F325968
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 215 | 161 | 430 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10238108|Ga0065714_102381081 |
| Length | 163 |
| Sequence | MPKEGEKGFPLLSGLKTRFMTVKVINRSTHALPNYETIASAGMDLRANLTESITLKPLERAIVPTGLYIELPIGYEAQVRPRSGLAAKRGVTVLNSPGTVDADYRGEVGVILVNLSNEPFTIENGERIAQMVIAKHERAEWAEVKELAQTSRGEGGFGSTGTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 11 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 13 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 14 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 26 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 30 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 43 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 44 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 46 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 47 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 48 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 49 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 50 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 51 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 52 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 53 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 54 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 55 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 56 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 57 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 58 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 59 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 60 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 61 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 62 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 63 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 64 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 65 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 66 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 67 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 68 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 69 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 70 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 71 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 72 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 73 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 74 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 75 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 76 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 77 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 78 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 79 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 80 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 81 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 82 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 83 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 84 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 85 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 86 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 87 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 88 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 89 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 103 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 104 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 105 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 106 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 107 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 108 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 109 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 110 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 111 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 112 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 113 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 116 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 117 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 118 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 119 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 120 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 121 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 122 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 123 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 124 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 125 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 126 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 127 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 128 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 129 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 130 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 131 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 132 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 133 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 134 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 135 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 136 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 137 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 138 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 139 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 140 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 141 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 142 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 143 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 144 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 145 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 146 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 147 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 148 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 149 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 150 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 151 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 152 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 153 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 154 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 155 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 156 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 157 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 158 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 159 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 160 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 161 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.72 |
| Metatranscriptomes | 0.47 |
| Isolates | 15.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.58 |
| Nodule | 1.86 |
| Rhizoplane | 3.72 |
| Rhizosphere | 71.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10238108 | 3300005288 | Bacteria | 801 |
| 2 | SwRhRL2b_contig_1163591 | 2162886007 | Bacteria | 1751 |
