
323 Ga0207662_10087584
324 Ga0207657_10004480
325 Ga0207657_10010403
326 Ga0207657_10019082
327 Ga0207657_10050862
328 Ga0207657_10150083
329 Ga0207657_10202174
330 Ga0207657_10240510
331 Ga0207649_10000247
332 Ga0207649_10114557
333 Ga0207652_10000001
334 Ga0207652_10000002
335 Ga0207652_10140794
336 Ga0207694_10002459
337 Ga0207659_10031541
338 Ga0207659_10303743
339 Ga0207664_10037781
340 Ga0207690_10000005
341 Ga0207690_10001534
342 Ga0207690_10009247
343 Ga0207690_10023352
344 Ga0207690_10032543
345 Ga0207706_10001464
346 Ga0207706_10148207
347 Ga0207669_10511238
348 Ga0207689_10095290
349 Ga0207661_10037047
350 Ga0207661_10049843
351 Ga0207661_10250619
352 Ga0207667_10062619
353 Ga0207667_10192124
354 Ga0207640_10062801
355 Ga0207677_10000029
356 Ga0207639_10134076
357 Ga0207639_10444316
358 Ga0207678_10078417
359 Ga0207708_10097352
360 Ga0207702_10003270
361 Ga0207702_10004428
362 Ga0207702_10286730
363 Ga0207702_10443326
364 Ga0207641_10010047
365 Ga0207674_10114100
366 Ga0207674_10481165
367 Ga0207675_100540566
368 Ga0268266_10000083
369 Ga0307513_10185768
370 Ga0307408_100242791
371 Ga0307413_10125165
372 Ga0307413_10186230
373 Ga0307413_10298261
374 Ga0307412_10727097
375 Ga0307409_100116104
376 Ga0307409_100381765
377 Ga0307411_10403502
378 Ga0307415_100253940
379 Ga0307415_100337136
380 Ga0373923_0037739
381 Ga0373954_0030922
382 Ga0373957_0093502
383 Ga0373962_0006774
384 Ga0373931_0035298
385 Ga0373933_0034212
386 Ga0373937_0005312
387 Ga0395900_0025405
388 Ga0395900_0036533
389 Ga0395900_0084451
390 Ga0395900_0140134
391 Ga0395900_0221823
392 Ga0395900_0509944
393 Ga0395898_0106532
394 Ga0395898_0114008
395 Ga0395905_0002782
396 Ga0395905_0213229
397 Ga0395905_0407284
398 Ga0395901_0008268
399 Ga0395901_0082169
400 Ga0395901_0326979
401 Ga0436365_0097396
402 Ga0436365_0687780
403 Ga0436365_0689373
404 Ga0436365_1127686
405 Ga0436363_0200595
406 Ga0436363_1455826
407 Ga0436362_0451893
408 Ga0466963_0025291
409 Ga0466963_0054434
410 Ga0466963_0161095
411 Ga0466963_0316651
412 Ga0466957_0007648
413 Ga0466957_0081079
414 Ga0451576_0000007
415 Ga0466958_0001114
416 Ga0466967_0015650
417 Ga0466967_0099998
418 Ga0495672_0000265
419 Ga0496102_0144883
420 Ga0496110_0422902
421 Ga0496111_0097058
422 Ga0496112_0111344
423 Ga0501070_0149229
424 Ga0501073_0154062
425 nmdc:mga08y16_663937_c1
426 nmdc:mga0n895_168334_c1
427 Ga0500592_000669
428 Ga0500573_0104164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

216

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

276

0.9

PF08659

KR

KR domain

31

201

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t4x-assembly1.cif.gz_A short chain dehydrogenase/reductase family oxidoreductase from bacillus anthracis str. ames ancestor 0.8986 4 242
3lf1-assembly1.cif.gz_A apo structure of the short chain oxidoreductase q9hya2 from pseudomonas aeruginosa pao1 containing an atypical catalytic center 0.8941 3 244
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.8874 3 242
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.8846 1 242
3s55-assembly2.cif.gz_H crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to nad 0.8831 3 238
ID Description Score Start End Superfamily
af_Q9T0G0_32_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9006 2 172 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9001 4 170 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.895 78 175 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8916 2 70 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8901 3 183 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R7DP49-F1-model_v4 deleted 0.9373 3 245
AF-A0A353LQW1-F1-model_v4 Oxidoreductase 0.9318 7 245 GO:0016491
AF-A0A4Y6BA85-F1-model_v4 deleted 0.9286 1 245
AF-A0A2A4I094-F1-model_v4 Oxidoreductase 0.9284 1 245 GO:0016491
AF-A0A1C7D869-F1-model_v4 2-(S)-hydroxypropyl-CoM dehydrogenase (EC 1.1.1.269) 0.9265 2 245 GO:0050575

Map