F325334

General Info

Members Datasets Scaffolds Average Seq Length
214 131 428 454

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10001997|Ga0307515_1000199736
Length 485
Sequence MLCLHSFLPGVLYRYIKFQETYMQIITRSVFILMALLISLNTFAQQNIKPIGLKALLSQVNANAPALITDSAAIGIRQAQAAETRSNWLPNLKLNYQADIGTNNNVAGPYFGFGIIPSDSRGVRTQSNTTAVSANVGVAALDWEVYNFGAYDAQNKVANSDIRVQQSQFANSKYQLQAYAIGNYLLLMRLQNFLDIQSRNIQRNVEIRRSVQSLAKSGVRAGVDTSIAEAELSKARLNYIELANQVKQVQLQLSAVSGLPYQSIVPDTAAETALIDQPAALQPIEQDTVNHPIINYYRSVYQNSLQRENLVKKSYNPKIMLEGAVWGRGSSVDANDHFNSLSTGWGFDRNNYLVGVGISYNLFDLRRKQLKLRTQKAETSYNARKLQEQKQMLAVNANQADVELETARQRLQEIPHQLRAANDGYRQKLSLYKNGLTDIIELNAALNILYRAETDFAQAKYSYSSALFQKAVTDNQVNAVLNLLK

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
117 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
120 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
121 2738541283 Pedobacter sp. OK701 Isolate Unclassified
122 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
123 2818991444 Filimonas endophytica 3197 Isolate Unclassified
124 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
125 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
126 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
127 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
128 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
129 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
130 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
131 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0
Isolates 5.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 0.47
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10001997 3300028794 Bacteria 45190
2 JGI24740J21852_10013928 3300001979 Bacteria 2982
3 JGI24737J22298_10003557 3300001990 Bacteria 5493
4 JGI24737J22298_10013459 3300001990 Bacteria 2662
5 JGI24735J21928_10000005 3300002067 Bacteria 356755
6 JGI25162J39368_1000008 3300002737 Bacteria 397212
7 JGI25162J39368_1001031 3300002737 Bacteria 17224
8 JGI25157J39369_1002587 3300002741 Bacteria 4312
9 JGI25165J46597_1000869 3300003214 Bacteria 21479
10 rootH1_10074478 3300003316 Bacteria 4231
11 rootH2_10002814 3300003320 Bacteria 49344
12 rootH2_10022503 3300003320 Bacteria 3548
13 rootH2_10044515 3300003320 Bacteria 11301
14 rootH1_10003212 3300003323 Bacteria 182359
15 rootH1_10087397 3300003323 Bacteria 3868
16 rootH1_10103532 3300003323 Bacteria 1524
17 Ga0055536_1000001 3300003781 Bacteria 630663
18 Ga0070658_10000011 3300005327 Bacteria 294396
19 Ga0070676_10003202 3300005328 Bacteria 8487
20 Ga0070683_100012824 3300005329 Bacteria 7294
21 Ga0070660_100008880 3300005339 Bacteria 7048
22 Ga0070673_100022762 3300005364 Bacteria 4566
23 Ga0070659_100000016 3300005366 Bacteria 169522
24 Ga0070678_100007302 3300005456 Bacteria 6545
25 Ga0070662_100000032 3300005457 Bacteria 78824
26 Ga0070681_10008778 3300005458 Bacteria 9921
27 Ga0070679_100082294 3300005530 Bacteria 3209
28 Ga0070684_100120506 3300005535 Bacteria 2360
29 Ga0068853_100047010 3300005539 Bacteria 3703
