F325490

General Info

Members Datasets Scaffolds Average Seq Length
214 159 211 141

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_0554633|Ga0451802_0554633_460_933
Length 157
Sequence MRRWNDAWQRRRYKAGMTLQPFHLAFPVHDLAAARAFYGGVLGCAEGRSSDRWIDFDLKGHQIVAHLDPAARPARSTTNPVDGHDVPVPHFGVVLDWDDWHLLAARLEASGIAFGIAPHIRFAGQVGEQATMFFRDPSGNALEFKAFRDINQLFASA

Samples

Sample ID Description Type Environment
1 2643221696 Nocardioides sp. Root140 Isolate Unclassified
2 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
3 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
149 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.94
Nodule 0
Rhizoplane 1.4
Rhizosphere 83.18
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c004604 3300000041 Bacteria 1195
2 JGI24738J21930_10040716 3300002075 Unclassified 944
3 Ga0055530_10006427 3300003791 Bacteria 5256
4 Ga0055531_10000165 3300003794 Bacteria 74768
5 Ga0055531_10043485 3300003794 Bacteria 1271
6 Ga0055543_1017821 3300004625 Bacteria 1331
7 Ga0065165_1005131 3300005262 Bacteria 7582
8 Ga0070658_10011847 3300005327 Bacteria 7000
9 Ga0070658_10652991 3300005327 Bacteria 913
10 Ga0070680_100007172 3300005336 Bacteria 8495
11 Ga0070660_100001224 3300005339 Bacteria 17461
12 Ga0070689_100169723 3300005340 Bacteria 1767
13 Ga0070661_100001258 3300005344 Bacteria 17794
14 Ga0070661_100022208 3300005344 Bacteria 4541
15 Ga0070692_10252207 3300005345 Bacteria 1057
16 Ga0070659_100001846 3300005366 Bacteria 15222
17 Ga0070659_100002332 3300005366 Bacteria 13503
18 Ga0070667_101537920 3300005367 Bacteria 625
19 Ga0070663_100049828 3300005455 Bacteria 2976
20 Ga0070663_101193068 3300005455 Bacteria 668
21 Ga0070662_100001160 3300005457 Bacteria 16172
22 Ga0070681_10001064 3300005458 Bacteria 23398
23 Ga0070681_10090899 3300005458 Bacteria 3003
24 Ga0070681_10102379 3300005458 Bacteria 2809
25 Ga0070698_100214872 3300005471 Bacteria 1857
26 Ga0070679_100003936 3300005530 Bacteria 13661
27 Ga0070679_100137173 3300005530 Bacteria 2427
28 Ga0070684_100409372 3300005535 Bacteria 1251
29 Ga0068853_100000994 3300005539 Bacteria 19949
30 Ga0068853_100026714 3300005539 Bacteria 4850
31 Ga0070665_100001388 3300005548 Bacteria 28525
32 Ga0070665_100529365 3300005548 Bacteria 1190
33 Ga0068855_100012426 3300005563 Bacteria 10284
34 Ga0068855_100030896 3300005563 Bacteria 6402
35 Ga0070664_100004605 3300005564 Bacteria 11068
36 Ga0068857_100070656 3300005577 Bacteria 3110
37 Ga0068857_100125946 3300005577 Bacteria 2308
38 Ga0068854_100000692 3300005578 Bacteria 20095
39 Ga0068854_100092245 3300005578 Bacteria 2256
40 Ga0068854_100447409 3300005578 Bacteria 1078
41 Ga0068856_100026895 3300005614 Bacteria 5611
42 Ga0068856_100287932 3300005614 Bacteria 1660
43 Ga0068859_100021652 3300005617 Bacteria 6452
44 Ga0068864_100387257 3300005618 Bacteria 1326
45 Ga0068863_101130485 3300005841 Bacteria 788
46 Ga0068860_100105726 3300005843 Bacteria 2688
47 Ga0081539_10386819 3300005985 Bacteria 583
48 Ga0097620_100021652 3300006931 Bacteria 6452
49 Ga0105251_10001358 3300009011 Bacteria 21141
50 Ga0105244_10017953 3300009036 Bacteria 3982
