F325666

General Info

Members Datasets Scaffolds Average Seq Length
214 142 428 188

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0302365|Ga0496121_0302365_209_892
Length 227
Sequence MSATRLPLTMEKAVTDCWLEQSPTIVGDRKEALTMLDTSSYERCSWAQDDPMMRGYHDVEWGVPQRDPRMLWEMLMLEGFQAGLAWIIILRKRDAFRAAFADFDPVKVAAFDERDIERLMADPGIVRARAKIEATIKGAQIYCEMQDRGEDFSEFCWSFTKGIPVLGDGKSWLATTPLSETISKELKRRGFKFVGPTITYAWMQAVGIVNDHSLSCFRRHVETGCRR

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
62 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
63 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
92 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
104 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
130 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
131 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
135 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
140 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
141 3004167301 Mesorhizobium loti 582 Isolate Unclassified
142 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 0.47
Rhizoplane 2.34
Rhizosphere 80.37
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0302365 3300048924 Bacteria 1085
2 JGI24739J22299_10013422 3300001989 Bacteria 2992
3 JGI24739J22299_10032313 3300001989 Bacteria 1802
4 JGI24737J22298_10046129 3300001990 Bacteria 1330
5 JGI24735J21928_10016734 3300002067 Bacteria 2271
6 JGI24735J21928_10023188 3300002067 Bacteria 1884
7 Ga0055529_1001903 3300003763 Bacteria 4796
8 Ga0058692_1016067 3300003856 Bacteria 1673
9 Ga0065165_1000001 3300005262 Bacteria 494087
10 Ga0070658_10697669 3300005327 Bacteria 881
11 Ga0070661_100013711 3300005344 Bacteria 5694
12 Ga0070668_100001993 3300005347 Bacteria 14929
13 Ga0070668_100102261 3300005347 Bacteria 2272
14 Ga0070668_100225251 3300005347 Bacteria 1548
15 Ga0070671_100218700 3300005355 Bacteria 1616
16 Ga0070667_100002460 3300005367 Bacteria 16164
17 Ga0070662_100007864 3300005457 Bacteria 6926
18 Ga0070706_100774528 3300005467 Bacteria 889
19 Ga0070672_100986154 3300005543 Bacteria 746
20 Ga0070686_100000034 3300005544 Bacteria 112341
21 Ga0070665_100295025 3300005548 Bacteria 1624
22 Ga0068863_100002812 3300005841 Bacteria 17228
23 Ga0068860_100328509 3300005843 Bacteria 1502
24 Ga0068862_100000510 3300005844 Bacteria 41329
25 Ga0075370_10296782 3300006353 Bacteria 961
26 Ga0075434_100165038 3300006871 Bacteria 2234
27 Ga0075436_100881421 3300006914 Bacteria 669
28 Ga0105247_10003010 3300009101 Bacteria 11168
29 Ga0105241_10394205 3300009174 Bacteria 1213
30 Ga0105248_10005918 3300009177 Bacteria 13443
31 Ga0105248_10126583 3300009177 Bacteria 2881
32 Ga0105248_10528256 3300009177 Bacteria 1331
33 Ga0105249_10010774 3300009553 Bacteria 8033
34 Ga0157326_1006125 3300012513 Bacteria 1279
35 Ga0157373_10467584 3300013100 Bacteria 909
36 Ga0157370_10101521 3300013104 Bacteria 2694
37 Ga0157369_10800181 3300013105 Bacteria 969
38 Ga0157374_10018251 3300013296 Bacteria 6189
39 Ga0157372_10014716 3300013307 Bacteria 8371
40 Ga0157372_10587757 3300013307 Bacteria 1298
41 Ga0157379_10040393 3300014968 Bacteria 4164
42 Ga0182006_1000005 3300015261 Bacteria 621201
43 Ga0163161_10003322 3300017792 Bacteria 11279
44 Ga0163161_10058811 3300017792 Bacteria 2794
45 Ga0163161_10087940 3300017792 Bacteria 2296
46 Ga0209674_101090 3300025226 Bacteria 8044
47 Ga0209437_101430 3300025233 Bacteria 5854
48 Ga0209258_102850 3300025242 Bacteria 4121