30 Ga0070665_100000003 3300005548 Bacteria 811857
31 Ga0068855_100000226 3300005563 Bacteria 72130
32 Ga0068855_100005580 3300005563 Bacteria 15354
33 Ga0068855_100009512 3300005563 Bacteria 11738
34 Ga0068855_100025360 3300005563 Bacteria 7095
35 Ga0068855_100113699 3300005563 Bacteria 3105
36 Ga0068855_100382855 3300005563 Bacteria 1544
37 Ga0068856_100000262 3300005614 Bacteria 57470
38 Ga0068856_100017009 3300005614 Bacteria 7048
39 Ga0068856_100069380 3300005614 Bacteria 3485
40 Ga0068852_100006795 3300005616 Bacteria 8304
41 Ga0068858_100019093 3300005842 Bacteria 6412
42 Ga0097621_100000827 3300006237 Bacteria 21866
43 Ga0097621_100084574 3300006237 Bacteria 2645
44 Ga0068871_100001149 3300006358 Bacteria 17749
45 Ga0068865_100000574 3300006881 Bacteria 20568
46 Ga0105240_10000294 3300009093 Bacteria 97108
47 Ga0105240_10058999 3300009093 Bacteria 4790
48 Ga0105240_10080032 3300009093 Bacteria 4019
49 Ga0105240_10085008 3300009093 Bacteria 3878
50 Ga0105240_10087953 3300009093 Bacteria 3803
51 Ga0105240_10114637 3300009093 Bacteria 3255
52 Ga0105241_10000398 3300009174 Bacteria 32826
53 Ga0105241_10024255 3300009174 Bacteria 4504
54 Ga0105241_10032645 3300009174 Bacteria 3905
55 Ga0105242_10020317 3300009176 Bacteria 5207
56 Ga0105237_10000109 3300009545 Bacteria 115699
57 Ga0105237_10001914 3300009545 Bacteria 26581
58 Ga0105237_10003009 3300009545 Bacteria 20347
59 Ga0105237_10006380 3300009545 Bacteria 13087
60 Ga0105237_10010022 3300009545 Bacteria 10112
61 Ga0105237_10056039 3300009545 Bacteria 3947
62 Ga0105238_10025080 3300009551 Bacteria 6077
63 Ga0105239_10000013 3300010375 Bacteria 327371
64 Ga0105239_10000068 3300010375 Bacteria 144666
65 Ga0105239_10000162 3300010375 Bacteria 95804
66 Ga0105239_10002839 3300010375 Bacteria 21676
67 Ga0105239_10017010 3300010375 Bacteria 8040
68 Ga0105239_10045225 3300010375 Bacteria 4825
69 Ga0105239_10051698 3300010375 Bacteria 4504
70 Ga0105239_10096725 3300010375 Bacteria 3262
71 Ga0157373_10000087 3300013100 Bacteria 80308
72 Ga0157373_10004610 3300013100 Bacteria 10368
73 Ga0157373_10063754 3300013100 Bacteria 2609
74 Ga0157371_10000155 3300013102 Bacteria 100230
75 Ga0157371_10015316 3300013102 Bacteria 5758
76 Ga0157371_10059525 3300013102 Bacteria 2708
77 Ga0157370_10002867 3300013104 Bacteria 20568
78 Ga0157370_10005261 3300013104 Bacteria 14556
79 Ga0157370_10016508 3300013104 Bacteria 7471
80 Ga0157370_10238890 3300013104 Bacteria 1681
81 Ga0157369_10002036 3300013105 Bacteria 24366
82 Ga0157369_10042719 3300013105 Bacteria 4944
83 Ga0157369_10053743 3300013105 Bacteria 4351
84 Ga0157374_10001012 3300013296 Bacteria 24372
85 Ga0157374_10002228 3300013296 Bacteria 16336
86 Ga0157374_10020201 3300013296 Bacteria 5907
87 Ga0163162_10000031 3300013306 Bacteria 157666
88 Ga0163162_10006055 3300013306 Bacteria 11707
89 Ga0157372_10000400 3300013307 Bacteria 47864
90 Ga0157372_10000874 3300013307 Bacteria 32723
91 Ga0157372_10002085 3300013307 Bacteria 21727
92 Ga0157372_10003009 3300013307 Bacteria 18174
