F325568

General Info

Members Datasets Scaffolds Average Seq Length
214 164 428 330

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0000312|Ga0495641_0000312_26609_27685
Length 358
Sequence MPLRVSTCRPFLDRCTSSDCRWVGFRPVKVFVTGGTGFIGGEVVRQLRGRGDEVVCLVRSPEKASKLKELGCELVSGDLGDANALRAGMEGCDGLIHAAAMYEVGIPAKQHPAMYEANVRGSERVLQAALDARVGKVVYVSTVGIFGNTHGKVVDESYEHPGKEFTSYYEETKLEGHRIAKRMMAEDDLPSVIVQPGGVYGPGDTSQIADLLSEFFAGRLFMLPFPELGICLSHVEDIATGIILALDKGKVGETYVISGPATTMREAIETIASASGRKAPKRAMPTAVLKALTPIGPLVGKLAGQPPNLRELISSADGVTFWASYEKAGRDLGYAPRGMEEGIRQTLEADDRFPDPAA

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 7.48
Rhizosphere 91.12
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0000312 3300046461 Bacteria 39169
2 JGI24748J21848_1004171 3300002074 Bacteria 1654
3 JGI24034J26672_10001976 3300002239 Bacteria 2779
4 JGI24742J22300_10002783 3300002244 Bacteria 2821
5 Ga0070683_100081530 3300005329 Bacteria 3029
6 Ga0070677_10000008 3300005333 Bacteria 74027
7 Ga0070682_100000090 3300005337 Bacteria 82642
8 Ga0070689_100098039 3300005340 Bacteria 2318
9 Ga0070691_10005926 3300005341 Bacteria 5576
10 Ga0070668_100009019 3300005347 Bacteria 7408
11 Ga0070674_100000023 3300005356 Bacteria 84887
12 Ga0070688_100036242 3300005365 Unclassified 2999
13 Ga0070667_100000785 3300005367 Bacteria 29854
14 Ga0070714_100034735 3300005435 Bacteria 4223
15 Ga0070714_100222532 3300005435 Bacteria 1735
16 Ga0070713_100000010 3300005436 Bacteria 151790
17 Ga0070713_100089229 3300005436 Bacteria 2648
18 Ga0070711_100002649 3300005439 Bacteria 10253
19 Ga0070711_100013554 3300005439 Bacteria 5120
20 Ga0070663_100084706 3300005455 Bacteria 2337
21 Ga0068867_100001394 3300005459 Bacteria 16721
22 Ga0070685_10199622 3300005466 Bacteria 1299
23 Ga0070679_100000818 3300005530 Bacteria 26995
24 Ga0070679_100002077 3300005530 Bacteria 18024
25 Ga0070665_100000135 3300005548 Bacteria 138925
26 Ga0070665_100060872 3300005548 Bacteria 3785
27 Ga0068855_100236053 3300005563 Bacteria 2045
28 Ga0068866_10000008 3300005718 Bacteria 117658
29 Ga0068863_100000022 3300005841 Bacteria 188278
30 Ga0068858_100000097 3300005842 Bacteria 91503
31 Ga0068858_100000142 3300005842 Bacteria 75787
32 Ga0068858_100191760 3300005842 Bacteria 1931
33 Ga0068860_100010110 3300005843 Bacteria 9348
34 Ga0068862_100000943 3300005844 Bacteria 28026
35 Ga0081455_10011619 3300005937 Bacteria 8834
36 Ga0081455_10076229 3300005937 Bacteria 2763
37 Ga0081538_10056209 3300005981 Bacteria 2307
38 Ga0081540_1000041 3300005983 Bacteria 136874
39 Ga0081539_10013108 3300005985 Bacteria 6285
40 Ga0070715_10000021 3300006163 Bacteria 119283
41 Ga0075433_10001579 3300006852 Bacteria 16871
42 Ga0105240_10278225 3300009093 Bacteria 1924
43 Ga0105245_10000130 3300009098 Bacteria 72166
44 Ga0105245_10000964 3300009098 Bacteria 26208
45 Ga0105242_10080844 3300009176 Bacteria 2716
46 Ga0105238_10000055 3300009551 Bacteria 139232
47 Ga0105249_10000143 3300009553 Bacteria 92539
48 Ga0105249_10003914 3300009553 Bacteria 12858
49 Ga0105239_10281194 3300010375 Unclassified 1873
50 Ga0157370_10005384 3300013104 Bacteria 14369
51 Ga0157370_10207645 3300013104 Bacteria 1816
52 Ga0157374_10005318 3300013296 Bacteria 10814