49 Ga0209148_1001060 3300025254 Bacteria 16929
50 Ga0209455_1001991 3300025272 Bacteria 8378
51 Ga0209673_1033047 3300025273 Bacteria 1584
52 Ga0209256_1012440 3300025299 Bacteria 3261
53 Ga0207426_1068650 3300025302 Bacteria 996
54 Ga0209051_1057371 3300025303 Bacteria 1248
55 Ga0207647_10182248 3300025904 Bacteria 1219
56 Ga0207705_10815215 3300025909 Bacteria 724
57 Ga0207657_10346316 3300025919 Bacteria 1172
58 Ga0207649_10005725 3300025920 Bacteria 6729
59 Ga0207681_10318868 3300025923 Bacteria 1235
60 Ga0207681_10607339 3300025923 Bacteria 904
61 Ga0207644_10320608 3300025931 Bacteria 1253
62 Ga0207706_10004946 3300025933 Bacteria 12450
63 Ga0207711_10003119 3300025941 Bacteria 14451
64 Ga0207711_10133412 3300025941 Bacteria 2228
65 Ga0207711_10341502 3300025941 Bacteria 1386
66 Ga0207668_10012609 3300025972 Bacteria 5180
67 Ga0207641_10002460 3300026088 Bacteria 17117
68 Ga0268266_11069391 3300028379 Bacteria 781
69 Ga0268264_10007841 3300028381 Bacteria 8888
70 Ga0373957_0151690 3300035120 Bacteria 951
71 Ga0373955_0016121 3300035172 Bacteria 3673
72 Ga0373933_0013866 3300035724 Bacteria 4472
73 Ga0451837_1760151 3300041494 Bacteria 1052
74 Ga0451845_0197061 3300041501 Bacteria 769
75 Ga0451843_0193364 3300041509 Bacteria 1087
76 Ga0439448_0002443 3300042005 Bacteria 5059
77 Ga0439455_0001126 3300042012 Bacteria 4293
78 Ga0439455_0060993 3300042012 Bacteria 1000
79 Ga0439458_0000207 3300042157 Bacteria 13733
80 Ga0466971_0069580 3300044719 Bacteria 1597
81 Ga0466957_0011261 3300044842 Bacteria 5152
82 Ga0466957_0450748 3300044842 Bacteria 887
83 Ga0466958_0083151 3300045836 Bacteria 1973
84 Ga0495617_000183 3300046452 Bacteria 39626
85 Ga0495617_000394 3300046452 Bacteria 24169
86 Ga0495638_0000422 3300046460 Bacteria 51201
87 Ga0495585_0000780 3300046492 Bacteria 28158
88 Ga0495607_0000003 3300046501 Bacteria 366900
89 Ga0495607_0000010 3300046501 Bacteria 206525
90 Ga0495583_0055268 3300046506 Bacteria 1794
91 Ga0495606_0000469 3300046507 Bacteria 66319
92 Ga0495606_0018574 3300046507 Bacteria 5205
93 Ga0495610_0000199 3300046512 Bacteria 67146
94 Ga0495610_0047203 3300046512 Bacteria 2120
95 Ga0495610_0171483 3300046512 Bacteria 909
96 Ga0495616_0000022 3300046513 Bacteria 149720
97 Ga0495616_0013621 3300046513 Bacteria 4580
98 Ga0495620_0000397 3300046515 Bacteria 29197
99 Ga0495631_0000137 3300046518 Bacteria 49790
100 Ga0495631_0000728 3300046518 Bacteria 21163
101 Ga0495632_0000011 3300046519 Bacteria 266804
102 Ga0495632_0058371 3300046519 Bacteria 1881
103 Ga0495648_0000798 3300046524 Bacteria 33314
104 Ga0495609_0003385 3300046538 Bacteria 9165
105 Ga0495611_0000001 3300046648 Bacteria 2628469
106 Ga0495611_0000068 3300046648 Bacteria 71983
107 Ga0495611_0134553 3300046648 Bacteria 1153
108 Ga0495625_0000001 3300046660 Bacteria 1641829
109 Ga0495625_0257141 3300046660 Bacteria 1131
110 Ga0495661_0000885 3300046665 Bacteria 27597
111 Ga0495661_0058660 3300046665 Bacteria 2293
112 Ga0495670_0000719 3300046691 Bacteria 15775
113 Ga0495671_0003422 3300046692 Bacteria 9752
114 Ga0495589_0000016 3300046794 Bacteria 209027
115 Ga0495660_0000116 3300046810 Bacteria 85798
116 Ga0495660_0000357 3300046810 Bacteria 40440
117 Ga0495672_0134655 3300047320 Bacteria 1296
118 Ga0495679_000001 3300047446 Bacteria 1607568
119 Ga0495673_0000001 3300047469 Bacteria 1630730
120 Ga0495673_0001025 3300047469 Bacteria 24644
121 Ga0495681_0000038 3300047470 Bacteria 121100
122 Ga0495686_0000115 3300047472 Bacteria 166876
