F325044

General Info

Members Datasets Scaffolds Average Seq Length
214 138 429 194

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10000011|Ga0075365_1000001118
Length 231
Sequence VGGRPKRRVGRRPVTRLLGGNPEGQDPRESKSIFMDQAKQKQQQLDDLAADIVASNVCPALAATATNLVMGDGDPDADIVFVGEAPGKNEDEQGKPFVGAAGKFLNEMLEDIGLARKDVYITNTVKYRPPNNRDPLPEEKKAFLPYLKQQLAIIQPKLIVTLGKHGTETFLPGLKISQIHGQPKRLRGLVVLPLFHPAAALYNGGMRQTLMDDFRKIPRILELIAQKGSVK

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
76 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
77 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
90 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
129 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
130 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
136 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
137 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.18
Nodule 0
Rhizoplane 1.87
Rhizosphere 62.15
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10000011 3300006038 Bacteria 85296
2 rootH1_10003685 3300003316 Bacteria 49635
3 rootH1_10003685 3300003323 Bacteria 21096
4 rootH2_10004334 3300003320 Bacteria 85448
5 rootH2_10336671 3300003320 Bacteria 1462
6 rootH1_10331381 3300003323 Bacteria 3235
7 Ga0070670_100219269 3300005331 Unclassified 1655
8 Ga0070680_100204128 3300005336 Bacteria 1667
9 Ga0070692_10265687 3300005345 Bacteria 1033
10 Ga0070668_100063905 3300005347 Bacteria 2853
11 Ga0070668_100079164 3300005347 Unclassified 2573
12 Ga0070669_100101605 3300005353 Bacteria 2170
13 Ga0070671_100055080 3300005355 Bacteria 3308
14 Ga0070667_100013150 3300005367 Bacteria 6841
15 Ga0070714_100000277 3300005435 Bacteria 39221
16 Ga0070681_10140684 3300005458 Bacteria 2343
17 Ga0068867_100441704 3300005459 Bacteria 1106
18 Ga0070679_100000332 3300005530 Bacteria 40130
19 Ga0068853_100078273 3300005539 Bacteria 2889
20 Ga0068855_100000002 3300005563 Bacteria 616881
21 Ga0068855_100077524 3300005563 Bacteria 3856
22 Ga0068856_100000248 3300005614 Bacteria 58638
23 Ga0068856_100188677 3300005614 Bacteria 2075
24 Ga0068852_100000001 3300005616 Bacteria 716526
25 Ga0068859_100153979 3300005617 Bacteria 2375
26 Ga0068858_100012836 3300005842 Bacteria 7899
27 Ga0068858_100109820 3300005842 Bacteria 2575
28 Ga0068860_100012760 3300005843 Bacteria 8261
29 Ga0081539_10004105 3300005985 Bacteria 16612
30 Ga0075365_10000005 3300006038 Bacteria 125137
31 Ga0075365_10000007 3300006038 Bacteria 116889
32 Ga0075365_10008503 3300006038 Bacteria 5837
33 Ga0075365_10015037 3300006038 Bacteria 4671
34 Ga0075365_10552724 3300006038 Bacteria 814
35 Ga0075368_10000026 3300006042 Bacteria 35367
36 Ga0075368_10021293 3300006042 Bacteria 2462
37 Ga0075363_100001027 3300006048 Bacteria 10022
38 Ga0075363_100054245 3300006048 Bacteria 2144
39 Ga0075364_10001101 3300006051 Bacteria 14440
40 Ga0075364_10003788 3300006051 Bacteria 8650
41 Ga0075364_10077586 3300006051 Bacteria 2193
42 Ga0075367_10002390 3300006178 Bacteria 8555