| 3 | rootL2_10119274 | 3300003322 | Bacteria | 1582 |
| 4 | rootL2_10137277 | 3300003322 | Bacteria | 1587 |
| 5 | Ga0006562J51391_1010105 | 3300003578 | Bacteria | 7110 |
| 6 | Ga0065714_10004665 | 3300005288 | Bacteria | 7459 |
| 7 | Ga0065714_10018601 | 3300005288 | Bacteria | 2553 |
| 8 | Ga0065714_10069705 | 3300005288 | Bacteria | 4117 |
| 9 | Ga0065714_10162730 | 3300005288 | Bacteria | 1018 |
| 10 | Ga0065704_10073530 | 3300005289 | Bacteria | 7059 |
| 11 | Ga0065704_10084039 | 3300005289 | Bacteria | 3385 |
| 12 | Ga0065715_10011160 | 3300005293 | Bacteria | 3184 |
| 13 | Ga0065715_10093480 | 3300005293 | Bacteria | 4662 |
| 14 | Ga0065715_10173541 | 3300005293 | Bacteria | 1529 |
| 15 | Ga0065715_10607783 | 3300005293 | Bacteria | 703 |
| 16 | Ga0070682_100012882 | 3300005337 | Bacteria | 4800 |
| 17 | Ga0070685_10003296 | 3300005466 | Bacteria | 8199 |
| 18 | Ga0070693_100086757 | 3300005547 | Bacteria | 1878 |
| 19 | Ga0068855_100140219 | 3300005563 | Bacteria | 2756 |
| 20 | Ga0070712_100000208 | 3300006175 | Bacteria | 33143 |
| 21 | Ga0099824_1000500 | 3300006942 | Bacteria | 46562 |
| 22 | Ga0079104_1000079 | 3300006946 | Bacteria | 141480 |
| 23 | Ga0105251_10054114 | 3300009011 | Bacteria | 1907 |
| 24 | Ga0105244_10000054 | 3300009036 | Bacteria | 133715 |
| 25 | Ga0105244_10014980 | 3300009036 | Bacteria | 4460 |
| 26 | Ga0105244_10260747 | 3300009036 | Bacteria | 807 |
| 27 | Ga0105245_10047981 | 3300009098 | Bacteria | 3819 |
| 28 | Ga0105242_10154857 | 3300009176 | Bacteria | 2001 |
| 29 | Ga0105242_10355042 | 3300009176 | Bacteria | 1355 |
| 30 | Ga0105248_10359116 | 3300009177 | Bacteria | 1640 |
| 31 | Ga0157373_10000035 | 3300013100 | Bacteria | 123284 |
| 32 | Ga0157371_10002400 | 3300013102 | Bacteria | 17928 |
| 33 | Ga0157371_10072279 | 3300013102 | Bacteria | 2442 |
| 34 | Ga0157370_10007281 | 3300013104 | Bacteria | 12078 |
| 35 | Ga0157370_10009318 | 3300013104 | Bacteria | 10511 |
| 36 | Ga0157370_10009838 | 3300013104 | Bacteria | 10134 |
| 37 | Ga0157370_10099986 | 3300013104 | Bacteria | 2718 |
| 38 | Ga0157370_10970818 | 3300013104 | Bacteria | 770 |
| 39 | Ga0157369_10002049 | 3300013105 | Bacteria | 24325 |
| 40 | Ga0157372_10005861 | 3300013307 | Bacteria | 13080 |
| 41 | Ga0157375_10036641 | 3300013308 | Bacteria | 4694 |
| 42 | Ga0182008_10384433 | 3300014497 | Bacteria | 751 |
| 43 | Ga0157377_10833276 | 3300014745 | Bacteria | 683 |
| 44 | Ga0157379_10015103 | 3300014968 | Bacteria | 6773 |
| 45 | Ga0157376_10287664 | 3300014969 | Bacteria | 1551 |
| 46 | Ga0182006_1001274 | 3300015261 | Bacteria | 15541 |
| 47 | Ga0182006_1011355 | 3300015261 | Bacteria | 3922 |
| 48 | Ga0163161_10000091 | 3300017792 | Bacteria | 90927 |
| 49 | Ga0163161_10038158 | 3300017792 | Bacteria | 3445 |
| 50 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 51 | Ga0207655_1054766 | 3300025728 | Bacteria | 1583 |
| 52 | Ga0207713_1047162 | 3300025735 | Bacteria | 1745 |
| 53 | Ga0207680_10000138 | 3300025903 | Bacteria | 34644 |
| 54 | Ga0207693_10003724 | 3300025915 | Bacteria | 12993 |
| 55 | Ga0207663_10145988 | 3300025916 | Bacteria | 1654 |
| 56 | Ga0207687_10300653 | 3300025927 | Bacteria | 1292 |
| 57 | Ga0207700_10036326 | 3300025928 | Bacteria | 3557 |
| 58 | Ga0207686_10143081 | 3300025934 | Bacteria | 1656 |
| 59 | Ga0207686_10216584 | 3300025934 | Bacteria | 1380 |
| 60 | Ga0207665_10250389 | 3300025939 | Bacteria | 1309 |
| 61 | Ga0207711_10301926 | 3300025941 | Bacteria | 1477 |