51 Ga0105241_10400268 3300009174 Bacteria 1204
52 Ga0105238_10013817 3300009551 Bacteria 8161
53 Ga0105238_10263064 3300009551 Bacteria 1705
54 Ga0105238_10785398 3300009551 Unclassified 967
55 Ga0105239_10227167 3300010375 Bacteria 2094
56 Ga0105239_10307926 3300010375 Bacteria 1785
57 Ga0157373_10022088 3300013100 Bacteria 4618
58 Ga0157371_10001333 3300013102 Bacteria 25960
59 Ga0157370_10003462 3300013104 Bacteria 18516
60 Ga0157370_10004146 3300013104 Bacteria 16779
61 Ga0157370_10046590 3300013104 Bacteria 4157
62 Ga0157370_10164100 3300013104 Bacteria 2067
63 Ga0157369_10001516 3300013105 Bacteria 28517
64 Ga0157369_10009432 3300013105 Bacteria 11157
65 Ga0157372_10000805 3300013307 Bacteria 34014
66 Ga0157372_10023818 3300013307 Bacteria 6642
67 Ga0157377_10335836 3300014745 Bacteria 1009
68 Ga0163161_10636681 3300017792 Bacteria 882
69 Ga0163161_11184285 3300017792 Bacteria 660
70 Ga0213875_10001151 3300021388 Bacteria 18173
71 Ga0209050_1000010 3300025298 Bacteria 980454
72 Ga0209257_1000027 3300025304 Bacteria 703541
73 Ga0209257_1008720 3300025304 Bacteria 5653
74 Ga0209257_1029012 3300025304 Bacteria 1810
75 Ga0207680_10050637 3300025903 Bacteria 2479
76 Ga0207647_10000549 3300025904 Bacteria 29891
77 Ga0207705_10000746 3300025909 Bacteria 26814
78 Ga0207705_10023411 3300025909 Bacteria 4406
79 Ga0207705_10035594 3300025909 Bacteria 3562
80 Ga0207705_10292971 3300025909 Bacteria 1247
81 Ga0207654_10041502 3300025911 Bacteria 2598
82 Ga0207707_10011955 3300025912 Bacteria 7549
83 Ga0207707_10065757 3300025912 Bacteria 3157
84 Ga0207707_10114204 3300025912 Bacteria 2360
85 Ga0207695_10019215 3300025913 Bacteria 7869
86 Ga0207695_10028947 3300025913 Bacteria 6132
87 Ga0207671_10027156 3300025914 Bacteria 4281
88 Ga0207660_10002296 3300025917 Bacteria 12599
89 Ga0207660_10018753 3300025917 Bacteria 4618
90 Ga0207657_10000124 3300025919 Bacteria 77147
91 Ga0207657_10000493 3300025919 Bacteria 41704
92 Ga0207649_10000996 3300025920 Bacteria 17529
93 Ga0207649_10023360 3300025920 Bacteria 3581
94 Ga0207652_10013287 3300025921 Bacteria 6667
95 Ga0207652_10039158 3300025921 Bacteria 4022
96 Ga0207694_10070614 3300025924 Bacteria 2729
97 Ga0207694_10790720 3300025924 Bacteria 801
98 Ga0207687_11124029 3300025927 Unclassified 675
99 Ga0207644_10002705 3300025931 Bacteria 11418
100 Ga0207690_10000269 3300025932 Bacteria 37187
101 Ga0207706_10000160 3300025933 Bacteria 75222
102 Ga0207670_10136983 3300025936 Bacteria 1801
103 Ga0207679_10005375 3300025945 Bacteria 8028
104 Ga0207667_10001795 3300025949 Bacteria 27020
105 Ga0207667_10008636 3300025949 Bacteria 12082
106 Ga0207667_10104382 3300025949 Bacteria 2923
107 Ga0207668_10009344 3300025972 Bacteria 5870
108 Ga0207640_10264921 3300025981 Bacteria 1341
109 Ga0207640_10316603 3300025981 Bacteria 1240
110 Ga0207658_10666884 3300025986 Bacteria 938
111 Ga0207639_10000805 3300026041 Bacteria 21309
112 Ga0207639_10885433 3300026041 Bacteria 834
113 Ga0207678_10000578 3300026067 Bacteria 33526
114 Ga0207678_10196691 3300026067 Bacteria 1723
115 Ga0207702_10500292 3300026078 Bacteria 1185