123 Ga0495686_0000824 3300047472 Bacteria 39973
124 Ga0495686_0164606 3300047472 Bacteria 1293
125 Ga0496100_0010911 3300048903 Bacteria 5158
126 Ga0496101_0007860 3300048904 Bacteria 6938
127 Ga0496102_1152097 3300048905 Bacteria 695
128 Ga0496106_0000705 3300048909 Bacteria 24064
129 Ga0496106_0170668 3300048909 Bacteria 1724
130 Ga0496119_0029944 3300048922 Bacteria 3679
131 Ga0496121_0001558 3300048924 Bacteria 38344
132 Ga0496121_0009781 3300048924 Bacteria 10958
133 Ga0496122_0007120 3300048925 Bacteria 12554
134 Ga0496122_0019903 3300048925 Bacteria 6102
135 Ga0496123_0015361 3300048926 Bacteria 6284
136 Ga0496123_0040968 3300048926 Bacteria 3217
137 Ga0496126_0000150 3300048929 Bacteria 162748
138 Ga0495678_000332 3300049459 Bacteria 49495
139 Ga0495682_0001413 3300049460 Bacteria 13055
140 Ga0495682_0040098 3300049460 Bacteria 1717
141 Ga0501032_0000984 3300049569 Bacteria 22979
142 Ga0501032_0014950 3300049569 Bacteria 5490
143 Ga0501033_0018711 3300049570 Bacteria 5235
144 Ga0501034_0001368 3300049571 Bacteria 32875
145 Ga0501034_0034730 3300049571 Bacteria 5112
146 Ga0501034_0106983 3300049571 Bacteria 2789
147 Ga0501034_0215374 3300049571 Bacteria 1874
148 Ga0501036_0068745 3300049572 Bacteria 2997
149 Ga0501036_0092605 3300049572 Bacteria 2553
150 Ga0501037_0028610 3300049573 Bacteria 4116
151 Ga0501037_0205713 3300049573 Bacteria 1389
152 Ga0501038_0008435 3300049574 Bacteria 9477
153 Ga0501038_0016687 3300049574 Bacteria 6654
154 Ga0501039_0051425 3300049575 Bacteria 3188
155 Ga0501043_0023469 3300049579 Bacteria 4837
156 Ga0501043_0060200 3300049579 Bacteria 2980
157 Ga0501043_0062988 3300049579 Bacteria 2912
158 Ga0501043_0607210 3300049579 Bacteria 807
159 Ga0501046_0005406 3300049580 Bacteria 11418
160 Ga0501046_0157416 3300049580 Bacteria 1710
161 Ga0501046_0327866 3300049580 Bacteria 1114
162 Ga0501046_0447173 3300049580 Bacteria 929
163 Ga0501047_0001819 3300049581 Bacteria 20607
164 Ga0501047_0016867 3300049581 Bacteria 6980
165 Ga0501047_0239474 3300049581 Bacteria 1665
166 Ga0501047_0437934 3300049581 Bacteria 1137
167 Ga0501048_0325795 3300049582 Bacteria 1094
168 Ga0501067_0019554 3300049583 Bacteria 3751
169 Ga0501067_0051087 3300049583 Bacteria 2292
170 Ga0501067_0206355 3300049583 Bacteria 1094
171 Ga0501068_0003916 3300049584 Bacteria 8095
172 Ga0501068_0004249 3300049584 Bacteria 7773
173 Ga0501068_0058705 3300049584 Bacteria 2335
174 Ga0501070_0347929 3300049586 Bacteria 1203
175 Ga0501072_0024002 3300049588 Bacteria 4741
176 Ga0501072_0371252 3300049588 Bacteria 1135
177 Ga0501073_0006654 3300049589 Bacteria 8610
178 Ga0501073_0042228 3300049589 Bacteria 3219
179 Ga0501073_0141105 3300049589 Bacteria 1669
180 Ga0501073_0248638 3300049589 Bacteria 1227
181 Ga0501074_0069106 3300049590 Bacteria 2539
182 Ga0501076_0447297 3300049592 Bacteria 1064
183 Ga0501077_0383163 3300049593 Bacteria 898
184 Ga0501080_0000239 3300049742 Bacteria 41220
185 Ga0501080_0029963 3300049742 Bacteria 5066
186 Ga0501080_0232031 3300049742 Bacteria 1686
187 Ga0501080_0379647 3300049742 Bacteria 1273
188 Ga0501083_0003312 3300049744 Bacteria 11253
189 Ga0501083_0381701 3300049744 Bacteria 916
190 Ga0501035_0025288 3300049822 Bacteria 5443
191 Ga0501035_0064805 3300049822 Bacteria 3246
192 Ga0501035_0627272 3300049822 Bacteria 873
193 Ga0501044_0000070 3300049823 Bacteria 124889
194 Ga0501044_0002449 3300049823 Bacteria 21162