53 Ga0163162_10332111 3300013306 Bacteria 1653
54 Ga0157375_10000127 3300013308 Bacteria 75142
55 Ga0157375_10128114 3300013308 Bacteria 2656
56 Ga0157379_10054545 3300014968 Bacteria 3571
57 Ga0157379_10211192 3300014968 Bacteria 1757
58 Ga0163161_10000053 3300017792 Bacteria 117408
59 Ga0207672_1001627 3300025223 Bacteria 1601
60 Ga0207682_10000022 3300025893 Bacteria 62630
61 Ga0207642_10000002 3300025899 Bacteria 658166
62 Ga0207685_10000028 3300025905 Bacteria 97935
63 Ga0207663_10000714 3300025916 Bacteria 14787
64 Ga0207663_10025753 3300025916 Unclassified 3406
65 Ga0207660_10014627 3300025917 Bacteria 5166
66 Ga0207652_10000827 3300025921 Bacteria 29489
67 Ga0207652_10114756 3300025921 Bacteria 2392
68 Ga0207681_10091882 3300025923 Bacteria 2169
69 Ga0207694_10000063 3300025924 Bacteria 139700
70 Ga0207687_10000032 3300025927 Bacteria 143196
71 Ga0207687_10000073 3300025927 Bacteria 73917
72 Ga0207700_10000007 3300025928 Bacteria 345720
73 Ga0207686_10013430 3300025934 Bacteria 4533
74 Ga0207669_10000026 3300025937 Bacteria 92199
75 Ga0207689_10300859 3300025942 Bacteria 1330
76 Ga0207661_10044273 3300025944 Bacteria 3517
77 Ga0207667_10228913 3300025949 Bacteria 1904
78 Ga0207712_10000058 3300025961 Bacteria 140948
79 Ga0207712_10002774 3300025961 Bacteria 11201
80 Ga0207712_10048720 3300025961 Bacteria 2948
81 Ga0207668_10002102 3300025972 Bacteria 11617
82 Ga0207658_10000785 3300025986 Bacteria 27036
83 Ga0207703_10000103 3300026035 Bacteria 99918
84 Ga0207703_10000287 3300026035 Bacteria 55757
85 Ga0207678_10056374 3300026067 Bacteria 3382
86 Ga0207641_10000016 3300026088 Bacteria 307363
87 Ga0207648_10000960 3300026089 Bacteria 32619
88 Ga0207675_100321038 3300026118 Bacteria 1512
89 Ga0207683_10112084 3300026121 Bacteria 2443
90 Ga0268266_10000056 3300028379 Bacteria 289176
91 Ga0268266_10158670 3300028379 Bacteria 2045
92 Ga0268264_10026963 3300028381 Bacteria 4693
93 Ga0265337_1000372 3300028556 Bacteria 24062
94 Ga0265326_10000092 3300028558 Bacteria 46613
95 Ga0265319_1000105 3300028563 Bacteria 65502
96 Ga0265319_1007655 3300028563 Bacteria 4822
97 Ga0265334_10057104 3300028573 Bacteria 1480
98 Ga0265318_10031056 3300028577 Bacteria 2074
99 Ga0265322_10000029 3300028654 Bacteria 82867
100 Ga0265336_10001887 3300028666 Bacteria 9067
101 Ga0265338_10000507 3300028800 Bacteria 69026
102 Ga0265324_10000901 3300029957 Bacteria 18913
103 Ga0265332_10055458 3300031238 Bacteria 1699
104 Ga0265320_10000011 3300031240 Bacteria 249534
105 Ga0265331_10001583 3300031250 Bacteria 16645
106 Ga0265327_10000015 3300031251 Bacteria 496677
107 Ga0265316_10048434 3300031344 Bacteria 3354
108 Ga0265314_10003295 3300031711 Bacteria 15771
109 Ga0265314_10086799 3300031711 Bacteria 2047
110 Ga0307407_10315665 3300031903 Bacteria 1095
111 Ga0451853_0476122 3300041512 Bacteria 3002
112 Ga0466963_0000008 3300044694 Bacteria 74916
113 Ga0495592_0142024 3300046454 Bacteria 1669
114 Ga0495603_0001120 3300046455 Bacteria 15587
115 Ga0495603_0004912 3300046455 Bacteria 7998
116 Ga0495582_0000001 3300046473 Bacteria 252434
117 Ga0495594_0000030 3300046499 Bacteria 66443
118 Ga0495594_0100491 3300046499 Bacteria 1627