| 62 | Ga0207708_11359559 | 3300026075 | Bacteria | 623 |
| 63 | Ga0209281_1000045 | 3300027111 | Bacteria | 328124 |
| 64 | Ga0209489_113286 | 3300027361 | Bacteria | 6759 |
| 65 | Ga0209974_10081102 | 3300027876 | Bacteria | 1116 |
| 66 | Ga0265318_10060130 | 3300028577 | Bacteria | 1416 |
| 67 | Ga0307517_10223484 | 3300028786 | Bacteria | 1141 |
| 68 | Ga0265338_10261001 | 3300028800 | Bacteria | 1273 |
| 69 | Ga0265332_10150665 | 3300031238 | Bacteria | 973 |
| 70 | Ga0265325_10000524 | 3300031241 | Bacteria | 27640 |
| 71 | Ga0265339_10033976 | 3300031249 | Bacteria | 2868 |
| 72 | Ga0265331_10314293 | 3300031250 | Bacteria | 702 |
| 73 | Ga0265316_10000434 | 3300031344 | Bacteria | 47748 |
| 74 | Ga0265316_10007300 | 3300031344 | Bacteria | 10425 |
| 75 | Ga0307408_100000600 | 3300031548 | Bacteria | 30960 |
| 76 | Ga0307408_100185756 | 3300031548 | Bacteria | 1671 |
| 77 | Ga0265313_10006817 | 3300031595 | Bacteria | 7977 |
| 78 | Ga0265342_10142618 | 3300031712 | Bacteria | 1336 |
| 79 | Ga0316576_10121252 | 3300031727 | Bacteria | 1963 |
| 80 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 81 | Ga0307405_11257071 | 3300031731 | Bacteria | 642 |
| 82 | Ga0307413_10000001 | 3300031824 | Bacteria | 159157 |
| 83 | Ga0307413_10462734 | 3300031824 | Bacteria | 1009 |
| 84 | Ga0307410_10000024 | 3300031852 | Bacteria | 59872 |
| 85 | Ga0307406_10000028 | 3300031901 | Bacteria | 91602 |
| 86 | Ga0307406_10000979 | 3300031901 | Bacteria | 15930 |
| 87 | Ga0307407_10052625 | 3300031903 | Bacteria | 2339 |
| 88 | Ga0307412_10543146 | 3300031911 | Bacteria | 975 |
| 89 | Ga0307416_100000066 | 3300032002 | Bacteria | 94549 |
| 90 | Ga0307414_10000022 | 3300032004 | Bacteria | 212123 |
| 91 | Ga0307414_10001546 | 3300032004 | Bacteria | 11955 |
| 92 | Ga0307414_10076863 | 3300032004 | Bacteria | 2427 |
| 93 | Ga0307414_10127856 | 3300032004 | Bacteria | 1966 |
| 94 | Ga0307414_10291352 | 3300032004 | Bacteria | 1376 |
| 95 | Ga0307414_11641760 | 3300032004 | Bacteria | 599 |
| 96 | Ga0307411_10000003 | 3300032005 | Bacteria | 477556 |
| 97 | Ga0316585_10013423 | 3300032137 | Unclassified | 2438 |
| 98 | Ga0307510_10044109 | 3300033180 | Bacteria | 4835 |
| 99 | Ga0373955_0201731 | 3300035172 | Bacteria | 1184 |
| 100 | Ga0316574_0302145 | 3300035398 | Bacteria | 1017 |
| 101 | Ga0316574_0340735 | 3300035398 | Unclassified | 950 |
| 102 | Ga0373937_0004654 | 3300036401 | Bacteria | 11654 |
| 103 | Ga0373937_1132692 | 3300036401 | Bacteria | 731 |
| 104 | Ga0316582_0066537 | 3300036647 | Unclassified | 2323 |
| 105 | Ga0316584_0178335 | 3300036712 | Unclassified | 1573 |
| 106 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 107 | Ga0439447_000106 | 3300041407 | Bacteria | 28341 |
| 108 | Ga0439466_0008226 | 3300041411 | Bacteria | 3933 |
| 109 | Ga0451787_192193 | 3300041441 | Bacteria | 605 |
| 110 | Ga0451802_0414641 | 3300041460 | Bacteria | 631 |
| 111 | Ga0451807_2457448 | 3300041486 | Bacteria | 603 |
| 112 | Ga0451807_2751782 | 3300041486 | Bacteria | 859 |
| 113 | Ga0451841_0365778 | 3300041498 | Bacteria | 823 |
| 114 | Ga0451843_0073584 | 3300041509 | Bacteria | 1250 |
| 115 | Ga0451855_0965708 | 3300041511 | Bacteria | 717 |
| 116 | Ga0439445_0044788 | 3300042004 | Bacteria | 1183 |
| 117 | Ga0439452_017039 | 3300042010 | Bacteria | 1963 |
| 118 | Ga0451577_0048817 | 3300042876 | Bacteria | 3780 |
| 119 | Ga0451577_0421289 | 3300042876 | Bacteria | 1212 |
| 120 | Ga0453683_0000230 | 3300044673 | Bacteria | 74466 |