93 Ga0157372_10073688 3300013307 Bacteria 3849
94 Ga0157375_10082580 3300013308 Bacteria 3255
95 Ga0182008_10000565 3300014497 Bacteria 27364
96 Ga0182006_1000168 3300015261 Bacteria 69340
97 Ga0182006_1001374 3300015261 Bacteria 14812
98 Ga0182005_1000290 3300015265 Bacteria 31414
99 Ga0163161_10018532 3300017792 Bacteria 4877
100 Ga0207427_100085 3300025231 Bacteria 142561
101 Ga0209437_100030 3300025233 Bacteria 532466
102 Ga0209437_100052 3300025233 Bacteria 380548
103 Ga0209026_1000840 3300025250 Bacteria 16216
104 Ga0209026_1005609 3300025250 Bacteria 3318
105 Ga0209233_1000067 3300025261 Bacteria 380554
106 Ga0209233_1000495 3300025261 Bacteria 23831
107 Ga0209233_1005605 3300025261 Bacteria 4152
108 Ga0209455_1011257 3300025272 Bacteria 2214
109 Ga0209676_1000008 3300025292 Bacteria 991778
110 Ga0209050_1000045 3300025298 Bacteria 388022
111 Ga0207426_1016190 3300025302 Bacteria 2685
112 Ga0207647_10000207 3300025904 Bacteria 48256
113 Ga0207647_10000948 3300025904 Bacteria 22427
114 Ga0207645_10000082 3300025907 Bacteria 68372
115 Ga0207705_10000015 3300025909 Bacteria 382901
116 Ga0207654_10003575 3300025911 Bacteria 7858
117 Ga0207654_10018119 3300025911 Bacteria 3691
118 Ga0207707_10023588 3300025912 Bacteria 5381
119 Ga0207695_10000142 3300025913 Bacteria 214715
120 Ga0207695_10004328 3300025913 Bacteria 19447
121 Ga0207695_10030109 3300025913 Bacteria 5981
122 Ga0207695_10137776 3300025913 Bacteria 2392
123 Ga0207671_10000110 3300025914 Bacteria 126480
124 Ga0207671_10005361 3300025914 Bacteria 11857
125 Ga0207671_10012941 3300025914 Bacteria 6677
126 Ga0207671_10052693 3300025914 Bacteria 3015
127 Ga0207660_10014223 3300025917 Bacteria 5227
128 Ga0207657_10021261 3300025919 Bacteria 6112
129 Ga0207652_10175749 3300025921 Bacteria 1923
130 Ga0207694_10097980 3300025924 Bacteria 2321
131 Ga0207690_10000495 3300025932 Bacteria 25433
132 Ga0207690_10014207 3300025932 Bacteria 4805
133 Ga0207690_10063873 3300025932 Bacteria 2512
134 Ga0207706_10000191 3300025933 Bacteria 68535
135 Ga0207704_10000053 3300025938 Bacteria 79904
136 Ga0207667_10000039 3300025949 Bacteria 278843
137 Ga0207667_10000896 3300025949 Bacteria 37967
138 Ga0207667_10006347 3300025949 Bacteria 14333
139 Ga0207667_10009992 3300025949 Bacteria 11130
140 Ga0207667_10042272 3300025949 Bacteria 4846
141 Ga0207651_10003179 3300025960 Bacteria 8017
142 Ga0207677_10066941 3300026023 Bacteria 2514
143 Ga0207703_10026721 3300026035 Bacteria 4546
144 Ga0207639_10031156 3300026041 Bacteria 3918
145 Ga0207639_10052007 3300026041 Bacteria 3119
146 Ga0207702_10000492 3300026078 Bacteria 44456
147 Ga0207702_10021697 3300026078 Bacteria 5317
148 Ga0207648_10009920 3300026089 Bacteria 9079
149 Ga0207683_10015163 3300026121 Bacteria 6558
150 Ga0207698_10003515 3300026142 Bacteria 9450
151 Ga0268266_10000052 3300028379 Bacteria 296230
152 Ga0307517_10007927 3300028786 Bacteria 15349
153 Ga0265338_10113214 3300028800 Bacteria 2180
154 Ga0265327_10000285 3300031251 Bacteria 99746
155 Ga0307510_10021552 3300033180 Bacteria 7508
156 Ga0395899_0000017 3300037312 Bacteria 440179
157 Ga0395899_0000055 3300037312 Bacteria 220579
158 Ga0395899_0000312 3300037312 Bacteria 62304
159 Ga0395900_0000014 3300037418 Bacteria 386513
160 Ga0395900_0000128 3300037418 Bacteria 127446
161 Ga0395900_0007404 3300037418 Bacteria 11346
162 Ga0395898_0022234 3300037466 Bacteria 6426
163 Ga0395905_0000037 3300037471 Bacteria 261808
164 Ga0395905_0002800 3300037471 Bacteria 19106
165 Ga0395901_0000166 3300038443 Bacteria 86352
166 Ga0395901_0054083 3300038443 Bacteria 4172
167 Ga0439448_0007477 3300042005 Bacteria 3170
168 Ga0466966_0024424 3300044684 Bacteria 3952
169 Ga0495650_0000050 3300046471 Bacteria 318894
170 Ga0495585_0000198 3300046492 Bacteria 62640
171 Ga0495585_0000553 3300046492 Bacteria 35342
172 Ga0495583_0022419 3300046506 Bacteria 3222
173 Ga0495610_0001134 3300046512 Bacteria 24228
174 Ga0495616_0001519 3300046513 Bacteria 15997
175 Ga0495616_0003999 3300046513 Bacteria 9373
176 Ga0495631_0012131 3300046518 Bacteria 4219
177 Ga0495637_0063232 3300046520 Bacteria 1513
178 Ga0495648_0007640 3300046524 Bacteria 8622
179 Ga0495609_0011754 3300046538 Bacteria 4163
180 Ga0495633_0009063 3300046558 Bacteria 5533
181 Ga0495668_0000032 3300046616 Bacteria 254951
182 Ga0495625_0000105 3300046660 Bacteria 126078
183 Ga0495625_0001038 3300046660 Bacteria 36510
184 Ga0495625_0008344 3300046660 Bacteria 8844
185 Ga0495625_0037377 3300046660 Bacteria 3563
186 Ga0495661_0011911 3300046665 Bacteria 5887
187 Ga0495649_0000011 3300046694 Bacteria 416695
188 Ga0495687_000552 3300047443 Bacteria 44401
189 Ga0495686_0000098 3300047472 Bacteria 183131
190 Ga0495686_0001801 3300047472 Bacteria 21688
191 Ga0495686_0015155 3300047472 Bacteria 5279
192 Ga0496121_0000011 3300048924 Bacteria 792193
193 Ga0496122_0001708 3300048925 Bacteria 34038
194 Ga0496123_0004392 3300048926 Bacteria 14872
195 Ga0496124_0020191 3300048927 Bacteria 6167
196 Ga0495678_005407 3300049459 Bacteria 7057
197 Ga0501034_0059705 3300049571 Bacteria 3830
198 Ga0501047_0118608 3300049581 Unclassified 2528
199 Ga0500608_001643 3300053122 Bacteria 8034
200 Ga0500618_000037 3300053125 Bacteria 117320
201 Ga0500559_0069347 3300053136 Bacteria 1585
202 Ga0500624_000530 3300053157 Bacteria 10893
203 2599480004 2599185184 Bacteria 6430550
204 2738756300 2738541283 Bacteria 7222293
205 2819576196 2818991442 Bacteria 8318214
206 2819587310 2818991444 Bacteria 6968812
207 2821142423 2821136567 Bacteria 8080116
208 2857632637 2857627736 Bacteria 5625397
209 2904470410 2904467357 Bacteria 8057758
210 2919439864 2919437846 Bacteria 6199444
211 2928081135 2928078545 Bacteria 6534839
212 2928152444 2928147474 Bacteria 6512076
213 2932087785 2932082852 Bacteria 6563563
214 2977236600 2977232053 Bacteria 5485925
215 Ga0307515_10001997
216 JGI24740J21852_10013928
217 JGI24737J22298_10003557
218 JGI24737J22298_10013459
219 JGI24735J21928_10000005
220 JGI25162J39368_1000008
221 JGI25162J39368_1001031
222 JGI25157J39369_1002587
223 JGI25165J46597_1000869
224 rootH1_10074478
225 rootH2_10002814
226 rootH2_10022503
227 rootH2_10044515
228 rootH1_10003212
229 rootH1_10087397
230 rootH1_10103532
231 Ga0055536_1000001
232 Ga0070658_10000011
233 Ga0070676_10003202
234 Ga0070683_100012824
235 Ga0070660_100008880
236 Ga0070673_100022762
237 Ga0070659_100000016
238 Ga0070678_100007302
239 Ga0070662_100000032
240 Ga0070681_10008778
241 Ga0070679_100082294
242 Ga0070684_100120506
243 Ga0068853_100047010
244 Ga0070665_100000003
245 Ga0068855_100000226
246 Ga0068855_100005580
247 Ga0068855_100009512
248 Ga0068855_100025360
249 Ga0068855_100113699
250 Ga0068855_100382855
251 Ga0068856_100000262
252 Ga0068856_100017009
253 Ga0068856_100069380
254 Ga0068852_100006795
255 Ga0068858_100019093
256 Ga0097621_100000827
257 Ga0097621_100084574
258 Ga0068871_100001149
259 Ga0068865_100000574
260 Ga0105240_10000294
261 Ga0105240_10058999
262 Ga0105240_10080032
263 Ga0105240_10085008
264 Ga0105240_10087953
265 Ga0105240_10114637
266 Ga0105241_10000398
267 Ga0105241_10024255
268 Ga0105241_10032645
269 Ga0105242_10020317
270 Ga0105237_10000109
271 Ga0105237_10001914
272 Ga0105237_10003009
273 Ga0105237_10006380
274 Ga0105237_10010022
275 Ga0105237_10056039
276 Ga0105238_10025080
277 Ga0105239_10000013
278 Ga0105239_10000068
279 Ga0105239_10000162
280 Ga0105239_10002839
281 Ga0105239_10017010
282 Ga0105239_10045225
283 Ga0105239_10051698
284 Ga0105239_10096725
285 Ga0157373_10000087
286 Ga0157373_10004610
287 Ga0157373_10063754
288 Ga0157371_10000155
289 Ga0157371_10015316
290 Ga0157371_10059525
291 Ga0157370_10002867
292 Ga0157370_10005261
293 Ga0157370_10016508
294 Ga0157370_10238890
295 Ga0157369_10002036
296 Ga0157369_10042719
297 Ga0157369_10053743
298 Ga0157374_10001012
299 Ga0157374_10002228
300 Ga0157374_10020201
301 Ga0163162_10000031
302 Ga0163162_10006055
303 Ga0157372_10000400
304 Ga0157372_10000874
305 Ga0157372_10002085
306 Ga0157372_10003009
307 Ga0157372_10073688
308 Ga0157375_10082580
309 Ga0182008_10000565
310 Ga0182006_1000168
311 Ga0182006_1001374
312 Ga0182005_1000290
313 Ga0163161_10018532
314 Ga0207427_100085
315 Ga0209437_100030
316 Ga0209437_100052
317 Ga0209026_1000840
318 Ga0209026_1005609
319 Ga0209233_1000067
320 Ga0209233_1000495
321 Ga0209233_1005605
322 Ga0209455_1011257
323 Ga0209676_1000008
324 Ga0209050_1000045
325 Ga0207426_1016190
326 Ga0207647_10000207
327 Ga0207647_10000948
328 Ga0207645_10000082
329 Ga0207705_10000015
330 Ga0207654_10003575
331 Ga0207654_10018119
332 Ga0207707_10023588
333 Ga0207695_10000142
334 Ga0207695_10004328
335 Ga0207695_10030109
336 Ga0207695_10137776
337 Ga0207671_10000110
338 Ga0207671_10005361
339 Ga0207671_10012941
340 Ga0207671_10052693
341 Ga0207660_10014223
342 Ga0207657_10021261
343 Ga0207652_10175749
344 Ga0207694_10097980
345 Ga0207690_10000495
346 Ga0207690_10014207
347 Ga0207690_10063873
348 Ga0207706_10000191
349 Ga0207704_10000053
350 Ga0207667_10000039
351 Ga0207667_10000896
352 Ga0207667_10006347
353 Ga0207667_10009992
354 Ga0207667_10042272
355 Ga0207651_10003179
356 Ga0207677_10066941
357 Ga0207703_10026721
358 Ga0207639_10031156
359 Ga0207639_10052007
360 Ga0207702_10000492
361 Ga0207702_10021697
362 Ga0207648_10009920
363 Ga0207683_10015163
364 Ga0207698_10003515
365 Ga0268266_10000052
366 Ga0307517_10007927
367 Ga0265338_10113214
368 Ga0265327_10000285
369 Ga0307510_10021552
370 Ga0395899_0000017
371 Ga0395899_0000055
372 Ga0395899_0000312
373 Ga0395900_0000014
374 Ga0395900_0000128
375 Ga0395900_0007404
376 Ga0395898_0022234
377 Ga0395905_0000037
378 Ga0395905_0002800
379 Ga0395901_0000166
380 Ga0395901_0054083
381 Ga0439448_0007477
382 Ga0466966_0024424
383 Ga0495650_0000050
384 Ga0495585_0000198
385 Ga0495585_0000553
386 Ga0495583_0022419
387 Ga0495610_0001134
388 Ga0495616_0001519
389 Ga0495616_0003999
390 Ga0495631_0012131
391 Ga0495637_0063232
392 Ga0495648_0007640
393 Ga0495609_0011754
394 Ga0495633_0009063
395 Ga0495668_0000032
396 Ga0495625_0000105
397 Ga0495625_0001038
398 Ga0495625_0008344
399 Ga0495625_0037377
400 Ga0495661_0011911
401 Ga0495649_0000011
402 Ga0495687_000552
403 Ga0495686_0000098
404 Ga0495686_0001801
405 Ga0495686_0015155
406 Ga0496121_0000011
407 Ga0496122_0001708
408 Ga0496123_0004392
409 Ga0496124_0020191
410 Ga0495678_005407
411 Ga0501034_0059705
412 Ga0501047_0118608
413 Ga0500608_001643
414 Ga0500618_000037
415 Ga0500559_0069347
416 Ga0500624_000530
417 2599480004
418 2738756300
419 2819576196
420 2819587310
421 2821142423
422 2857632637
423 2904470410
424 2919439864
425 2928081135
426 2928152444
427 2932087785
428 2977236600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

285

472

0.97

PF02321

OEP

Outer membrane efflux protein

53

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.785 32 441
1yc9-assembly1.cif.gz_A the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution 0.7709 32 441
4mt4-assembly1.cif.gz_C crystal structure of the campylobacter jejuni cmec outer membrane channel 0.7662 32 444
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.7639 32 440
5azs-assembly1.cif.gz_C crystal structure of a membrane protein from pseudomonas aeruginosa 0.7558 32 440
ID Description Score Start End Superfamily
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9087 367 435 1.10.287.470
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8965 367 435 1.10.287.470
2f1mA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8746 367 435 1.10.287.470
2f1mB03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8474 367 435 1.10.287.470
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8417 367 435 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A841MXC2-F1-model_v4 deleted 0.8645 267 449
AF-A0A7X7XGQ2-F1-model_v4 TolC family protein 0.8446 27 444 GO:0015562
AF-A0A651HHT1-F1-model_v4 TolC family protein 0.842 30 444 GO:0015562
AF-A0A1C4DGW6-F1-model_v4 Outer membrane protein TolC 0.8391 27 451 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A646MR91-F1-model_v4 deleted 0.8384 131 452

Map