195 Ga0501044_0164718 3300049823 Bacteria 2192
196 Ga0501044_0328504 3300049823 Bacteria 1452
197 nmdc:mga0n895_1089409_c1 3300050512 Bacteria 777
198 Ga0500643_000002 3300053087 Bacteria 1277657
199 Ga0500643_090590 3300053087 Unclassified 834
200 Ga0500555_000854 3300053103 Bacteria 10894
201 Ga0500652_151848 3300053131 Bacteria 960
202 Ga0500559_0141835 3300053136 Bacteria 1125
203 Ga0500604_0006041 3300053151 Bacteria 3196
204 Ga0500627_0002242 3300053158 Bacteria 5669
205 Ga0500633_0122623 3300053160 Bacteria 967
206 Ga0500645_000797 3300053730 Bacteria 18886
207 Ga0500661_009113 3300055283 Bacteria 1822
208 Ga0501082_0018422 3300060353 Bacteria 6013
209 Ga0501082_0032874 3300060353 Bacteria 4474
210 Ga0501082_0048083 3300060353 Bacteria 3676
211 2792583266 2791355082 Bacteria 5973319
212 2842916636 2842914999 Bacteria 4419378
213 3004168350 3004167301 Bacteria 8330599
214 8054305547 8054302542 Bacteria 5698134
215 Ga0496121_0302365
216 JGI24739J22299_10013422
217 JGI24739J22299_10032313
218 JGI24737J22298_10046129
219 JGI24735J21928_10016734
220 JGI24735J21928_10023188
221 Ga0055529_1001903
222 Ga0058692_1016067
223 Ga0065165_1000001
224 Ga0070658_10697669
225 Ga0070661_100013711
226 Ga0070668_100001993
227 Ga0070668_100102261
228 Ga0070668_100225251
229 Ga0070671_100218700
230 Ga0070667_100002460
231 Ga0070662_100007864
232 Ga0070706_100774528
233 Ga0070672_100986154
234 Ga0070686_100000034
235 Ga0070665_100295025
236 Ga0068863_100002812
237 Ga0068860_100328509
238 Ga0068862_100000510
239 Ga0075370_10296782
240 Ga0075434_100165038
241 Ga0075436_100881421
242 Ga0105247_10003010
243 Ga0105241_10394205
244 Ga0105248_10005918
245 Ga0105248_10126583
246 Ga0105248_10528256
247 Ga0105249_10010774
248 Ga0157326_1006125
249 Ga0157373_10467584
250 Ga0157370_10101521
251 Ga0157369_10800181
252 Ga0157374_10018251
253 Ga0157372_10014716
254 Ga0157372_10587757
255 Ga0157379_10040393
256 Ga0182006_1000005
257 Ga0163161_10003322
258 Ga0163161_10058811
259 Ga0163161_10087940
260 Ga0209674_101090
261 Ga0209437_101430
262 Ga0209258_102850
263 Ga0209148_1001060
264 Ga0209455_1001991
265 Ga0209673_1033047
266 Ga0209256_1012440
267 Ga0207426_1068650
268 Ga0209051_1057371
269 Ga0207647_10182248
270 Ga0207705_10815215
271 Ga0207657_10346316
272 Ga0207649_10005725
273 Ga0207681_10318868
274 Ga0207681_10607339
275 Ga0207644_10320608
276 Ga0207706_10004946
277 Ga0207711_10003119
278 Ga0207711_10133412
279 Ga0207711_10341502
280 Ga0207668_10012609
281 Ga0207641_10002460
282 Ga0268266_11069391
283 Ga0268264_10007841
284 Ga0373957_0151690
285 Ga0373955_0016121
286 Ga0373933_0013866
287 Ga0451837_1760151
288 Ga0451845_0197061
289 Ga0451843_0193364
290 Ga0439448_0002443
291 Ga0439455_0001126
292 Ga0439455_0060993
293 Ga0439458_0000207
294 Ga0466971_0069580
295 Ga0466957_0011261
296 Ga0466957_0450748
297 Ga0466958_0083151
298 Ga0495617_000183
299 Ga0495617_000394
300 Ga0495638_0000422
301 Ga0495585_0000780
302 Ga0495607_0000003
303 Ga0495607_0000010
304 Ga0495583_0055268
305 Ga0495606_0000469
306 Ga0495606_0018574
307 Ga0495610_0000199
308 Ga0495610_0047203
309 Ga0495610_0171483
310 Ga0495616_0000022
311 Ga0495616_0013621
312 Ga0495620_0000397
313 Ga0495631_0000137
314 Ga0495631_0000728
315 Ga0495632_0000011
316 Ga0495632_0058371
317 Ga0495648_0000798
318 Ga0495609_0003385
319 Ga0495611_0000001
320 Ga0495611_0000068
321 Ga0495611_0134553
322 Ga0495625_0000001
323 Ga0495625_0257141
324 Ga0495661_0000885
325 Ga0495661_0058660