43 Ga0075367_10094336 3300006178 Bacteria 1824
44 Ga0075369_10000632 3300006186 Bacteria 11170
45 Ga0075369_10048544 3300006186 Bacteria 1832
46 Ga0075369_10075573 3300006186 Unclassified 1488
47 Ga0075370_10008436 3300006353 Bacteria 5301
48 Ga0075370_10019022 3300006353 Bacteria 3732
49 Ga0097620_100153970 3300006931 Bacteria 2375
50 Ga0105240_10000030 3300009093 Bacteria 321312
51 Ga0105240_10024855 3300009093 Bacteria 7886
52 Ga0105240_10434052 3300009093 Bacteria 1473
53 Ga0105245_10192954 3300009098 Unclassified 1952
54 Ga0105247_10104320 3300009101 Bacteria 1816
55 Ga0105243_10026379 3300009148 Bacteria 4447
56 Ga0105241_10078141 3300009174 Bacteria 2585
57 Ga0105248_10022205 3300009177 Bacteria 7036
58 Ga0105248_10153555 3300009177 Bacteria 2597
59 Ga0105237_10000001 3300009545 Bacteria 1009213
60 Ga0105237_10000159 3300009545 Bacteria 95980
61 Ga0105237_10899145 3300009545 Unclassified 892
62 Ga0105238_10001607 3300009551 Bacteria 22640
63 Ga0105238_10326934 3300009551 Unclassified 1520
64 Ga0105032_100009 3300009979 Bacteria 86569
65 Ga0105028_100242 3300009993 Bacteria 5958
66 Ga0105239_10000481 3300010375 Bacteria 58265
67 Ga0157371_10000207 3300013102 Bacteria 86226
68 Ga0157371_10070095 3300013102 Bacteria 2482
69 Ga0157370_10000232 3300013104 Bacteria 71177
70 Ga0157370_10021155 3300013104 Bacteria 6487
71 Ga0157370_10226107 3300013104 Bacteria 1732
72 Ga0157369_10000003 3300013105 Bacteria 507337
73 Ga0157369_10069603 3300013105 Unclassified 3780
74 Ga0157374_10925614 3300013296 Bacteria 890
75 Ga0157372_10000007 3300013307 Bacteria 340690
76 Ga0163163_10131508 3300014325 Bacteria 2543
77 Ga0207710_10166333 3300025900 Bacteria 1076
78 Ga0207654_10168484 3300025911 Bacteria 1420
79 Ga0207695_10000009 3300025913 Bacteria 1034276
80 Ga0207695_10001780 3300025913 Bacteria 34020
81 Ga0207695_10010358 3300025913 Bacteria 11409
82 Ga0207695_10502844 3300025913 Bacteria 1094
83 Ga0207671_10000003 3300025914 Bacteria 1065461
84 Ga0207671_10000008 3300025914 Bacteria 798229
85 Ga0207660_10053984 3300025917 Bacteria 2866
86 Ga0207660_10281928 3300025917 Bacteria 1319
87 Ga0207657_10000547 3300025919 Bacteria 40133
88 Ga0207681_10250945 3300025923 Bacteria 1381
89 Ga0207694_10003006 3300025924 Bacteria 13529
90 Ga0207687_10090650 3300025927 Unclassified 2228
91 Ga0207664_10000812 3300025929 Bacteria 21191
92 Ga0207644_10040017 3300025931 Bacteria 3311
93 Ga0207690_10362136 3300025932 Bacteria 1149
94 Ga0207667_10000005 3300025949 Bacteria 715503
95 Ga0207667_10063483 3300025949 Bacteria 3859
96 Ga0207668_10095437 3300025972 Unclassified 2195
97 Ga0207658_10011472 3300025986 Bacteria 6031
98 Ga0207677_10165343 3300026023 Bacteria 1724
99 Ga0207703_10008920 3300026035 Bacteria 7899
100 Ga0207703_10672499 3300026035 Bacteria 983
101 Ga0207639_10187634 3300026041 Bacteria 1764
102 Ga0207702_10000181 3300026078 Bacteria 75992
103 Ga0207702_10024889 3300026078 Bacteria 4967
104 Ga0207702_10834417 3300026078 Unclassified 912