| 121 | Ga0453683_0174746 | 3300044673 | Bacteria | 1361 |
| 122 | Ga0466965_0094673 | 3300044683 | Bacteria | 1522 |
| 123 | Ga0453684_0040034 | 3300044712 | Bacteria | 6373 |
| 124 | Ga0453684_0062713 | 3300044712 | Bacteria | 4759 |
| 125 | Ga0453684_0093048 | 3300044712 | Bacteria | 3714 |
| 126 | Ga0453684_0158865 | 3300044712 | Bacteria | 2676 |
| 127 | Ga0451576_0000180 | 3300045051 | Bacteria | 159491 |
| 128 | Ga0451576_0015638 | 3300045051 | Bacteria | 8398 |
| 129 | Ga0495627_010032 | 3300046453 | Bacteria | 3462 |
| 130 | Ga0495607_0010034 | 3300046501 | Bacteria | 6380 |
| 131 | Ga0495607_0279802 | 3300046501 | Bacteria | 792 |
| 132 | Ga0495606_0006217 | 3300046507 | Bacteria | 11098 |
| 133 | Ga0495606_0135024 | 3300046507 | Bacteria | 1462 |
| 134 | Ga0495610_0051290 | 3300046512 | Bacteria | 2009 |
| 135 | Ga0495616_0005577 | 3300046513 | Bacteria | 7718 |
| 136 | Ga0495643_0000308 | 3300046522 | Bacteria | 67404 |
| 137 | Ga0495644_0040428 | 3300046523 | Bacteria | 1758 |
| 138 | Ga0495654_0135881 | 3300046530 | Bacteria | 1100 |
| 139 | Ga0495625_0037234 | 3300046660 | Bacteria | 3571 |
| 140 | Ga0495625_0088970 | 3300046660 | Bacteria | 2138 |
| 141 | Ga0495671_0019640 | 3300046692 | Bacteria | 3568 |
| 142 | Ga0495672_0530995 | 3300047320 | Bacteria | 519 |
| 143 | Ga0495681_0147764 | 3300047470 | Bacteria | 988 |
| 144 | Ga0495686_0000551 | 3300047472 | Bacteria | 53580 |
| 145 | Ga0496104_0957037 | 3300048907 | Bacteria | 761 |
| 146 | Ga0496111_0842982 | 3300048914 | Bacteria | 662 |
| 147 | Ga0496115_0008392 | 3300048918 | Bacteria | 7645 |
| 148 | Ga0496115_0043191 | 3300048918 | Bacteria | 3594 |
| 149 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 150 | Ga0496117_0169448 | 3300048920 | Bacteria | 1269 |
| 151 | Ga0496118_0441617 | 3300048921 | Bacteria | 663 |
| 152 | Ga0496121_0074261 | 3300048924 | Bacteria | 2721 |
| 153 | Ga0496123_0094107 | 3300048926 | Bacteria | 1767 |
| 154 | Ga0496124_0282911 | 3300048927 | Bacteria | 1208 |
| 155 | Ga0496124_0501743 | 3300048927 | Bacteria | 813 |
| 156 | Ga0496125_0000108 | 3300048928 | Bacteria | 196060 |
| 157 | Ga0496125_0000267 | 3300048928 | Bacteria | 107026 |
| 158 | Ga0496126_0023757 | 3300048929 | Bacteria | 5935 |
| 159 | Ga0496126_0100902 | 3300048929 | Bacteria | 2525 |
| 160 | Ga0496126_0756810 | 3300048929 | Bacteria | 749 |
| 161 | Ga0501039_0121057 | 3300049575 | Bacteria | 2051 |
| 162 | Ga0501048_0417392 | 3300049582 | Bacteria | 960 |
| 163 | Ga0501238_000123 | 3300049671 | Bacteria | 12106 |
| 164 | Ga0501249_000002 | 3300049679 | Bacteria | 262756 |
| 165 | Ga0501249_016219 | 3300049679 | Bacteria | 1598 |
| 166 | Ga0501266_000003 | 3300049763 | Bacteria | 388836 |
| 167 | Ga0501266_004622 | 3300049763 | Bacteria | 1708 |
| 168 | Ga0501280_001933 | 3300049776 | Bacteria | 3613 |
| 169 | Ga0501282_010394 | 3300049778 | Bacteria | 999 |
| 170 | Ga0500644_0309899 | 3300053088 | Bacteria | 677 |
| 171 | Ga0500646_0000932 | 3300053090 | Bacteria | 8048 |
| 172 | Ga0500646_0022047 | 3300053090 | Bacteria | 1701 |
| 173 | Ga0500646_0065216 | 3300053090 | Bacteria | 1081 |
| 174 | Ga0500641_0000005 | 3300053096 | Bacteria | 226810 |
| 175 | Ga0500641_0000106 | 3300053096 | Bacteria | 31895 |
| 176 | Ga0500641_0000409 | 3300053096 | Bacteria | 15914 |
| 177 | Ga0500594_0000805 | 3300053118 | Bacteria | 6691 |
| 178 | Ga0500658_0000015 | 3300053134 | Bacteria | 151134 |
| 179 | Ga0500559_0159891 | 3300053136 | Bacteria | 1058 |