116 Ga0207641_10142599 3300026088 Bacteria 2163
117 Ga0207674_10001312 3300026116 Bacteria 32457
118 Ga0207674_10009719 3300026116 Bacteria 10962
119 Ga0207674_11347483 3300026116 Bacteria 683
120 Ga0207675_102515149 3300026118 Bacteria 526
121 Ga0209982_1003162 3300027552 Bacteria 2328
122 Ga0268264_10864103 3300028381 Bacteria 906
123 Ga0307515_10046953 3300028794 Bacteria 6584
124 Ga0265340_10031214 3300031247 Bacteria 2666
125 Ga0307508_10000405 3300031616 Bacteria 51700
126 Ga0307413_10324625 3300031824 Bacteria 1177
127 Ga0307412_10000104 3300031911 Bacteria 67823
128 Ga0307409_100277510 3300031995 Bacteria 1547
129 Ga0307411_10721626 3300032005 Bacteria 870
130 Ga0307510_10193010 3300033180 Bacteria 1582
131 Ga0373940_0073671 3300035088 Unclassified 998
132 Ga0373923_0326747 3300035111 Bacteria 729
133 Ga0373942_0020074 3300035207 Unclassified 1675
134 Ga0373931_0032835 3300035691 Bacteria 2688
135 Ga0395899_0000004 3300037312 Bacteria 874267
136 Ga0436364_0305590 3300037853 Bacteria 8332
137 Ga0436365_0077997 3300039437 Bacteria 1628
138 Ga0451802_0554633 3300041460 Bacteria 2006
139 Ga0451806_343130 3300041462 Bacteria 1974
140 Ga0451807_2646196 3300041486 Bacteria 2996
141 Ga0451849_1094068 3300041505 Bacteria 645
142 Ga0451853_3974607 3300041512 Bacteria 717
143 Ga0451577_0008922 3300042876 Bacteria 9704
144 Ga0451577_0166437 3300042876 Bacteria 1986
145 Ga0466969_0209435 3300044656 Bacteria 888
146 Ga0466965_0273200 3300044683 Bacteria 911
147 Ga0466965_0464742 3300044683 Bacteria 706
148 Ga0466961_0022591 3300044693 Bacteria 4047
149 Ga0453684_0606923 3300044712 Bacteria 1199
150 Ga0466959_0018584 3300045049 Bacteria 5105
151 Ga0495629_0063854 3300046459 Bacteria 2571
152 Ga0495582_0141795 3300046473 Bacteria 1362
153 Ga0495594_0000486 3300046499 Bacteria 20257
154 Ga0495606_0171975 3300046507 Bacteria 1256
155 Ga0495643_0053154 3300046522 Bacteria 2172
156 Ga0495648_0010148 3300046524 Bacteria 7207
157 Ga0495648_0388512 3300046524 Bacteria 627
158 Ga0495666_0086336 3300046526 Bacteria 1482
159 Ga0495654_0082995 3300046530 Bacteria 1499
160 Ga0495586_0008370 3300046535 Bacteria 5505
161 Ga0495609_0028579 3300046538 Bacteria 2544
162 Ga0495621_0092965 3300046539 Bacteria 1139
163 Ga0495622_0111891 3300046557 Bacteria 1250
164 Ga0495625_0570877 3300046660 Bacteria 683
165 Ga0495635_0266652 3300046663 Bacteria 1152
166 Ga0495659_0013327 3300046664 Bacteria 2678
167 Ga0495661_0120601 3300046665 Bacteria 1449
168 Ga0495588_0035483 3300046674 Bacteria 2527
169 Ga0495613_0000754 3300046689 Bacteria 25353
170 Ga0495670_0000006 3300046691 Bacteria 255322
171 Ga0495671_0007217 3300046692 Bacteria 6353
172 Ga0495581_0089519 3300047315 Bacteria 1785
173 Ga0495604_0005234 3300047317 Bacteria 10276
174 Ga0495636_0070080 3300047318 Bacteria 1495
175 Ga0495683_0431739 3300047323 Bacteria 543
176 Ga0495686_0330383 3300047472 Bacteria 833
177 Ga0495686_0361570 3300047472 Bacteria 787
178 Ga0495593_0050098 3300047673 Bacteria 2214
179 Ga0496120_0012430 3300048923 Bacteria 5797
180 Ga0496122_0141626 3300048925 Bacteria 1503