105 Ga0207641_10069416 3300026088 Bacteria 3025
106 Ga0207648_10179691 3300026089 Bacteria 1873
107 Ga0207648_10210529 3300026089 Bacteria 1726
108 Ga0207674_10023745 3300026116 Bacteria 6562
109 Ga0207698_10000001 3300026142 Bacteria 625389
110 Ga0209813_10000003 3300027866 Bacteria 207060
111 Ga0209813_10018171 3300027866 Bacteria 1939
112 Ga0209974_10000448 3300027876 Bacteria 13666
113 Ga0268264_10037657 3300028381 Bacteria 3988
114 Ga0265338_10040327 3300028800 Bacteria 4388
115 Ga0265338_10078934 3300028800 Unclassified 2773
116 Ga0316180_1179590 3300030736 Bacteria 5947
117 Ga0316183_1065354 3300030742 Bacteria 25518
118 Ga0316183_1078101 3300030742 Bacteria 6501
119 Ga0316183_1128004 3300030742 Bacteria 15421
120 Ga0316181_1123581 3300030744 Bacteria 76132
121 Ga0316182_1006672 3300030745 Bacteria 11372
122 Ga0316182_1062290 3300030745 Bacteria 23471
123 Ga0316182_1150634 3300030745 Bacteria 3286
124 Ga0316182_1188782 3300030745 Bacteria 15742
125 Ga0265327_10000260 3300031251 Bacteria 104663
126 Ga0265327_10004259 3300031251 Bacteria 12826
127 Ga0307516_10001926 3300031730 Bacteria 28435
128 Ga0307405_10043254 3300031731 Bacteria 2747
129 Ga0373959_0000080 3300034820 Bacteria 21114
130 Ga0395899_0401177 3300037312 Unclassified 907
131 Ga0395900_0000001 3300037418 Bacteria 931146
132 Ga0395898_0000002 3300037466 Bacteria 931013
133 Ga0395901_0000006 3300038443 Bacteria 514112
134 Ga0395901_0012352 3300038443 Bacteria 8664
135 Ga0439461_0000020 3300041410 Bacteria 20574
136 Ga0451807_1437275 3300041486 Bacteria 2139
137 Ga0450903_014278 3300042138 Unclassified 1257
138 Ga0450918_003503 3300042531 Bacteria 2913
139 Ga0450918_030944 3300042531 Bacteria 945
140 Ga0451577_0030391 3300042876 Bacteria 4882
141 Ga0453684_0000042 3300044712 Bacteria 682980
142 Ga0453684_0034626 3300044712 Bacteria 7005
143 Ga0451576_0090342 3300045051 Bacteria 3186
144 Ga0495671_0059558 3300046692 Bacteria 1887
145 Ga0495660_0000114 3300046810 Bacteria 86218
146 Ga0495672_0216063 3300047320 Bacteria 949
147 Ga0496105_0391640 3300048908 Unclassified 1104
148 Ga0496109_0132195 3300048912 Bacteria 2330
149 Ga0496115_0000001 3300048918 Bacteria 367230
150 Ga0496124_0025707 3300048927 Bacteria 5326
151 Ga0501034_0000187 3300049571 Bacteria 116046
152 Ga0501034_0001064 3300049571 Bacteria 38926
153 Ga0501036_0020651 3300049572 Bacteria 5532
154 Ga0501037_0051176 3300049573 Bacteria 3021
155 Ga0501040_0477932 3300049576 Bacteria 898
156 Ga0501047_0000024 3300049581 Bacteria 230397
157 Ga0501048_0002392 3300049582 Bacteria 14332
158 Ga0501070_0068589 3300049586 Bacteria 2936
159 Ga0501070_0153093 3300049586 Bacteria 1902
160 Ga0501080_0419136 3300049742 Bacteria 1203
161 Ga0501083_0006549 3300049744 Bacteria 8263
162 Ga0501035_0000005 3300049822 Bacteria 392980
163 Ga0501044_0010432 3300049823 Bacteria 10083
164 Ga0501044_0347009 3300049823 Bacteria 1405
165 nmdc:mga03n38_49_c1 3300050490 Bacteria 25851