119 Ga0495608_0000007 3300046511 Bacteria 313495
120 Ga0495608_0023810 3300046511 Bacteria 4191
121 Ga0495618_0000091 3300046514 Bacteria 64654
122 Ga0495620_0000139 3300046515 Bacteria 59244
123 Ga0495628_0000815 3300046516 Bacteria 28812
124 Ga0495628_0079571 3300046516 Bacteria 2548
125 Ga0495628_0094303 3300046516 Bacteria 2314
126 Ga0495630_0006550 3300046517 Bacteria 8295
127 Ga0495630_0054389 3300046517 Bacteria 2999
128 Ga0495652_0019133 3300046529 Bacteria 6100
129 Ga0495640_0119643 3300046533 Bacteria 1713
130 Ga0495586_0001547 3300046535 Bacteria 12691
131 Ga0495587_0010005 3300046536 Bacteria 6055
132 Ga0495645_0001353 3300046543 Bacteria 16573
133 Ga0495645_0140118 3300046543 Bacteria 1688
134 Ga0495622_0000080 3300046557 Bacteria 85557
135 Ga0495656_0001564 3300046615 Bacteria 7486
136 Ga0495634_0000031 3300046642 Bacteria 110396
137 Ga0495625_0000409 3300046660 Bacteria 65188
138 Ga0495657_0000001 3300046675 Bacteria 445641
139 Ga0495657_0069570 3300046675 Bacteria 2302
140 Ga0495647_0000001 3300046681 Bacteria 222371
141 Ga0495647_0000851 3300046681 Bacteria 9140
142 Ga0495658_0000002 3300046683 Bacteria 309651
143 Ga0495669_0000779 3300046684 Bacteria 13635
144 Ga0495613_0000041 3300046689 Bacteria 130784
145 Ga0495624_0000724 3300046690 Bacteria 25913
146 Ga0495649_0005501 3300046694 Bacteria 8035
147 Ga0495600_0000420 3300046809 Bacteria 21910
148 Ga0495604_0000718 3300047317 Bacteria 28069
149 Ga0495672_0014930 3300047320 Bacteria 5294
150 Ga0495676_0000131 3300047321 Bacteria 56689
151 Ga0495680_0000212 3300047322 Bacteria 63418
152 Ga0495680_0000241 3300047322 Bacteria 60168
153 Ga0495675_0000055 3300047444 Bacteria 77878
154 Ga0495685_035995 3300047447 Bacteria 1700
155 Ga0495602_0000007 3300048088 Bacteria 273212
156 Ga0495602_0001626 3300048088 Bacteria 22343
157 Ga0496100_0000013 3300048903 Bacteria 177476
158 Ga0496101_0000035 3300048904 Bacteria 177237
159 Ga0496104_0000052 3300048907 Bacteria 137286
160 Ga0496105_0000030 3300048908 Bacteria 137325
161 Ga0496106_0000062 3300048909 Bacteria 85769
162 Ga0496106_0000461 3300048909 Bacteria 29143
163 Ga0496107_0000020 3300048910 Bacteria 148990
164 Ga0496107_0014813 3300048910 Bacteria 5459
165 Ga0496108_0000006 3300048911 Bacteria 469473
166 Ga0496108_0005281 3300048911 Bacteria 10426
167 Ga0496109_0000009 3300048912 Bacteria 236561
168 Ga0496110_0019085 3300048913 Bacteria 5764
169 Ga0496114_0000039 3300048917 Bacteria 138486
170 Ga0496115_0000011 3300048918 Bacteria 222529
171 Ga0496115_0000162 3300048918 Bacteria 62522
172 Ga0496115_0011552 3300048918 Bacteria 6620
173 Ga0501034_0230756 3300049571 Bacteria 1800
174 Ga0501039_0198818 3300049575 Bacteria 1576
175 Ga0501041_0056289 3300049577 Bacteria 2402
176 Ga0501042_0149929 3300049578 Bacteria 1681
177 Ga0501043_0046290 3300049579 Bacteria 3421
178 Ga0501047_0104568 3300049581 Bacteria 2711
179 Ga0501047_0179539 3300049581 Bacteria 1983
180 Ga0501048_0225570 3300049582 Bacteria 1329
181 Ga0501068_0182887 3300049584 Bacteria 1326
182 Ga0501069_0058118 3300049585 Bacteria 2157
183 Ga0501070_0208794 3300049586 Bacteria 1603
184 Ga0501071_0057494 3300049587 Bacteria 2811
