F325968

General Info

Members Datasets Scaffolds Average Seq Length
215 161 430 144

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10238108|Ga0065714_102381081
Length 163
Sequence MPKEGEKGFPLLSGLKTRFMTVKVINRSTHALPNYETIASAGMDLRANLTESITLKPLERAIVPTGLYIELPIGYEAQVRPRSGLAAKRGVTVLNSPGTVDADYRGEVGVILVNLSNEPFTIENGERIAQMVIAKHERAEWAEVKELAQTSRGEGGFGSTGTK

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
13 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
44 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
77 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
78 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
116 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
117 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
118 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
119 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
123 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
127 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
128 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
129 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
130 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
131 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
132 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
133 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
134 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
135 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
136 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
137 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
138 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
139 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
140 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
141 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
142 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
143 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
144 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
145 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
146 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
147 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
148 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
149 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
150 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
151 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
152 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
153 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
154 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
155 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
156 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
157 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
158 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
159 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
160 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
161 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.72
Metatranscriptomes 0.47
Isolates 15.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 1.86
Rhizoplane 3.72
Rhizosphere 71.63
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10238108 3300005288 Bacteria 801
2 SwRhRL2b_contig_1163591 2162886007 Bacteria 1751
3 rootL2_10119274 3300003322 Bacteria 1582
4 rootL2_10137277 3300003322 Bacteria 1587
5 Ga0006562J51391_1010105 3300003578 Bacteria 7110
6 Ga0065714_10004665 3300005288 Bacteria 7459
7 Ga0065714_10018601 3300005288 Bacteria 2553
8 Ga0065714_10069705 3300005288 Bacteria 4117
9 Ga0065714_10162730 3300005288 Bacteria 1018
10 Ga0065704_10073530 3300005289 Bacteria 7059
11 Ga0065704_10084039 3300005289 Bacteria 3385
12 Ga0065715_10011160 3300005293 Bacteria 3184
13 Ga0065715_10093480 3300005293 Bacteria 4662
14 Ga0065715_10173541 3300005293 Bacteria 1529
15 Ga0065715_10607783 3300005293 Bacteria 703
16 Ga0070682_100012882 3300005337 Bacteria 4800
17 Ga0070685_10003296 3300005466 Bacteria 8199
18 Ga0070693_100086757 3300005547 Bacteria 1878
19 Ga0068855_100140219 3300005563 Bacteria 2756
20 Ga0070712_100000208 3300006175 Bacteria 33143
21 Ga0099824_1000500 3300006942 Bacteria 46562