166 nmdc:mga00v17_37476_c1 3300050491 Unclassified 2896
167 nmdc:mga00v17_7235_c1 3300050491 Bacteria 5914
168 nmdc:mga00v17_96_c1 3300050491 Bacteria 52369
169 nmdc:mga0yw44_114_c1 3300050492 Bacteria 28261
170 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
171 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
172 nmdc:mga0yw44_512720_c1 3300050492 Bacteria 814
173 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
174 nmdc:mga0yw44_611510_c1 3300050492 Unclassified 740
175 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
176 nmdc:mga0k408_54_c1 3300050493 Bacteria 57640
177 nmdc:mga06z11_1428_c1 3300050494 Bacteria 8882
178 nmdc:mga06z11_92_c1 3300050494 Bacteria 38165
179 nmdc:mga04h51_12480_c1 3300050495 Bacteria 2386
180 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
181 nmdc:mga07m45_1342_c2 3300050496 Bacteria 10327
182 nmdc:mga07m45_39830_c1 3300050496 Bacteria 2628
183 nmdc:mga07m45_78851_c1 3300050496 Bacteria 1880
184 nmdc:mga0sz30_2823_c1 3300050516 Bacteria 6205
185 nmdc:mga0sz30_30227_c1 3300050516 Bacteria 2237
186 nmdc:mga0sz30_41585_c1 3300050516 Unclassified 1452
187 nmdc:mga0sz30_54875_c1 3300050516 Bacteria 1695
188 Ga0500643_000009 3300053087 Bacteria 444150
189 Ga0500643_013218 3300053087 Unclassified 2924
190 Ga0500643_031554 3300053087 Bacteria 1614
191 Ga0500583_0000311 3300053092 Bacteria 16660
192 Ga0500583_0004674 3300053092 Bacteria 4494
193 Ga0500583_0138182 3300053092 Unclassified 1210
194 Ga0500651_0000235 3300053093 Bacteria 34448
195 Ga0500641_0000001 3300053096 Bacteria 1115973
196 Ga0500650_0058751 3300053098 Bacteria 1794
197 Ga0500650_0089228 3300053098 Bacteria 1443
198 Ga0500555_000045 3300053103 Bacteria 63148
199 Ga0500569_000002 3300053109 Bacteria 127605
200 Ga0500593_000001 3300053117 Bacteria 784404
201 Ga0500614_002554 3300053123 Bacteria 4033
202 Ga0500652_000001 3300053131 Bacteria 946868
203 Ga0500655_000340 3300053133 Bacteria 10261
204 Ga0500568_0044165 3300053139 Bacteria 1778
205 Ga0500577_0000892 3300053142 Bacteria 7716
206 Ga0500588_0000459 3300053146 Bacteria 6447
207 Ga0500616_0000005 3300053153 Bacteria 961725
208 Ga0500616_0000067 3300053153 Bacteria 236311
209 Ga0500616_0027081 3300053153 Bacteria 3168
210 Ga0500616_0081536 3300053153 Bacteria 1625
211 Ga0500620_100697 3300053155 Unclassified 1011
212 Ga0500570_000001 3300053724 Bacteria 243552
213 Ga0500570_106719 3300053724 Bacteria 1154
214 Ga0587085_010716 3300059506 Bacteria 1223
215 Ga0587094_000554 3300059513 Bacteria 3008
216 Ga0075365_10000011
217 rootH1_10003685
218 rootH2_10004334
219 rootH2_10336671
220 rootH1_10331381
221 Ga0070670_100219269
222 Ga0070680_100204128
223 Ga0070692_10265687
224 Ga0070668_100063905
225 Ga0070668_100079164
226 Ga0070669_100101605
227 Ga0070671_100055080
228 Ga0070667_100013150
229 Ga0070714_100000277
230 Ga0070681_10140684
231 Ga0068867_100441704
232 Ga0070679_100000332
233 Ga0068853_100078273
234 Ga0068855_100000002
235 Ga0068855_100077524
236 Ga0068856_100000248