185 Ga0501072_0017562 3300049588 Bacteria 5500
186 Ga0501072_0164141 3300049588 Bacteria 1772
187 Ga0501074_0073304 3300049590 Bacteria 2459
188 Ga0501074_0325536 3300049590 Bacteria 1091
189 Ga0501075_0086685 3300049591 Bacteria 2372
190 Ga0501076_0003627 3300049592 Bacteria 10840
191 Ga0501077_0044146 3300049593 Bacteria 2833
192 Ga0501077_0116610 3300049593 Bacteria 1692
193 Ga0501079_0064115 3300049741 Bacteria 2834
194 Ga0501080_0147482 3300049742 Bacteria 2175
195 Ga0501080_0216213 3300049742 Bacteria 1755
196 Ga0501045_0026560 3300049824 Bacteria 4166
197 nmdc:mga0qj67_172112_c1 3300050509 Bacteria 1758
198 nmdc:mga0a205_113_c1 3300050515 Bacteria 30301
199 Ga0495601_0000043 3300053077 Bacteria 77025
200 Ga0495601_0000720 3300053077 Bacteria 17767
201 Ga0495612_0007533 3300053078 Bacteria 4449
202 Ga0495655_0000002 3300053083 Bacteria 312752
203 Ga0495655_0000382 3300053083 Bacteria 7591
204 Ga0495595_0000002 3300053084 Bacteria 445641
205 Ga0495595_0005936 3300053084 Bacteria 4954
206 Ga0495619_0000010 3300053085 Bacteria 302390
207 Ga0495619_0000084 3300053085 Bacteria 70164
208 Ga0495619_0000095 3300053085 Bacteria 66204
209 Ga0500614_000152 3300053123 Bacteria 17444
210 Ga0500628_000001 3300053129 Bacteria 564074
211 Ga0501084_0101087 3300054114 Unclassified 2421
212 Ga0501082_0008073 3300060353 Bacteria 9082
213 Ga0501082_0091068 3300060353 Bacteria 2633
214 Ga0501082_0318123 3300060353 Unclassified 1356
215 Ga0495641_0000312
216 JGI24748J21848_1004171
217 JGI24034J26672_10001976
218 JGI24742J22300_10002783
219 Ga0070683_100081530
220 Ga0070677_10000008
221 Ga0070682_100000090
222 Ga0070689_100098039
223 Ga0070691_10005926
224 Ga0070668_100009019
225 Ga0070674_100000023
226 Ga0070688_100036242
227 Ga0070667_100000785
228 Ga0070714_100034735
229 Ga0070714_100222532
230 Ga0070713_100000010
231 Ga0070713_100089229
232 Ga0070711_100002649
233 Ga0070711_100013554
234 Ga0070663_100084706
235 Ga0068867_100001394
236 Ga0070685_10199622
237 Ga0070679_100000818
238 Ga0070679_100002077
239 Ga0070665_100000135
240 Ga0070665_100060872
241 Ga0068855_100236053
242 Ga0068866_10000008
243 Ga0068863_100000022
244 Ga0068858_100000097
245 Ga0068858_100000142
246 Ga0068858_100191760
247 Ga0068860_100010110
248 Ga0068862_100000943
249 Ga0081455_10011619
250 Ga0081455_10076229
251 Ga0081538_10056209
252 Ga0081540_1000041
253 Ga0081539_10013108
254 Ga0070715_10000021
255 Ga0075433_10001579
256 Ga0105240_10278225
257 Ga0105245_10000130
258 Ga0105245_10000964
259 Ga0105242_10080844
260 Ga0105238_10000055
261 Ga0105249_10000143
262 Ga0105249_10003914
263 Ga0105239_10281194
264 Ga0157370_10005384
265 Ga0157370_10207645
266 Ga0157374_10005318
267 Ga0163162_10332111
268 Ga0157375_10000127
269 Ga0157375_10128114
270 Ga0157379_10054545
271 Ga0157379_10211192
272 Ga0163161_10000053
273 Ga0207672_1001627
274 Ga0207682_10000022
275 Ga0207642_10000002
276 Ga0207685_10000028
277 Ga0207663_10000714
278 Ga0207663_10025753
279 Ga0207660_10014627
280 Ga0207652_10000827
281 Ga0207652_10114756
282 Ga0207681_10091882
283 Ga0207694_10000063
284 Ga0207687_10000032
285 Ga0207687_10000073
286 Ga0207700_10000007
287 Ga0207686_10013430
288 Ga0207669_10000026