| 180 | Ga0500622_0254655 | 3300053156 | Bacteria | 769 |
| 181 | Ga0500584_005442 | 3300053726 | Bacteria | 5347 |
| 182 | 2513234706 | 2513020052 | Bacteria | 5120511 |
| 183 | 2520880468 | 2519899754 | Bacteria | 5336938 |
| 184 | 2644012131 | 2643221600 | Bacteria | 5530138 |
| 185 | 2644374563 | 2643221667 | Bacteria | 5627472 |
| 186 | 2644641404 | 2643221716 | Bacteria | 4986332 |
| 187 | 2644682478 | 2643221725 | Bacteria | 5087956 |
| 188 | 2738735816 | 2738541279 | Bacteria | 6149495 |
| 189 | 2738768393 | 2738541285 | Bacteria | 6150075 |
| 190 | 2739217398 | 2738543007 | Bacteria | 6149845 |
| 191 | 2740000352 | 2739367857 | Bacteria | 5433684 |
| 192 | 2740005168 | 2739367858 | Bacteria | 5432813 |
| 193 | 2802651250 | 2802428842 | Bacteria | 4926114 |
| 194 | 2817414132 | 2816332280 | Bacteria | 5109718 |
| 195 | 2833641608 | 2833640130 | Bacteria | 4858325 |
| 196 | 2857617793 | 2857613821 | Bacteria | 4917088 |
| 197 | 2857621391 | 2857618242 | Bacteria | 5635925 |
| 198 | 2881248856 | 2881247448 | Bacteria | 3717788 |
| 199 | 2881361437 | 2881359912 | Bacteria | 4935907 |
| 200 | 2903895212 | 2903895155 | Bacteria | 5258610 |
| 201 | 2904420391 | 2904419702 | Bacteria | 5166287 |
| 202 | 2904557763 | 2904555929 | Bacteria | 5218588 |
| 203 | 2919192403 | 2919191525 | Bacteria | 5765973 |
| 204 | 2919512679 | 2919509842 | Bacteria | 4104664 |
| 205 | 2919684190 | 2919683626 | Bacteria | 5534354 |
| 206 | 2929151286 | 2929150217 | Bacteria | 5462483 |
| 207 | 2958459559 | 2958458903 | Bacteria | 5301041 |
| 208 | 2958515582 | 2958512119 | Bacteria | 4528530 |
| 209 | 2965321238 | 2965320100 | Bacteria | 3975600 |
| 210 | 2977272664 | 2977268062 | Bacteria | 5243061 |
| 211 | 8036737050 | 8036736890 | Bacteria | 2944828 |
| 212 | 8054310868 | 8054307821 | Bacteria | 5212224 |
| 213 | 8055420122 | 8055419101 | Bacteria | 5289643 |
| 214 | 8055597009 | 8055592153 | Bacteria | 5961247 |
| 215 | 8056440900 | 8056440228 | Bacteria | 4946504 |
| 216 | Ga0065714_10238108 | |||
| 217 | SwRhRL2b_contig_1163591 | |||
| 218 | rootL2_10119274 | |||
| 219 | rootL2_10137277 | |||
| 220 | Ga0006562J51391_1010105 | |||
| 221 | Ga0065714_10004665 | |||
| 222 | Ga0065714_10018601 | |||
| 223 | Ga0065714_10069705 | |||
| 224 | Ga0065714_10162730 | |||
| 225 | Ga0065704_10073530 | |||
| 226 | Ga0065704_10084039 | |||
| 227 | Ga0065715_10011160 | |||
| 228 | Ga0065715_10093480 | |||
| 229 | Ga0065715_10173541 | |||
| 230 | Ga0065715_10607783 | |||
| 231 | Ga0070682_100012882 | |||
| 232 | Ga0070685_10003296 | |||
| 233 | Ga0070693_100086757 | |||
| 234 | Ga0068855_100140219 | |||
| 235 | Ga0070712_100000208 | |||
| 236 | Ga0099824_1000500 | |||
| 237 | Ga0079104_1000079 | |||
| 238 | Ga0105251_10054114 | |||
| 239 | Ga0105244_10000054 | |||
| 240 | Ga0105244_10014980 | |||
| 241 | Ga0105244_10260747 | |||
| 242 | Ga0105245_10047981 | |||
| 243 | Ga0105242_10154857 | |||
| 244 | Ga0105242_10355042 | |||
| 245 | Ga0105248_10359116 | |||
| 246 | Ga0157373_10000035 | |||
| 247 | Ga0157371_10002400 | |||
| 248 | Ga0157371_10072279 | |||
| 249 | Ga0157370_10007281 | |||
| 250 | Ga0157370_10009318 | |||
| 251 | Ga0157370_10009838 | |||
| 252 | Ga0157370_10099986 | |||
| 253 | Ga0157370_10970818 | |||
| 254 | Ga0157369_10002049 | |||
| 255 | Ga0157372_10005861 | |||
| 256 | Ga0157375_10036641 | |||
| 257 | Ga0182008_10384433 | |||
| 258 | Ga0157377_10833276 | |||
| 259 | Ga0157379_10015103 | |||