237 Ga0068856_100188677
238 Ga0068852_100000001
239 Ga0068859_100153979
240 Ga0068858_100012836
241 Ga0068858_100109820
242 Ga0068860_100012760
243 Ga0081539_10004105
244 Ga0075365_10000005
245 Ga0075365_10000007
246 Ga0075365_10008503
247 Ga0075365_10015037
248 Ga0075365_10552724
249 Ga0075368_10000026
250 Ga0075368_10021293
251 Ga0075363_100001027
252 Ga0075363_100054245
253 Ga0075364_10001101
254 Ga0075364_10003788
255 Ga0075364_10077586
256 Ga0075367_10002390
257 Ga0075367_10094336
258 Ga0075369_10000632
259 Ga0075369_10048544
260 Ga0075369_10075573
261 Ga0075370_10008436
262 Ga0075370_10019022
263 Ga0097620_100153970
264 Ga0105240_10000030
265 Ga0105240_10024855
266 Ga0105240_10434052
267 Ga0105245_10192954
268 Ga0105247_10104320
269 Ga0105243_10026379
270 Ga0105241_10078141
271 Ga0105248_10022205
272 Ga0105248_10153555
273 Ga0105237_10000001
274 Ga0105237_10000159
275 Ga0105237_10899145
276 Ga0105238_10001607
277 Ga0105238_10326934
278 Ga0105032_100009
279 Ga0105028_100242
280 Ga0105239_10000481
281 Ga0157371_10000207
282 Ga0157371_10070095
283 Ga0157370_10000232
284 Ga0157370_10021155
285 Ga0157370_10226107
286 Ga0157369_10000003
287 Ga0157369_10069603
288 Ga0157374_10925614
289 Ga0157372_10000007
290 Ga0163163_10131508
291 Ga0207710_10166333
292 Ga0207654_10168484
293 Ga0207695_10000009
294 Ga0207695_10001780
295 Ga0207695_10010358
296 Ga0207695_10502844
297 Ga0207671_10000003
298 Ga0207671_10000008
299 Ga0207660_10053984
300 Ga0207660_10281928
301 Ga0207657_10000547
302 Ga0207681_10250945
303 Ga0207694_10003006
304 Ga0207687_10090650
305 Ga0207664_10000812
306 Ga0207644_10040017
307 Ga0207690_10362136
308 Ga0207667_10000005
309 Ga0207667_10063483
310 Ga0207668_10095437
311 Ga0207658_10011472
312 Ga0207677_10165343
313 Ga0207703_10008920
314 Ga0207703_10672499
315 Ga0207639_10187634
316 Ga0207702_10000181
317 Ga0207702_10024889
318 Ga0207702_10834417
319 Ga0207641_10069416
320 Ga0207648_10179691
321 Ga0207648_10210529
322 Ga0207674_10023745
323 Ga0207698_10000001
324 Ga0209813_10000003
325 Ga0209813_10018171
326 Ga0209974_10000448
327 Ga0268264_10037657
328 Ga0265338_10040327
329 Ga0265338_10078934
330 Ga0316180_1179590
331 Ga0316183_1065354
332 Ga0316183_1078101
333 Ga0316183_1128004
334 Ga0316181_1123581
335 Ga0316182_1006672
336 Ga0316182_1062290
337 Ga0316182_1150634
338 Ga0316182_1188782
339 Ga0265327_10000260
340 Ga0265327_10004259
341 Ga0307516_10001926
342 Ga0307405_10043254
343 Ga0373959_0000080
344 Ga0395899_0401177
345 Ga0395900_0000001
346 Ga0395898_0000002
347 Ga0395901_0000006
348 Ga0395901_0012352
349 Ga0439461_0000020
350 Ga0451807_1437275
351 Ga0450903_014278
352 Ga0450918_003503
353 Ga0450918_030944
354 Ga0451577_0030391
355 Ga0453684_0000042
356 Ga0453684_0034626
357 Ga0451576_0090342
358 Ga0495671_0059558
359 Ga0495660_0000114
360 Ga0495672_0216063
361 Ga0496105_0391640
362 Ga0496109_0132195
363 Ga0496115_0000001
364 Ga0496124_0025707
365 Ga0501034_0000187
366 Ga0501034_0001064