289 Ga0207689_10300859
290 Ga0207661_10044273
291 Ga0207667_10228913
292 Ga0207712_10000058
293 Ga0207712_10002774
294 Ga0207712_10048720
295 Ga0207668_10002102
296 Ga0207658_10000785
297 Ga0207703_10000103
298 Ga0207703_10000287
299 Ga0207678_10056374
300 Ga0207641_10000016
301 Ga0207648_10000960
302 Ga0207675_100321038
303 Ga0207683_10112084
304 Ga0268266_10000056
305 Ga0268266_10158670
306 Ga0268264_10026963
307 Ga0265337_1000372
308 Ga0265326_10000092
309 Ga0265319_1000105
310 Ga0265319_1007655
311 Ga0265334_10057104
312 Ga0265318_10031056
313 Ga0265322_10000029
314 Ga0265336_10001887
315 Ga0265338_10000507
316 Ga0265324_10000901
317 Ga0265332_10055458
318 Ga0265320_10000011
319 Ga0265331_10001583
320 Ga0265327_10000015
321 Ga0265316_10048434
322 Ga0265314_10003295
323 Ga0265314_10086799
324 Ga0307407_10315665
325 Ga0451853_0476122
326 Ga0466963_0000008
327 Ga0495592_0142024
328 Ga0495603_0001120
329 Ga0495603_0004912
330 Ga0495582_0000001
331 Ga0495594_0000030
332 Ga0495594_0100491
333 Ga0495608_0000007
334 Ga0495608_0023810
335 Ga0495618_0000091
336 Ga0495620_0000139
337 Ga0495628_0000815
338 Ga0495628_0079571
339 Ga0495628_0094303
340 Ga0495630_0006550
341 Ga0495630_0054389
342 Ga0495652_0019133
343 Ga0495640_0119643
344 Ga0495586_0001547
345 Ga0495587_0010005
346 Ga0495645_0001353
347 Ga0495645_0140118
348 Ga0495622_0000080
349 Ga0495656_0001564
350 Ga0495634_0000031
351 Ga0495625_0000409
352 Ga0495657_0000001
353 Ga0495657_0069570
354 Ga0495647_0000001
355 Ga0495647_0000851
356 Ga0495658_0000002
357 Ga0495669_0000779
358 Ga0495613_0000041
359 Ga0495624_0000724
360 Ga0495649_0005501
361 Ga0495600_0000420
362 Ga0495604_0000718
363 Ga0495672_0014930
364 Ga0495676_0000131
365 Ga0495680_0000212
366 Ga0495680_0000241
367 Ga0495675_0000055
368 Ga0495685_035995
369 Ga0495602_0000007
370 Ga0495602_0001626
371 Ga0496100_0000013
372 Ga0496101_0000035
373 Ga0496104_0000052
374 Ga0496105_0000030
375 Ga0496106_0000062
376 Ga0496106_0000461
377 Ga0496107_0000020
378 Ga0496107_0014813
379 Ga0496108_0000006
380 Ga0496108_0005281
381 Ga0496109_0000009
382 Ga0496110_0019085
383 Ga0496114_0000039
384 Ga0496115_0000011
385 Ga0496115_0000162
386 Ga0496115_0011552
387 Ga0501034_0230756
388 Ga0501039_0198818
389 Ga0501041_0056289
390 Ga0501042_0149929
391 Ga0501043_0046290
392 Ga0501047_0104568
393 Ga0501047_0179539
394 Ga0501048_0225570
395 Ga0501068_0182887
396 Ga0501069_0058118
397 Ga0501070_0208794
398 Ga0501071_0057494
399 Ga0501072_0017562
400 Ga0501072_0164141
401 Ga0501074_0073304
402 Ga0501074_0325536
403 Ga0501075_0086685
404 Ga0501076_0003627
405 Ga0501077_0044146
406 Ga0501077_0116610
407 Ga0501079_0064115
408 Ga0501080_0147482
409 Ga0501080_0216213
410 Ga0501045_0026560
411 nmdc:mga0qj67_172112_c1
412 nmdc:mga0a205_113_c1
413 Ga0495601_0000043
414 Ga0495601_0000720
415 Ga0495612_0007533
416 Ga0495655_0000002
417 Ga0495655_0000382
418 Ga0495595_0000002
419 Ga0495595_0005936
420 Ga0495619_0000010
421 Ga0495619_0000084
422 Ga0495619_0000095
423 Ga0500614_000152
424 Ga0500628_000001
425 Ga0501084_0101087
426 Ga0501082_0008073
427 Ga0501082_0091068
428 Ga0501082_0318123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