181 Ga0496122_0597671 3300048925 Bacteria 516
182 Ga0496123_0093350 3300048926 Bacteria 1778
183 Ga0496123_0110048 3300048926 Bacteria 1577
184 Ga0496124_0002401 3300048927 Bacteria 24606
185 Ga0495682_0014452 3300049460 Bacteria 2993
186 Ga0501033_0011484 3300049570 Bacteria 6778
187 Ga0501034_0117095 3300049571 Bacteria 2652
188 Ga0501034_0747913 3300049571 Bacteria 873
189 Ga0501037_0548792 3300049573 Bacteria 780
190 Ga0501038_0000233 3300049574 Bacteria 47024
191 Ga0501043_0002283 3300049579 Bacteria 16280
192 Ga0501043_0162983 3300049579 Bacteria 1742
193 Ga0501046_0000076 3300049580 Bacteria 103321
194 Ga0501047_0182892 3300049581 Bacteria 1962
195 Ga0501047_0469873 3300049581 Bacteria 1086
196 Ga0501048_0607328 3300049582 Bacteria 785
197 Ga0501073_0083905 3300049589 Bacteria 2217
198 Ga0501241_008932 3300049758 Bacteria 1827
199 Ga0501280_082950 3300049776 Bacteria 592
200 Ga0501035_0022523 3300049822 Bacteria 5786
201 Ga0501035_0763995 3300049822 Bacteria 775
202 Ga0501044_0047896 3300049823 Bacteria 4419
203 Ga0500643_000262 3300053087 Bacteria 46736
204 Ga0500643_001942 3300053087 Bacteria 11204
205 Ga0500651_0000010 3300053093 Bacteria 253038
206 Ga0500594_0002031 3300053118 Bacteria 4378
207 Ga0500595_054818 3300053119 Bacteria 1223
208 Ga0500559_0109216 3300053136 Bacteria 1280
209 Ga0500604_0000081 3300053151 Bacteria 33232
210 Ga0500587_002114 3300053739 Bacteria 2836
211 Ga0501084_1542470 3300054114 Bacteria 556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10019215 Ga0207695_100192153 118
2 3300025927 Ga0207687_11124029 Ga0207687_111240292 119
3 3300026118 Ga0207675_102515149 Ga0207675_1025151491 133
4 iso_pu_bacteria 2928968154 2928970636 134
5 iso_pu_bacteria 2830075706 2830076852 135
6 3300035111 Ga0373923_0326747 Ga0373923_0326747_290_703 136
7 3300035088 Ga0373940_0073671 Ga0373940_0073671_321_737 137
8 3300035207 Ga0373942_0020074 Ga0373942_0020074_154_570 137
9 3300035691 Ga0373931_0032835 Ga0373931_0032835_70_486 137
10 3300046530 Ga0495654_0082995 Ga0495654_0082995_299_715 137
11 3300046692 Ga0495671_0007217 Ga0495671_0007217_2753_3169 137
12 3300053087 Ga0500643_001942 Ga0500643_001942_4904_5320 137
13 3300053118 Ga0500594_0002031 Ga0500594_0002031_1534_1950 137
14 3300003794 Ga0055531_10043485 Ga0055531_100434852 138
15 3300005327 Ga0070658_10652991 Ga0070658_106529911 138
16 3300005336 Ga0070680_100007172 Ga0070680_1000071724 138
17 3300005339 Ga0070660_100001224 Ga0070660_1000012247 138
18 3300005344 Ga0070661_100001258 Ga0070661_1000012589 138
19 3300005345 Ga0070692_10252207 Ga0070692_102522072 138
20 3300005366 Ga0070659_100002332 Ga0070659_1000023329 138
21 3300005457 Ga0070662_100001160 Ga0070662_1000011609 138
22 3300005458 Ga0070681_10102379 Ga0070681_101023792 138
23 3300005530 Ga0070679_100003936 Ga0070679_1000039367 138
24 3300005535 Ga0070684_100409372 Ga0070684_1004093721 138
25 3300005539 Ga0068853_100000994 Ga0068853_1000009949 138
26 3300005563 Ga0068855_100012426 Ga0068855_1000124263 138
27 3300005564 Ga0070664_100004605 Ga0070664_1000046056 138
28 3300005577 Ga0068857_100070656 Ga0068857_1000706563 138