367 Ga0501036_0020651
368 Ga0501037_0051176
369 Ga0501040_0477932
370 Ga0501047_0000024
371 Ga0501048_0002392
372 Ga0501070_0068589
373 Ga0501070_0153093
374 Ga0501080_0419136
375 Ga0501083_0006549
376 Ga0501035_0000005
377 Ga0501044_0010432
378 Ga0501044_0347009
379 nmdc:mga03n38_49_c1
380 nmdc:mga00v17_37476_c1
381 nmdc:mga00v17_7235_c1
382 nmdc:mga00v17_96_c1
383 nmdc:mga0yw44_114_c1
384 nmdc:mga0yw44_11_c1
385 nmdc:mga0yw44_3_c1
386 nmdc:mga0yw44_512720_c1
387 nmdc:mga0yw44_5_c1
388 nmdc:mga0yw44_611510_c1
389 nmdc:mga0yw44_7_c1
390 nmdc:mga0k408_54_c1
391 nmdc:mga06z11_1428_c1
392 nmdc:mga06z11_92_c1
393 nmdc:mga04h51_12480_c1
394 nmdc:mga04h51_3_c1
395 nmdc:mga07m45_1342_c2
396 nmdc:mga07m45_39830_c1
397 nmdc:mga07m45_78851_c1
398 nmdc:mga0sz30_2823_c1
399 nmdc:mga0sz30_30227_c1
400 nmdc:mga0sz30_41585_c1
401 nmdc:mga0sz30_54875_c1
402 Ga0500643_000009
403 Ga0500643_013218
404 Ga0500643_031554
405 Ga0500583_0000311
406 Ga0500583_0004674
407 Ga0500583_0138182
408 Ga0500651_0000235
409 Ga0500641_0000001
410 Ga0500650_0058751
411 Ga0500650_0089228
412 Ga0500555_000045
413 Ga0500569_000002
414 Ga0500593_000001
415 Ga0500614_002554
416 Ga0500652_000001
417 Ga0500655_000340
418 Ga0500568_0044165
419 Ga0500577_0000892
420 Ga0500588_0000459
421 Ga0500616_0000005
422 Ga0500616_0000067
423 Ga0500616_0027081
424 Ga0500616_0081536
425 Ga0500620_100697
426 Ga0500570_000001
427 Ga0500570_106719
428 Ga0587085_010716
429 Ga0587094_000554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

70

217

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iig-assembly1.cif.gz_A complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a 0.9415 27 187
6ajo-assembly1.cif.gz_A complex form of uracil dna glycosylase x and uracil-dna. 0.9331 12 187
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.9272 12 195
8iiq-assembly1.cif.gz_A msmudgx h109s/e52n double mutant 0.9254 28 185
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.92 28 187
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9271 12 195 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9211 12 195 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8854 12 195 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8796 12 195 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8002 39 194 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3C7Z768-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9888 6 163 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A2G6C4R2-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9863 8 194 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A258GH73-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9854 5 193 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A1F4ZAG9-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9831 31 188 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A3C7Z768-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9826 6 163 GO:0004844
GO:0006281
GO:0046872
GO:0051539

Map