| 260 | Ga0157376_10287664 | |||
| 261 | Ga0182006_1001274 | |||
| 262 | Ga0182006_1011355 | |||
| 263 | Ga0163161_10000091 | |||
| 264 | Ga0163161_10038158 | |||
| 265 | Ga0207655_1000003 | |||
| 266 | Ga0207655_1054766 | |||
| 267 | Ga0207713_1047162 | |||
| 268 | Ga0207680_10000138 | |||
| 269 | Ga0207693_10003724 | |||
| 270 | Ga0207663_10145988 | |||
| 271 | Ga0207687_10300653 | |||
| 272 | Ga0207700_10036326 | |||
| 273 | Ga0207686_10143081 | |||
| 274 | Ga0207686_10216584 | |||
| 275 | Ga0207665_10250389 | |||
| 276 | Ga0207711_10301926 | |||
| 277 | Ga0207708_11359559 | |||
| 278 | Ga0209281_1000045 | |||
| 279 | Ga0209489_113286 | |||
| 280 | Ga0209974_10081102 | |||
| 281 | Ga0265318_10060130 | |||
| 282 | Ga0307517_10223484 | |||
| 283 | Ga0265338_10261001 | |||
| 284 | Ga0265332_10150665 | |||
| 285 | Ga0265325_10000524 | |||
| 286 | Ga0265339_10033976 | |||
| 287 | Ga0265331_10314293 | |||
| 288 | Ga0265316_10000434 | |||
| 289 | Ga0265316_10007300 | |||
| 290 | Ga0307408_100000600 | |||
| 291 | Ga0307408_100185756 | |||
| 292 | Ga0265313_10006817 | |||
| 293 | Ga0265342_10142618 | |||
| 294 | Ga0316576_10121252 | |||
| 295 | Ga0307405_10000001 | |||
| 296 | Ga0307405_11257071 | |||
| 297 | Ga0307413_10000001 | |||
| 298 | Ga0307413_10462734 | |||
| 299 | Ga0307410_10000024 | |||
| 300 | Ga0307406_10000028 | |||
| 301 | Ga0307406_10000979 | |||
| 302 | Ga0307407_10052625 | |||
| 303 | Ga0307412_10543146 | |||
| 304 | Ga0307416_100000066 | |||
| 305 | Ga0307414_10000022 | |||
| 306 | Ga0307414_10001546 | |||
| 307 | Ga0307414_10076863 | |||
| 308 | Ga0307414_10127856 | |||
| 309 | Ga0307414_10291352 | |||
| 310 | Ga0307414_11641760 | |||
| 311 | Ga0307411_10000003 | |||
| 312 | Ga0316585_10013423 | |||
| 313 | Ga0307510_10044109 | |||
| 314 | Ga0373955_0201731 | |||
| 315 | Ga0316574_0302145 | |||
| 316 | Ga0316574_0340735 | |||
| 317 | Ga0373937_0004654 | |||
| 318 | Ga0373937_1132692 | |||
| 319 | Ga0316582_0066537 | |||
| 320 | Ga0316584_0178335 | |||
| 321 | Ga0395905_0000001 | |||
| 322 | Ga0439447_000106 | |||
| 323 | Ga0439466_0008226 | |||
| 324 | Ga0451787_192193 | |||
| 325 | Ga0451802_0414641 | |||
| 326 | Ga0451807_2457448 | |||
| 327 | Ga0451807_2751782 | |||
| 328 | Ga0451841_0365778 | |||
| 329 | Ga0451843_0073584 | |||
| 330 | Ga0451855_0965708 | |||
| 331 | Ga0439445_0044788 | |||
| 332 | Ga0439452_017039 | |||
| 333 | Ga0451577_0048817 | |||
| 334 | Ga0451577_0421289 | |||
| 335 | Ga0453683_0000230 | |||
| 336 | Ga0453683_0174746 | |||
| 337 | Ga0466965_0094673 | |||
| 338 | Ga0453684_0040034 | |||
| 339 | Ga0453684_0062713 | |||
| 340 | Ga0453684_0093048 | |||
| 341 | Ga0453684_0158865 | |||
| 342 | Ga0451576_0000180 | |||
| 343 | Ga0451576_0015638 | |||
| 344 | Ga0495627_010032 | |||
| 345 | Ga0495607_0010034 | |||
| 346 | Ga0495607_0279802 | |||
| 347 | Ga0495606_0006217 | |||
| 348 | Ga0495606_0135024 | |||
| 349 | Ga0495610_0051290 | |||
| 350 | Ga0495616_0005577 | |||
| 351 | Ga0495643_0000308 | |||
| 352 | Ga0495644_0040428 | |||
| 353 | Ga0495654_0135881 | |||
| 354 | Ga0495625_0037234 | |||
| 355 | Ga0495625_0088970 | |||
| 356 | Ga0495671_0019640 | |||
| 357 | Ga0495672_0530995 | |||
| 358 | Ga0495681_0147764 | |||
| 359 | Ga0495686_0000551 | |||
| 360 | Ga0496104_0957037 | |||
| 361 | Ga0496111_0842982 | |||
| 362 | Ga0496115_0008392 | |||
| 363 | Ga0496115_0043191 | |||
| 364 | Ga0496116_0000002 | |||
| 365 | Ga0496117_0169448 | |||
| 366 | Ga0496118_0441617 | |||
| 367 | Ga0496121_0074261 | |||