29 3300005578 Ga0068854_100092245 Ga0068854_1000922453 138
30 3300005614 Ga0068856_100026895 Ga0068856_1000268957 138
31 3300005985 Ga0081539_10386819 Ga0081539_103868191 138
32 3300009174 Ga0105241_10400268 Ga0105241_104002682 138
33 3300009551 Ga0105238_10785398 Ga0105238_107853981 138
34 3300010375 Ga0105239_10307926 Ga0105239_103079262 138
35 3300013100 Ga0157373_10022088 Ga0157373_100220884 138
36 3300013102 Ga0157371_10001333 Ga0157371_1000133312 138
37 3300013104 Ga0157370_10004146 Ga0157370_1000414611 138
38 3300013105 Ga0157369_10009432 Ga0157369_100094326 138
39 3300013307 Ga0157372_10023818 Ga0157372_100238183 138
40 3300017792 Ga0163161_11184285 Ga0163161_111842851 138
41 3300021388 Ga0213875_10001151 Ga0213875_100011517 138
42 3300025304 Ga0209257_1008720 Ga0209257_10087204 138
43 3300025909 Ga0207705_10023411 Ga0207705_100234115 138
44 3300025911 Ga0207654_10041502 Ga0207654_100415022 138
45 3300025912 Ga0207707_10114204 Ga0207707_101142042 138
46 3300025917 Ga0207660_10018753 Ga0207660_100187533 138
47 3300025919 Ga0207657_10000124 Ga0207657_1000012467 138
48 3300025920 Ga0207649_10000996 Ga0207649_1000099612 138
49 3300025921 Ga0207652_10013287 Ga0207652_100132876 138
50 3300025932 Ga0207690_10000269 Ga0207690_1000026912 138
51 3300025933 Ga0207706_10000160 Ga0207706_100001606 138
52 3300025945 Ga0207679_10005375 Ga0207679_100053754 138
53 3300025949 Ga0207667_10001795 Ga0207667_1000179515 138
54 3300025981 Ga0207640_10316603 Ga0207640_103166032 138
55 3300026041 Ga0207639_10000805 Ga0207639_100008059 138
56 3300026067 Ga0207678_10196691 Ga0207678_101966912 138
57 3300026078 Ga0207702_10500292 Ga0207702_105002922 138
58 3300026116 Ga0207674_10009719 Ga0207674_100097194 138
59 3300026116 Ga0207674_11347483 Ga0207674_113474832 138
60 3300031911 Ga0307412_10000104 Ga0307412_100001045 138
61 3300032005 Ga0307411_10721626 Ga0307411_107216261 138
62 3300037853 Ga0436364_0305590 Ga0436364_0305590_5959_6378 138
63 3300039437 Ga0436365_0077997 Ga0436365_0077997_468_887 138
64 3300042876 Ga0451577_0166437 Ga0451577_0166437_1001_1465 138
65 3300046522 Ga0495643_0053154 Ga0495643_0053154_859_1275 138
66 3300046524 Ga0495648_0388512 Ga0495648_0388512_56_475 138
67 3300046665 Ga0495661_0120601 Ga0495661_0120601_624_1043 138
68 3300046691 Ga0495670_0000006 Ga0495670_0000006_141821_142237 138
69 3300048923 Ga0496120_0012430 Ga0496120_0012430_4413_4829 138
70 3300048925 Ga0496122_0141626 Ga0496122_0141626_212_628 138
71 3300048925 Ga0496122_0597671 Ga0496122_0597671_79_495 138
72 3300048926 Ga0496123_0093350 Ga0496123_0093350_901_1317 138
73 3300048926 Ga0496123_0110048 Ga0496123_0110048_139_555 138
74 3300048927 Ga0496124_0002401 Ga0496124_0002401_11767_12183 138
75 3300049460 Ga0495682_0014452 Ga0495682_0014452_702_1121 138
76 3300049571 Ga0501034_0117095 Ga0501034_0117095_813_1232 138
77 3300049776 Ga0501280_082950 Ga0501280_082950_158_577 138
78 3300053093 Ga0500651_0000010 Ga0500651_0000010_20145_20564 138
79 3300000041 ARcpr5oldR_c004604 ARcpr5oldR_0046043 139
80 3300002075 JGI24738J21930_10040716 JGI24738J21930_100407162 139