22 Ga0079104_1000079 3300006946 Bacteria 141480
23 Ga0105251_10054114 3300009011 Bacteria 1907
24 Ga0105244_10000054 3300009036 Bacteria 133715
25 Ga0105244_10014980 3300009036 Bacteria 4460
26 Ga0105244_10260747 3300009036 Bacteria 807
27 Ga0105245_10047981 3300009098 Bacteria 3819
28 Ga0105242_10154857 3300009176 Bacteria 2001
29 Ga0105242_10355042 3300009176 Bacteria 1355
30 Ga0105248_10359116 3300009177 Bacteria 1640
31 Ga0157373_10000035 3300013100 Bacteria 123284
32 Ga0157371_10002400 3300013102 Bacteria 17928
33 Ga0157371_10072279 3300013102 Bacteria 2442
34 Ga0157370_10007281 3300013104 Bacteria 12078
35 Ga0157370_10009318 3300013104 Bacteria 10511
36 Ga0157370_10009838 3300013104 Bacteria 10134
37 Ga0157370_10099986 3300013104 Bacteria 2718
38 Ga0157370_10970818 3300013104 Bacteria 770
39 Ga0157369_10002049 3300013105 Bacteria 24325
40 Ga0157372_10005861 3300013307 Bacteria 13080
41 Ga0157375_10036641 3300013308 Bacteria 4694
42 Ga0182008_10384433 3300014497 Bacteria 751
43 Ga0157377_10833276 3300014745 Bacteria 683
44 Ga0157379_10015103 3300014968 Bacteria 6773
45 Ga0157376_10287664 3300014969 Bacteria 1551
46 Ga0182006_1001274 3300015261 Bacteria 15541
47 Ga0182006_1011355 3300015261 Bacteria 3922
48 Ga0163161_10000091 3300017792 Bacteria 90927
49 Ga0163161_10038158 3300017792 Bacteria 3445
50 Ga0207655_1000003 3300025728 Bacteria 1081376
51 Ga0207655_1054766 3300025728 Bacteria 1583
52 Ga0207713_1047162 3300025735 Bacteria 1745
53 Ga0207680_10000138 3300025903 Bacteria 34644
54 Ga0207693_10003724 3300025915 Bacteria 12993
55 Ga0207663_10145988 3300025916 Bacteria 1654
56 Ga0207687_10300653 3300025927 Bacteria 1292
57 Ga0207700_10036326 3300025928 Bacteria 3557
58 Ga0207686_10143081 3300025934 Bacteria 1656
59 Ga0207686_10216584 3300025934 Bacteria 1380
60 Ga0207665_10250389 3300025939 Bacteria 1309
61 Ga0207711_10301926 3300025941 Bacteria 1477
62 Ga0207708_11359559 3300026075 Bacteria 623
63 Ga0209281_1000045 3300027111 Bacteria 328124
64 Ga0209489_113286 3300027361 Bacteria 6759
65 Ga0209974_10081102 3300027876 Bacteria 1116
66 Ga0265318_10060130 3300028577 Bacteria 1416
67 Ga0307517_10223484 3300028786 Bacteria 1141
68 Ga0265338_10261001 3300028800 Bacteria 1273
69 Ga0265332_10150665 3300031238 Bacteria 973
70 Ga0265325_10000524 3300031241 Bacteria 27640
71 Ga0265339_10033976 3300031249 Bacteria 2868
72 Ga0265331_10314293 3300031250 Bacteria 702
73 Ga0265316_10000434 3300031344 Bacteria 47748
74 Ga0265316_10007300 3300031344 Bacteria 10425
75 Ga0307408_100000600 3300031548 Bacteria 30960
76 Ga0307408_100185756 3300031548 Bacteria 1671
77 Ga0265313_10006817 3300031595 Bacteria 7977
78 Ga0265342_10142618 3300031712 Bacteria 1336
79 Ga0316576_10121252 3300031727 Bacteria 1963
80 Ga0307405_10000001 3300031731 Bacteria 1731270
81 Ga0307405_11257071 3300031731 Bacteria 642
82 Ga0307413_10000001 3300031824 Bacteria 159157
83 Ga0307413_10462734 3300031824 Bacteria 1009
84 Ga0307410_10000024 3300031852 Bacteria 59872
85 Ga0307406_10000028 3300031901 Bacteria 91602
86 Ga0307406_10000979 3300031901 Bacteria 15930
87 Ga0307407_10052625 3300031903 Bacteria 2339
88 Ga0307412_10543146 3300031911 Bacteria 975
89 Ga0307416_100000066 3300032002 Bacteria 94549
90 Ga0307414_10000022 3300032004 Bacteria 212123
91 Ga0307414_10001546 3300032004 Bacteria 11955
92 Ga0307414_10076863 3300032004 Bacteria 2427
93 Ga0307414_10127856 3300032004 Bacteria 1966
94 Ga0307414_10291352 3300032004 Bacteria 1376
95 Ga0307414_11641760 3300032004 Bacteria 599
96 Ga0307411_10000003 3300032005 Bacteria 477556
97 Ga0316585_10013423 3300032137 Unclassified 2438
98 Ga0307510_10044109 3300033180 Bacteria 4835
99 Ga0373955_0201731 3300035172 Bacteria 1184
100 Ga0316574_0302145 3300035398 Bacteria 1017
101 Ga0316574_0340735 3300035398 Unclassified 950
102 Ga0373937_0004654 3300036401 Bacteria 11654
103 Ga0373937_1132692 3300036401 Bacteria 731
104 Ga0316582_0066537 3300036647 Unclassified 2323
105 Ga0316584_0178335 3300036712 Unclassified 1573
106 Ga0395905_0000001 3300037471 Bacteria 2037079
107 Ga0439447_000106 3300041407 Bacteria 28341