326 Ga0495670_0000719
327 Ga0495671_0003422
328 Ga0495589_0000016
329 Ga0495660_0000116
330 Ga0495660_0000357
331 Ga0495672_0134655
332 Ga0495679_000001
333 Ga0495673_0000001
334 Ga0495673_0001025
335 Ga0495681_0000038
336 Ga0495686_0000115
337 Ga0495686_0000824
338 Ga0495686_0164606
339 Ga0496100_0010911
340 Ga0496101_0007860
341 Ga0496102_1152097
342 Ga0496106_0000705
343 Ga0496106_0170668
344 Ga0496119_0029944
345 Ga0496121_0001558
346 Ga0496121_0009781
347 Ga0496122_0007120
348 Ga0496122_0019903
349 Ga0496123_0015361
350 Ga0496123_0040968
351 Ga0496126_0000150
352 Ga0495678_000332
353 Ga0495682_0001413
354 Ga0495682_0040098
355 Ga0501032_0000984
356 Ga0501032_0014950
357 Ga0501033_0018711
358 Ga0501034_0001368
359 Ga0501034_0034730
360 Ga0501034_0106983
361 Ga0501034_0215374
362 Ga0501036_0068745
363 Ga0501036_0092605
364 Ga0501037_0028610
365 Ga0501037_0205713
366 Ga0501038_0008435
367 Ga0501038_0016687
368 Ga0501039_0051425
369 Ga0501043_0023469
370 Ga0501043_0060200
371 Ga0501043_0062988
372 Ga0501043_0607210
373 Ga0501046_0005406
374 Ga0501046_0157416
375 Ga0501046_0327866
376 Ga0501046_0447173
377 Ga0501047_0001819
378 Ga0501047_0016867
379 Ga0501047_0239474
380 Ga0501047_0437934
381 Ga0501048_0325795
382 Ga0501067_0019554
383 Ga0501067_0051087
384 Ga0501067_0206355
385 Ga0501068_0003916
386 Ga0501068_0004249
387 Ga0501068_0058705
388 Ga0501070_0347929
389 Ga0501072_0024002
390 Ga0501072_0371252
391 Ga0501073_0006654
392 Ga0501073_0042228
393 Ga0501073_0141105
394 Ga0501073_0248638
395 Ga0501074_0069106
396 Ga0501076_0447297
397 Ga0501077_0383163
398 Ga0501080_0000239
399 Ga0501080_0029963
400 Ga0501080_0232031
401 Ga0501080_0379647
402 Ga0501083_0003312
403 Ga0501083_0381701
404 Ga0501035_0025288
405 Ga0501035_0064805
406 Ga0501035_0627272
407 Ga0501044_0000070
408 Ga0501044_0002449
409 Ga0501044_0164718
410 Ga0501044_0328504
411 nmdc:mga0n895_1089409_c1
412 Ga0500643_000002
413 Ga0500643_090590
414 Ga0500555_000854
415 Ga0500652_151848
416 Ga0500559_0141835
417 Ga0500604_0006041
418 Ga0500627_0002242
419 Ga0500633_0122623
420 Ga0500645_000797
421 Ga0500661_009113
422 Ga0501082_0018422
423 Ga0501082_0032874
424 Ga0501082_0048083
425 2792583266
426 2842916636
427 3004168350
428 8054305547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

46

219

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9816 6 181
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9473 5 183
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9445 6 181
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9407 7 183
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9395 7 183
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9765 5 180 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9504 7 183 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9375 5 183 1.10.340.30
1p7mA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.93 5 180 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9246 5 181 1.10.340.30
ID Description Score Start End GO Terms
AF-G6EHB2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9964 17 183 GO:0006284
GO:0008725
GO:0046872
AF-A0A852YC63-F1-model_v4 deleted 0.9894 3 186
AF-A0A2W4I4B0-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9872 18 182 GO:0006284
GO:0008725
GO:0046872
AF-A0A7H0LMW5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.986 4 183 GO:0006284
GO:0008725
GO:0046872
AF-A0A4Q3X5K2-F1-model_v4 deleted 0.9853 18 183

Map