81 3300003791 Ga0055530_10006427 Ga0055530_100064272 139
82 3300003794 Ga0055531_10000165 Ga0055531_1000016553 139
83 3300004625 Ga0055543_1017821 Ga0055543_10178211 139
84 3300005262 Ga0065165_1005131 Ga0065165_10051313 139
85 3300005327 Ga0070658_10011847 Ga0070658_100118473 139
86 3300005340 Ga0070689_100169723 Ga0070689_1001697233 139
87 3300005344 Ga0070661_100022208 Ga0070661_1000222082 139
88 3300005366 Ga0070659_100001846 Ga0070659_10000184610 139
89 3300005367 Ga0070667_101537920 Ga0070667_1015379201 139
90 3300005455 Ga0070663_100049828 Ga0070663_1000498283 139
91 3300005455 Ga0070663_101193068 Ga0070663_1011930681 139
92 3300005458 Ga0070681_10001064 Ga0070681_100010646 139
93 3300005458 Ga0070681_10090899 Ga0070681_100908992 139
94 3300005471 Ga0070698_100214872 Ga0070698_1002148722 139
95 3300005530 Ga0070679_100137173 Ga0070679_1001371733 139
96 3300005539 Ga0068853_100026714 Ga0068853_1000267141 139
97 3300005548 Ga0070665_100001388 Ga0070665_1000013888 139
98 3300005548 Ga0070665_100529365 Ga0070665_1005293651 139
99 3300005563 Ga0068855_100030896 Ga0068855_1000308962 139
100 3300005577 Ga0068857_100125946 Ga0068857_1001259462 139
101 3300005578 Ga0068854_100000692 Ga0068854_10000069210 139
102 3300005578 Ga0068854_100447409 Ga0068854_1004474092 139
103 3300005614 Ga0068856_100287932 Ga0068856_1002879322 139
104 3300005617 Ga0068859_100021652 Ga0068859_1000216524 139
105 3300005618 Ga0068864_100387257 Ga0068864_1003872572 139
106 3300005841 Ga0068863_101130485 Ga0068863_1011304852 139
107 3300005843 Ga0068860_100105726 Ga0068860_1001057261 139
108 3300006931 Ga0097620_100021652 Ga0097620_1000216525 139
109 3300009011 Ga0105251_10001358 Ga0105251_1000135814 139
110 3300009036 Ga0105244_10017953 Ga0105244_100179532 139
111 3300009551 Ga0105238_10013817 Ga0105238_100138172 139
112 3300009551 Ga0105238_10263064 Ga0105238_102630641 139
113 3300010375 Ga0105239_10227167 Ga0105239_102271674 139
114 3300013104 Ga0157370_10003462 Ga0157370_100034626 139
115 3300013104 Ga0157370_10046590 Ga0157370_100465904 139
116 3300013104 Ga0157370_10164100 Ga0157370_101641003 139
117 3300013105 Ga0157369_10001516 Ga0157369_100015169 139
118 3300013307 Ga0157372_10000805 Ga0157372_1000080510 139
119 3300014745 Ga0157377_10335836 Ga0157377_103358361 139
120 3300017792 Ga0163161_10636681 Ga0163161_106366811 139
121 3300025298 Ga0209050_1000010 Ga0209050_1000010710 139
122 3300025304 Ga0209257_1000027 Ga0209257_1000027352 139
123 3300025304 Ga0209257_1029012 Ga0209257_10290122 139
124 3300025903 Ga0207680_10050637 Ga0207680_100506372 139
125 3300025904 Ga0207647_10000549 Ga0207647_1000054914 139
126 3300025909 Ga0207705_10000746 Ga0207705_100007463 139
127 3300025909 Ga0207705_10035594 Ga0207705_100355942 139
128 3300025909 Ga0207705_10292971 Ga0207705_102929712 139
129 3300025912 Ga0207707_10011955 Ga0207707_100119552 139
130 3300025912 Ga0207707_10065757 Ga0207707_100657573 139
131 3300025913 Ga0207695_10028947 Ga0207695_100289472 139
132 3300025914 Ga0207671_10027156 Ga0207671_100271563 139
133 3300025917 Ga0207660_10002296 Ga0207660_100022961 139