30

160

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

258

0.9

PF02254

TrkA_N

TrkA-N domain

31

108

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

30

145

0.88

PF07993

NAD_binding_4

Male sterility protein

73

227

0.85

PF08659

KR

KR domain

29

153

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

31

346

0.82

PF04321

RmlD_sub_bind

RmlD substrate binding domain

28

219

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

34

218

0.81

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

31

251

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.858 1 321
3ic5-assembly2.cif.gz_B n-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi. 0.8495 2 107
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.8487 2 114
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8486 1 321
4j2o-assembly1.cif.gz_F crystal structure of nadp-bound wbjb from a. baumannii community strain d1279779 0.8485 2 244
ID Description Score Start End Superfamily
af_A0A1D6GEP1_267_439_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9219 2 119 3.40.50.720
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9064 1 321 3.40.50.720
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 2 76 3.40.50.720
af_A0A1D6MSA0_57_130_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9014 4 40 3.40.50.720
af_Q8H1Z0_455_526_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8924 3 40 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6P2AIP0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9591 1 265 GO:0004029
GO:0005737
AF-A0A535W1F1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9588 2 320 GO:0004029
GO:0005737
AF-A0A7Y1X7T6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9517 1 112 GO:0004029
GO:0005737
AF-A0A3S1CNG6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9486 1 75 GO:0004029
GO:0005737
GO:0016020
AF-A0A537ZBR9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9475 111 321 GO:0004029
GO:0005737

Map