| 368 | Ga0496123_0094107 | |||
| 369 | Ga0496124_0282911 | |||
| 370 | Ga0496124_0501743 | |||
| 371 | Ga0496125_0000108 | |||
| 372 | Ga0496125_0000267 | |||
| 373 | Ga0496126_0023757 | |||
| 374 | Ga0496126_0100902 | |||
| 375 | Ga0496126_0756810 | |||
| 376 | Ga0501039_0121057 | |||
| 377 | Ga0501048_0417392 | |||
| 378 | Ga0501238_000123 | |||
| 379 | Ga0501249_000002 | |||
| 380 | Ga0501249_016219 | |||
| 381 | Ga0501266_000003 | |||
| 382 | Ga0501266_004622 | |||
| 383 | Ga0501280_001933 | |||
| 384 | Ga0501282_010394 | |||
| 385 | Ga0500644_0309899 | |||
| 386 | Ga0500646_0000932 | |||
| 387 | Ga0500646_0022047 | |||
| 388 | Ga0500646_0065216 | |||
| 389 | Ga0500641_0000005 | |||
| 390 | Ga0500641_0000106 | |||
| 391 | Ga0500641_0000409 | |||
| 392 | Ga0500594_0000805 | |||
| 393 | Ga0500658_0000015 | |||
| 394 | Ga0500559_0159891 | |||
| 395 | Ga0500622_0254655 | |||
| 396 | Ga0500584_005442 | |||
| 397 | 2513234706 | |||
| 398 | 2520880468 | |||
| 399 | 2644012131 | |||
| 400 | 2644374563 | |||
| 401 | 2644641404 | |||
| 402 | 2644682478 | |||
| 403 | 2738735816 | |||
| 404 | 2738768393 | |||
| 405 | 2739217398 | |||
| 406 | 2740000352 | |||
| 407 | 2740005168 | |||
| 408 | 2802651250 | |||
| 409 | 2817414132 | |||
| 410 | 2833641608 | |||
| 411 | 2857617793 | |||
| 412 | 2857621391 | |||
| 413 | 2881248856 | |||
| 414 | 2881361437 | |||
| 415 | 2903895212 | |||
| 416 | 2904420391 | |||
| 417 | 2904557763 | |||
| 418 | 2919192403 | |||
| 419 | 2919512679 | |||
| 420 | 2919684190 | |||
| 421 | 2929151286 | |||
| 422 | 2958459559 | |||
| 423 | 2958515582 | |||
| 424 | 2965321238 | |||
| 425 | 2977272664 | |||
| 426 | 8036737050 | |||
| 427 | 8054310868 | |||
| 428 | 8055420122 | |||
| 429 | 8055597009 | |||
| 430 | 8056440900 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okb-assembly1.cif.gz_A | high resolution crystal structures of vaccinia virus dutpase | 0.9311 | 5 | 114 |
| 5y5q-assembly1.cif.gz_C | crystal structure of the wssv dutpase d88n/r158e mutant in complex with dutp | 0.8786 | 3 | 117 |
| 3h6d-assembly1.cif.gz_A | structure of the mycobacterium tuberculosis dutpase d28n mutant | 0.8767 | 1 | 132 |
| 3i93-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase stop138t mutant | 0.8739 | 3 | 132 |
| 7n56-assembly3.cif.gz_K | crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e | 0.8734 | 3 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d4lA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8962 | 13 | 114 | 2.70.40.10 |
| 5y5qC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8786 | 3 | 117 | 2.70.40.10 |
| 5y5qB00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8728 | 3 | 117 | 2.70.40.10 |
| 1xs4F00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8621 | 31 | 114 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8612 | 1 | 131 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9CIF6-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9991 | 1 | 113 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A656KD48-F1-model_v4 | deleted | 0.9964 | 25 | 115 |
|
| AF-A0A355S0S3-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9876 | 1 | 109 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A7X9DHN2-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9849 | 1 | 113 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A7X9CIF6-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9817 | 1 | 113 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |