F325337

General Info

Members Datasets Scaffolds Average Seq Length
214 123 428 159

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10141479|Ga0265338_101414792
Length 184
Sequence MEGKPLKDDIEEAILYAKKYIEDLLSFFGLNTDVYATTEDHEVIELHIPSTHLNGFLIGQHGDTMRALQYIISSALKNQSFSHVRVNVDVADYKKRRAERVVRDAETWFKEVQTSGQAKELLPMNPADRRAVHKAATDYGLQTESIGEGRERHIVLKPSSELSRPSANADDDEATRKSTAGTSK

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
115 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
116 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
119 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
120 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
121 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 0.47
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 22.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10141479 3300028800 Archaea 1884
2 JGI24742J22300_10000009 3300002244 Bacteria 33403
3 JGI25406J46586_10027450 3300003203 Unclassified 2183
4 rootH2_10080305 3300003320 Bacteria 8745
5 rootL2_10359168 3300003322 Bacteria 2092
6 Ga0070658_10012051 3300005327 Bacteria 6944
7 Ga0070658_10134120 3300005327 Bacteria 2065
8 Ga0070658_10654881 3300005327 Bacteria 911
9 Ga0070676_10001177 3300005328 Bacteria 13106
10 Ga0070683_100188291 3300005329 Bacteria 1959
11 Ga0070683_100264839 3300005329 Unclassified 1635
12 Ga0070690_100045633 3300005330 Bacteria 2784
13 Ga0070670_100074316 3300005331 Unclassified 2920
14 Ga0070682_100194073 3300005337 Bacteria 1428
15 Ga0070660_100752913 3300005339 Bacteria 818
16 Ga0070689_100977440 3300005340 Unclassified 752
17 Ga0070661_100064556 3300005344 Bacteria 2690
18 Ga0070679_100097683 3300005530 Bacteria 2924
19 Ga0070679_100423643 3300005530 Unclassified 1276
20 Ga0070679_101473454 3300005530 Unclassified 627
21 Ga0070684_100342835 3300005535 Bacteria 1374
22 Ga0070684_100390043 3300005535 Bacteria 1283
23 Ga0070684_101160528 3300005535 Unclassified 726
24 Ga0068853_100980853 3300005539 Bacteria 813
25 Ga0070696_101755913 3300005546 Bacteria 535
26 Ga0068855_100000001 3300005563 Bacteria 818777
27 Ga0068855_100413464 3300005563 Bacteria 1476
28 Ga0068855_100599725 3300005563 Bacteria 1188
29 Ga0068855_100849423 3300005563 Bacteria 967
30 Ga0068855_101006725 3300005563 Bacteria 875
31 Ga0068857_100174058 3300005577 Bacteria 1957
32 Ga0068857_100913157 3300005577 Bacteria 842
33 Ga0068856_100105499 3300005614 Bacteria 2812
34 Ga0068852_100088736 3300005616 Unclassified 2762
35 Ga0068852_100202667 3300005616 Bacteria 1878
36 Ga0068859_100193821 3300005617 Bacteria 2116
37 Ga0068863_100039519 3300005841 Unclassified 4488
38 Ga0068858_100026448 3300005842 Bacteria 5390
39 Ga0081539_10005462 3300005985 Bacteria 12961
40 Ga0081539_10095061 3300005985 Bacteria 1531
41 Ga0075365_10000012 3300006038 Bacteria 82049
42 Ga0075365_10018373 3300006038 Bacteria 4298
43 Ga0075366_10000382 3300006195 Bacteria 20515
44 Ga0097621_100000005 3300006237 Bacteria 143888
45 Ga0068871_100000003 3300006358 Bacteria 141580
46 Ga0075433_10601583 3300006852 Unclassified 965
47 Ga0097620_100193806 3300006931 Bacteria 2116
48 Ga0105240_10419827 3300009093 Bacteria 1503
49 Ga0105240_10495092 3300009093 Bacteria 1360
50 Ga0105240_12250887 3300009093 Unclassified 565
51 Ga0105245_10000007 3300009098 Bacteria 312285
52 Ga0105243_11111865 3300009148 Unclassified 799
53 Ga0105241_10000009 3300009174 Bacteria 258876
54 Ga0105241_10000192 3300009174 Bacteria 45865
55 Ga0105241_10657989 3300009174 Bacteria 952
56 Ga0105241_11287035 3300009174 Bacteria 696
57 Ga0105242_10691779 3300009176 Bacteria 996
58 Ga0105237_10294942 3300009545 Bacteria 1624
59 Ga0105237_10958379 3300009545 Bacteria 862
60 Ga0105238_10000151 3300009551 Bacteria 76390
61 Ga0105238_10554399 3300009551 Unclassified 1154
62 Ga0105238_12162980 3300009551 Unclassified 591
63 Ga0105239_10589543 3300010375 Bacteria 1267
64 Ga0157370_10126094 3300013104 Bacteria 2389
65 Ga0157370_10629039 3300013104 Bacteria 982
66 Ga0157369_10001636 3300013105 Bacteria 27361
67 Ga0157369_10011463 3300013105 Bacteria 10067
68 Ga0157369_10977310 3300013105 Bacteria 867
69 Ga0157374_10000014 3300013296 Bacteria 396846
70 Ga0157374_10450157 3300013296 Bacteria 1289
71 Ga0157378_12343158 3300013297 Unclassified 585
72 Ga0157372_10103296 3300013307 Bacteria 3256
73 Ga0157372_10524500 3300013307 Bacteria 1381
74 Ga0157372_10763017 3300013307 Bacteria 1124
75 Ga0157372_12070321 3300013307 Bacteria 654
76 Ga0157377_10059529 3300014745 Bacteria 2177
77 Ga0157379_10008956 3300014968 Bacteria 8725
78 Ga0207647_10114829 3300025904 Bacteria 1590
79 Ga0207645_10006038 3300025907 Bacteria 8707
80 Ga0207705_10000019 3300025909 Bacteria 317770
81 Ga0207654_10000002 3300025911 Bacteria 1460142
82 Ga0207654_10003399 3300025911 Bacteria 8044
83 Ga0207654_10612712 3300025911 Bacteria 777
84 Ga0207654_10764814 3300025911 Bacteria 696
85 Ga0207707_10003089 3300025912 Bacteria 14770
86 Ga0207707_10596259 3300025912 Unclassified 935
87 Ga0207695_10323847 3300025913 Bacteria 1430
88 Ga0207657_10011343 3300025919 Bacteria 8850
89 Ga0207657_10887572 3300025919 Bacteria 687
90 Ga0207649_10046458 3300025920 Bacteria 2668
91 Ga0207652_10138298 3300025921 Bacteria 2176
92 Ga0207652_10247042 3300025921 Bacteria 1609
93 Ga0207652_10270854 3300025921 Bacteria 1532
94 Ga0207652_10352668 3300025921 Unclassified 1328
95 Ga0207694_10016919 3300025924 Bacteria 5509
96 Ga0207694_10429657 3300025924 Unclassified 1101
97 Ga0207687_10000008 3300025927 Bacteria 497738
98 Ga0207644_10021130 3300025931 Unclassified 4431
99 Ga0207690_10298742 3300025932 Unclassified 1259
100 Ga0207686_10513123 3300025934 Bacteria 932
101 Ga0207670_10093275 3300025936 Bacteria 2133
102 Ga0207670_10369021 3300025936 Bacteria 1140
103 Ga0207661_10186246 3300025944 Unclassified 1817
104 Ga0207661_10222760 3300025944 Bacteria 1668
105 Ga0207667_10000003 3300025949 Bacteria 822935
106 Ga0207667_10025542 3300025949 Bacteria 6465
107 Ga0207667_10029728 3300025949 Bacteria 5919
108 Ga0207667_10033412 3300025949 Bacteria 5530
109 Ga0207667_10660051 3300025949 Bacteria 1051
110 Ga0207703_10005339 3300026035 Bacteria 10350
111 Ga0207639_10859439 3300026041 Unclassified 847
112 Ga0207702_10003709 3300026078 Bacteria 13809
113 Ga0207674_10001822 3300026116 Bacteria 27200
114 Ga0207674_10048713 3300026116 Bacteria 4336
115 Ga0207674_10848391 3300026116 Bacteria 881
116 Ga0265337_1015186 3300028556 Bacteria 2529
117 Ga0265326_10009625 3300028558 Bacteria 2891
118 Ga0265326_10046065 3300028558 Archaea 1236
119 Ga0265334_10000206 3300028573 Bacteria 34123
120 Ga0265334_10000502 3300028573 Bacteria 20124
121 Ga0265334_10012617 3300028573 Bacteria 3548
122 Ga0265334_10027316 3300028573 Bacteria 2299
123 Ga0265318_10025910 3300028577 Unclassified 2311
124 Ga0265318_10116255 3300028577 Archaea 983
125 Ga0265323_10121862 3300028653 Unclassified 849
126 Ga0265322_10002362 3300028654 Bacteria 5839
127 Ga0265322_10053150 3300028654 Bacteria 1149
128 Ga0265322_10057684 3300028654 Archaea 1101
129 Ga0265336_10121455 3300028666 Archaea 778
130 Ga0265336_10208768 3300028666 Unclassified 580
131 Ga0265338_10000217 3300028800 Bacteria 106453
132 Ga0265338_10000894 3300028800 Bacteria 50064
133 Ga0265338_10000979 3300028800 Bacteria 48106
134 Ga0265338_10084526 3300028800 Bacteria 2649
135 Ga0265338_10109043 3300028800 Archaea 2234
136 Ga0265338_10470339 3300028800 Bacteria 888
137 Ga0265324_10006011 3300029957 Bacteria 5137
138 Ga0265324_10024917 3300029957 Archaea 2123
139 Ga0265324_10128724 3300029957 Unclassified 859
140 Ga0265330_10016742 3300031235 Bacteria 3379
141 Ga0265332_10062993 3300031238 Bacteria 1584
142 Ga0265320_10012911 3300031240 Unclassified 4829
143 Ga0265320_10076274 3300031240 Archaea 1571
144 Ga0265320_10188048 3300031240 Bacteria 924
145 Ga0265325_10011085 3300031241 Archaea 5187
146 Ga0265325_10073443 3300031241 Archaea 1712
147 Ga0265329_10011539 3300031242 Unclassified 3208
148 Ga0265329_10127746 3300031242 Archaea 817
149 Ga0265340_10000983 3300031247 Bacteria 16295
150 Ga0265339_10069689 3300031249 Unclassified 1876
151 Ga0265339_10110883 3300031249 Unclassified 1419
152 Ga0265339_10267191 3300031249 Unclassified 823
153 Ga0265331_10040109 3300031250 Unclassified 2279
154 Ga0265331_10191071 3300031250 Bacteria 924
155 Ga0265327_10080178 3300031251 Bacteria 1614
156 Ga0265327_10091216 3300031251 Archaea 1485
157 Ga0265316_10000518 3300031344 Bacteria 43510
158 Ga0265316_10004980 3300031344 Bacteria 13044
159 Ga0265316_10140187 3300031344 Bacteria 1817
160 Ga0265313_10055633 3300031595 Unclassified 1873
161 Ga0265313_10109149 3300031595 Archaea 1218
162 Ga0265314_10032104 3300031711 Unclassified 3867
163 Ga0265314_10037196 3300031711 Bacteria 3529
164 Ga0265314_10196106 3300031711 Unclassified 1197
165 Ga0265314_10481032 3300031711 Unclassified 656
166 Ga0265342_10263246 3300031712 Archaea 917
167 Ga0395899_0007401 3300037312 Bacteria 8486
168 Ga0395899_0242915 3300037312 Unclassified 1238
169 Ga0395899_0344280 3300037312 Unclassified 999
170 Ga0395900_0003106 3300037418 Bacteria 18033
171 Ga0395900_0018107 3300037418 Bacteria 7187
172 Ga0395900_0109338 3300037418 Unclassified 2840
173 Ga0395900_0128155 3300037418 Bacteria 2602
174 Ga0395900_0466520 3300037418 Unclassified 1217
175 Ga0395900_1038674 3300037418 Unclassified 738
176 Ga0395898_0039977 3300037466 Bacteria 4640
177 Ga0395898_0159893 3300037466 Unclassified 2154
178 Ga0395905_0002040 3300037471 Bacteria 23070
179 Ga0395905_0014359 3300037471 Bacteria 7567
180 Ga0395905_0087433 3300037471 Unclassified 2922
181 Ga0395901_0002445 3300038443 Bacteria 18833
182 Ga0395901_0009627 3300038443 Bacteria 9803
183 Ga0395901_0104217 3300038443 Bacteria 2977
184 Ga0436365_0981200 3300039437 Unclassified 629
185 Ga0436363_1272177 3300039450 Bacteria 939
186 Ga0495583_0099376 3300046506 Unclassified 1243
187 Ga0496100_0341516 3300048903 Unclassified 1129
188 Ga0501033_0009581 3300049570 Bacteria 7451
189 Ga0501033_0262789 3300049570 Bacteria 1221
190 Ga0501034_0000510 3300049571 Bacteria 62507
191 Ga0501036_0124499 3300049572 Bacteria 2177
192 Ga0501037_0014497 3300049573 Bacteria 5800
193 Ga0501038_0046508 3300049574 Bacteria 3763
194 Ga0501047_0000024 3300049581 Bacteria 230397
195 Ga0501070_0182227 3300049586 Bacteria 1728
196 Ga0501083_0300317 3300049744 Unclassified 1044
197 Ga0501035_0000005 3300049822 Bacteria 392980
198 Ga0501044_0004809 3300049823 Bacteria 15101
199 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
200 nmdc:mga0k408_264_c1 3300050493 Bacteria 28733
201 nmdc:mga0a205_879466_c1 3300050515 Bacteria 743
202 nmdc:mga0sz30_85898_c1 3300050516 Bacteria 1365
203 Ga0500643_000009 3300053087 Bacteria 444150
204 Ga0500644_0105460 3300053088 Bacteria 1077
205 Ga0500646_0002706 3300053090 Bacteria 4577
206 Ga0500650_0000018 3300053098 Bacteria 70093
207 Ga0500594_0000001 3300053118 Bacteria 1178472
208 Ga0500628_003724 3300053129 Bacteria 2517
209 Ga0500655_002269 3300053133 Bacteria 3528
210 Ga0500577_0059187 3300053142 Bacteria 1467
211 Ga0500579_039170 3300053143 Unclassified 2993
212 Ga0500616_0000005 3300053153 Bacteria 961725
213 Ga0500616_0171257 3300053153 Bacteria 986
214 Ga0500570_000001 3300053724 Bacteria 243552
215 Ga0265338_10141479
216 JGI24742J22300_10000009
217 JGI25406J46586_10027450
218 rootH2_10080305
219 rootL2_10359168
220 Ga0070658_10012051
221 Ga0070658_10134120
222 Ga0070658_10654881
223 Ga0070676_10001177
224 Ga0070683_100188291
225 Ga0070683_100264839
226 Ga0070690_100045633
227 Ga0070670_100074316
228 Ga0070682_100194073
229 Ga0070660_100752913
230 Ga0070689_100977440
231 Ga0070661_100064556
232 Ga0070679_100097683
233 Ga0070679_100423643
234 Ga0070679_101473454
235 Ga0070684_100342835
236 Ga0070684_100390043
237 Ga0070684_101160528
238 Ga0068853_100980853
239 Ga0070696_101755913
240 Ga0068855_100000001
241 Ga0068855_100413464
242 Ga0068855_100599725
243 Ga0068855_100849423
244 Ga0068855_101006725
245 Ga0068857_100174058
246 Ga0068857_100913157
247 Ga0068856_100105499
248 Ga0068852_100088736
249 Ga0068852_100202667
250 Ga0068859_100193821
251 Ga0068863_100039519
252 Ga0068858_100026448
253 Ga0081539_10005462
254 Ga0081539_10095061
255 Ga0075365_10000012
256 Ga0075365_10018373
257 Ga0075366_10000382
258 Ga0097621_100000005
259 Ga0068871_100000003
260 Ga0075433_10601583
261 Ga0097620_100193806
262 Ga0105240_10419827
263 Ga0105240_10495092
264 Ga0105240_12250887
265 Ga0105245_10000007
266 Ga0105243_11111865
267 Ga0105241_10000009
268 Ga0105241_10000192
269 Ga0105241_10657989
270 Ga0105241_11287035
271 Ga0105242_10691779
272 Ga0105237_10294942
273 Ga0105237_10958379
274 Ga0105238_10000151
275 Ga0105238_10554399
276 Ga0105238_12162980
277 Ga0105239_10589543
278 Ga0157370_10126094
279 Ga0157370_10629039
280 Ga0157369_10001636
281 Ga0157369_10011463
282 Ga0157369_10977310
283 Ga0157374_10000014
284 Ga0157374_10450157
285 Ga0157378_12343158
286 Ga0157372_10103296
287 Ga0157372_10524500
288 Ga0157372_10763017
289 Ga0157372_12070321
290 Ga0157377_10059529
291 Ga0157379_10008956
292 Ga0207647_10114829
293 Ga0207645_10006038
294 Ga0207705_10000019
295 Ga0207654_10000002
296 Ga0207654_10003399
297 Ga0207654_10612712
298 Ga0207654_10764814
299 Ga0207707_10003089
300 Ga0207707_10596259
301 Ga0207695_10323847
302 Ga0207657_10011343
303 Ga0207657_10887572
304 Ga0207649_10046458
305 Ga0207652_10138298
306 Ga0207652_10247042
307 Ga0207652_10270854
308 Ga0207652_10352668
309 Ga0207694_10016919
310 Ga0207694_10429657
311 Ga0207687_10000008
312 Ga0207644_10021130
313 Ga0207690_10298742
314 Ga0207686_10513123
315 Ga0207670_10093275
316 Ga0207670_10369021
317 Ga0207661_10186246
318 Ga0207661_10222760
319 Ga0207667_10000003
320 Ga0207667_10025542
321 Ga0207667_10029728
322 Ga0207667_10033412
323 Ga0207667_10660051
324 Ga0207703_10005339
325 Ga0207639_10859439
326 Ga0207702_10003709
327 Ga0207674_10001822
328 Ga0207674_10048713
329 Ga0207674_10848391
330 Ga0265337_1015186
331 Ga0265326_10009625
332 Ga0265326_10046065
333 Ga0265334_10000206
334 Ga0265334_10000502
335 Ga0265334_10012617
336 Ga0265334_10027316
337 Ga0265318_10025910
338 Ga0265318_10116255
339 Ga0265323_10121862
340 Ga0265322_10002362
341 Ga0265322_10053150
342 Ga0265322_10057684
343 Ga0265336_10121455
344 Ga0265336_10208768
345 Ga0265338_10000217
346 Ga0265338_10000894
347 Ga0265338_10000979
348 Ga0265338_10084526
349 Ga0265338_10109043
350 Ga0265338_10470339
351 Ga0265324_10006011
352 Ga0265324_10024917
353 Ga0265324_10128724
354 Ga0265330_10016742
355 Ga0265332_10062993
356 Ga0265320_10012911
357 Ga0265320_10076274
358 Ga0265320_10188048
359 Ga0265325_10011085
360 Ga0265325_10073443
361 Ga0265329_10011539
362 Ga0265329_10127746
363 Ga0265340_10000983
364 Ga0265339_10069689
365 Ga0265339_10110883
366 Ga0265339_10267191
367 Ga0265331_10040109
368 Ga0265331_10191071
369 Ga0265327_10080178
370 Ga0265327_10091216
371 Ga0265316_10000518
372 Ga0265316_10004980
373 Ga0265316_10140187
374 Ga0265313_10055633
375 Ga0265313_10109149
376 Ga0265314_10032104
377 Ga0265314_10037196
378 Ga0265314_10196106
379 Ga0265314_10481032
380 Ga0265342_10263246
381 Ga0395899_0007401
382 Ga0395899_0242915
383 Ga0395899_0344280
384 Ga0395900_0003106
385 Ga0395900_0018107
386 Ga0395900_0109338
387 Ga0395900_0128155
388 Ga0395900_0466520
389 Ga0395900_1038674
390 Ga0395898_0039977
391 Ga0395898_0159893
392 Ga0395905_0002040
393 Ga0395905_0014359
394 Ga0395905_0087433
395 Ga0395901_0002445
396 Ga0395901_0009627
397 Ga0395901_0104217
398 Ga0436365_0981200
399 Ga0436363_1272177
400 Ga0495583_0099376
401 Ga0496100_0341516
402 Ga0501033_0009581
403 Ga0501033_0262789
404 Ga0501034_0000510
405 Ga0501036_0124499
406 Ga0501037_0014497
407 Ga0501038_0046508
408 Ga0501047_0000024
409 Ga0501070_0182227
410 Ga0501083_0300317
411 Ga0501035_0000005
412 Ga0501044_0004809
413 nmdc:mga0yw44_7_c1
414 nmdc:mga0k408_264_c1
415 nmdc:mga0a205_879466_c1
416 nmdc:mga0sz30_85898_c1
417 Ga0500643_000009
418 Ga0500644_0105460
419 Ga0500646_0002706
420 Ga0500650_0000018
421 Ga0500594_0000001
422 Ga0500628_003724
423 Ga0500655_002269
424 Ga0500577_0059187
425 Ga0500579_039170
426 Ga0500616_0000005
427 Ga0500616_0171257
428 Ga0500570_000001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

99

158

0.91

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

17

89

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lrr-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate 0.8669 95 147
2fph-assembly1.cif.gz_X cell division protein ylmh from streptococcus pneumoniae 0.8447 87 151
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.7985 4 87
1jva-assembly2.cif.gz_B crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides 0.7831 106 150
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.7505 107 148
ID Description Score Start End Superfamily
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9526 87 148 3.30.1370.50
af_Q09868_358_423_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9068 108 148 3.30.1370.50
af_B6UEM9_432_490_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9041 93 147 3.30.1370.50
af_I1LZN2_426_500_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.904 93 147 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8975 87 148 3.30.1370.50
ID Description Score Start End GO Terms
AF-A0A6B3G4P8-F1-model_v4 Single-stranded DNA-binding protein 0.9541 85 149 GO:0003677
GO:0003723
AF-A0A6B3G4P8-F1-model_v4 Single-stranded DNA-binding protein 0.927 85 149 GO:0003677
GO:0003723
AF-A0A0K2QVL6-F1-model_v4 deleted 0.9189 79 148
AF-A0A0K2QVL6-F1-model_v4 deleted 0.8728 79 148
AF-X0UTT8-F1-model_v4 R3H domain-containing protein 0.8382 81 155 GO:0003676

Map