134 3300025919 Ga0207657_10000493 Ga0207657_100004936 139
135 3300025920 Ga0207649_10023360 Ga0207649_100233602 139
136 3300025921 Ga0207652_10039158 Ga0207652_100391582 139
137 3300025924 Ga0207694_10070614 Ga0207694_100706142 139
138 3300025924 Ga0207694_10790720 Ga0207694_107907201 139
139 3300025931 Ga0207644_10002705 Ga0207644_100027055 139
140 3300025936 Ga0207670_10136983 Ga0207670_101369833 139
141 3300025949 Ga0207667_10008636 Ga0207667_100086362 139
142 3300025949 Ga0207667_10104382 Ga0207667_101043823 139
143 3300025972 Ga0207668_10009344 Ga0207668_100093442 139
144 3300025981 Ga0207640_10264921 Ga0207640_102649212 139
145 3300025986 Ga0207658_10666884 Ga0207658_106668842 139
146 3300026041 Ga0207639_10885433 Ga0207639_108854331 139
147 3300026067 Ga0207678_10000578 Ga0207678_1000057812 139
148 3300026088 Ga0207641_10142599 Ga0207641_101425992 139
149 3300026116 Ga0207674_10001312 Ga0207674_1000131213 139
150 3300027552 Ga0209982_1003162 Ga0209982_10031622 139
151 3300028381 Ga0268264_10864103 Ga0268264_108641031 139
152 3300028794 Ga0307515_10046953 Ga0307515_100469535 139
153 3300031247 Ga0265340_10031214 Ga0265340_100312144 139
154 3300031616 Ga0307508_10000405 Ga0307508_1000040549 139
155 3300031824 Ga0307413_10324625 Ga0307413_103246252 139
156 3300031995 Ga0307409_100277510 Ga0307409_1002775101 139
157 3300033180 Ga0307510_10193010 Ga0307510_101930102 139
158 3300037312 Ga0395899_0000004 Ga0395899_0000004_279394_279819 139
159 3300041460 Ga0451802_0554633 Ga0451802_0554633_460_933 139
160 3300041462 Ga0451806_343130 Ga0451806_343130_1299_1772 139
161 3300041486 Ga0451807_2646196 Ga0451807_2646196_2133_2606 139
162 3300041505 Ga0451849_1094068 Ga0451849_1094068_105_578 139
163 3300041512 Ga0451853_3974607 Ga0451853_3974607_133_603 139
164 3300042876 Ga0451577_0008922 Ga0451577_0008922_729_1151 139
165 3300044656 Ga0466969_0209435 Ga0466969_0209435_11_430 139
166 3300044683 Ga0466965_0273200 Ga0466965_0273200_38_514 139
167 3300044683 Ga0466965_0464742 Ga0466965_0464742_167_595 139
168 3300044693 Ga0466961_0022591 Ga0466961_0022591_3458_3877 139
169 3300044712 Ga0453684_0606923 Ga0453684_0606923_336_758 139
170 3300045049 Ga0466959_0018584 Ga0466959_0018584_3246_3671 139
171 3300046459 Ga0495629_0063854 Ga0495629_0063854_372_818 139
172 3300046473 Ga0495582_0141795 Ga0495582_0141795_59_505 139
173 3300046499 Ga0495594_0000486 Ga0495594_0000486_5567_6013 139
174 3300046507 Ga0495606_0171975 Ga0495606_0171975_758_1180 139
175 3300046524 Ga0495648_0010148 Ga0495648_0010148_5714_6154 139
176 3300046526 Ga0495666_0086336 Ga0495666_0086336_757_1203 139
177 3300046535 Ga0495586_0008370 Ga0495586_0008370_4184_4630 139
178 3300046538 Ga0495609_0028579 Ga0495609_0028579_130_552 139
179 3300046539 Ga0495621_0092965 Ga0495621_0092965_308_730 139
180 3300046557 Ga0495622_0111891 Ga0495622_0111891_404_850 139
181 3300046660 Ga0495625_0570877 Ga0495625_0570877_55_501 139
182 3300046663 Ga0495635_0266652 Ga0495635_0266652_668_1114 139
183 3300046664 Ga0495659_0013327 Ga0495659_0013327_1416_1838 139
184 3300046674 Ga0495588_0035483 Ga0495588_0035483_861_1307 139
185 3300046689 Ga0495613_0000754 Ga0495613_0000754_11302_11748 139
186 3300047315 Ga0495581_0089519 Ga0495581_0089519_1147_1593 139
187 3300047317 Ga0495604_0005234 Ga0495604_0005234_6110_6535 139
188 3300047318 Ga0495636_0070080 Ga0495636_0070080_986_1408 139
189 3300047323 Ga0495683_0431739 Ga0495683_0431739_82_501 139
190 3300047472 Ga0495686_0330383 Ga0495686_0330383_112_531 139
191 3300047472 Ga0495686_0361570 Ga0495686_0361570_135_554 139
192 3300047673 Ga0495593_0050098 Ga0495593_0050098_98_544 139
193 3300049570 Ga0501033_0011484 Ga0501033_0011484_2608_3030 139
194 3300049571 Ga0501034_0747913 Ga0501034_0747913_301_726 139
195 3300049573 Ga0501037_0548792 Ga0501037_0548792_49_522 139
196 3300049574 Ga0501038_0000233 Ga0501038_0000233_42690_43112 139
197 3300049579 Ga0501043_0002283 Ga0501043_0002283_8261_8683 139
198 3300049579 Ga0501043_0162983 Ga0501043_0162983_315_737 139
199 3300049580 Ga0501046_0000076 Ga0501046_0000076_19392_19814 139
200 3300049581 Ga0501047_0182892 Ga0501047_0182892_210_650 139
201 3300049581 Ga0501047_0469873 Ga0501047_0469873_452_877 139
202 3300049582 Ga0501048_0607328 Ga0501048_0607328_233_655 139
203 3300049589 Ga0501073_0083905 Ga0501073_0083905_1340_1762 139
204 3300049758 Ga0501241_008932 Ga0501241_008932_1322_1741 139
205 3300049822 Ga0501035_0022523 Ga0501035_0022523_2385_2807 139
206 3300049822 Ga0501035_0763995 Ga0501035_0763995_185_625 139
207 3300049823 Ga0501044_0047896 Ga0501044_0047896_944_1366 139
208 3300053087 Ga0500643_000262 Ga0500643_000262_35730_36155 139
209 3300053119 Ga0500595_054818 Ga0500595_054818_61_483 139
210 3300053136 Ga0500559_0109216 Ga0500559_0109216_630_1073 139
211 3300053151 Ga0500604_0000081 Ga0500604_0000081_13391_13825 139
212 3300053739 Ga0500587_002114 Ga0500587_002114_1825_2253 139
213 3300054114 Ga0501084_1542470 Ga0501084_1542470_113_535 139
214 iso_pu_bacteria 2643221696 2644531809 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8284 1 127
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8199 1 139
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.8019 1 137
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.7974 1 138
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.7964 1 137
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8056 4 133 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8043 73 129 3.30.720.110
5wewB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7977 1 138 3.10.180.10
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7771 2 51 3.30.720.120
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.776 109 132 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A6J4C0Q1-F1-model_v4 Glyoxalase 0.9943 1 139
AF-A0A4R2TY40-F1-model_v4 Extradiol dioxygenase family protein 0.9901 1 139 GO:0051213
AF-A0A245ZVH6-F1-model_v4 Glyoxalase-like domain protein 0.9895 1 138
AF-A0A6J4C0Q1-F1-model_v4 Glyoxalase 0.9872 1 139
AF-A0A4R2TY40-F1-model_v4 Extradiol dioxygenase family protein 0.983 1 139 GO:0051213

Feature Viewer

pLDDT pTM Quality
93.88 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map