108 Ga0439466_0008226 3300041411 Bacteria 3933
109 Ga0451787_192193 3300041441 Bacteria 605
110 Ga0451802_0414641 3300041460 Bacteria 631
111 Ga0451807_2457448 3300041486 Bacteria 603
112 Ga0451807_2751782 3300041486 Bacteria 859
113 Ga0451841_0365778 3300041498 Bacteria 823
114 Ga0451843_0073584 3300041509 Bacteria 1250
115 Ga0451855_0965708 3300041511 Bacteria 717
116 Ga0439445_0044788 3300042004 Bacteria 1183
117 Ga0439452_017039 3300042010 Bacteria 1963
118 Ga0451577_0048817 3300042876 Bacteria 3780
119 Ga0451577_0421289 3300042876 Bacteria 1212
120 Ga0453683_0000230 3300044673 Bacteria 74466
121 Ga0453683_0174746 3300044673 Bacteria 1361
122 Ga0466965_0094673 3300044683 Bacteria 1522
123 Ga0453684_0040034 3300044712 Bacteria 6373
124 Ga0453684_0062713 3300044712 Bacteria 4759
125 Ga0453684_0093048 3300044712 Bacteria 3714
126 Ga0453684_0158865 3300044712 Bacteria 2676
127 Ga0451576_0000180 3300045051 Bacteria 159491
128 Ga0451576_0015638 3300045051 Bacteria 8398
129 Ga0495627_010032 3300046453 Bacteria 3462
130 Ga0495607_0010034 3300046501 Bacteria 6380
131 Ga0495607_0279802 3300046501 Bacteria 792
132 Ga0495606_0006217 3300046507 Bacteria 11098
133 Ga0495606_0135024 3300046507 Bacteria 1462
134 Ga0495610_0051290 3300046512 Bacteria 2009
135 Ga0495616_0005577 3300046513 Bacteria 7718
136 Ga0495643_0000308 3300046522 Bacteria 67404
137 Ga0495644_0040428 3300046523 Bacteria 1758
138 Ga0495654_0135881 3300046530 Bacteria 1100
139 Ga0495625_0037234 3300046660 Bacteria 3571
140 Ga0495625_0088970 3300046660 Bacteria 2138
141 Ga0495671_0019640 3300046692 Bacteria 3568
142 Ga0495672_0530995 3300047320 Bacteria 519
143 Ga0495681_0147764 3300047470 Bacteria 988
144 Ga0495686_0000551 3300047472 Bacteria 53580
145 Ga0496104_0957037 3300048907 Bacteria 761
146 Ga0496111_0842982 3300048914 Bacteria 662
147 Ga0496115_0008392 3300048918 Bacteria 7645
148 Ga0496115_0043191 3300048918 Bacteria 3594
149 Ga0496116_0000002 3300048919 Bacteria 920291
150 Ga0496117_0169448 3300048920 Bacteria 1269
151 Ga0496118_0441617 3300048921 Bacteria 663
152 Ga0496121_0074261 3300048924 Bacteria 2721
153 Ga0496123_0094107 3300048926 Bacteria 1767
154 Ga0496124_0282911 3300048927 Bacteria 1208
155 Ga0496124_0501743 3300048927 Bacteria 813
156 Ga0496125_0000108 3300048928 Bacteria 196060
157 Ga0496125_0000267 3300048928 Bacteria 107026
158 Ga0496126_0023757 3300048929 Bacteria 5935
159 Ga0496126_0100902 3300048929 Bacteria 2525
160 Ga0496126_0756810 3300048929 Bacteria 749
161 Ga0501039_0121057 3300049575 Bacteria 2051
162 Ga0501048_0417392 3300049582 Bacteria 960
163 Ga0501238_000123 3300049671 Bacteria 12106
164 Ga0501249_000002 3300049679 Bacteria 262756
165 Ga0501249_016219 3300049679 Bacteria 1598
166 Ga0501266_000003 3300049763 Bacteria 388836
167 Ga0501266_004622 3300049763 Bacteria 1708
168 Ga0501280_001933 3300049776 Bacteria 3613
169 Ga0501282_010394 3300049778 Bacteria 999
170 Ga0500644_0309899 3300053088 Bacteria 677
171 Ga0500646_0000932 3300053090 Bacteria 8048
172 Ga0500646_0022047 3300053090 Bacteria 1701
173 Ga0500646_0065216 3300053090 Bacteria 1081
174 Ga0500641_0000005 3300053096 Bacteria 226810
175 Ga0500641_0000106 3300053096 Bacteria 31895
176 Ga0500641_0000409 3300053096 Bacteria 15914
177 Ga0500594_0000805 3300053118 Bacteria 6691
178 Ga0500658_0000015 3300053134 Bacteria 151134
179 Ga0500559_0159891 3300053136 Bacteria 1058
180 Ga0500622_0254655 3300053156 Bacteria 769
181 Ga0500584_005442 3300053726 Bacteria 5347
182 2513234706 2513020052 Bacteria 5120511
183 2520880468 2519899754 Bacteria 5336938
184 2644012131 2643221600 Bacteria 5530138
185 2644374563 2643221667 Bacteria 5627472
186 2644641404 2643221716 Bacteria 4986332
187 2644682478 2643221725 Bacteria 5087956
188 2738735816 2738541279 Bacteria 6149495
189 2738768393 2738541285 Bacteria 6150075
190 2739217398 2738543007 Bacteria 6149845
191 2740000352 2739367857 Bacteria 5433684
192 2740005168 2739367858 Bacteria 5432813
193 2802651250 2802428842 Bacteria 4926114
194 2817414132 2816332280 Bacteria 5109718
195 2833641608 2833640130 Bacteria 4858325
196 2857617793 2857613821 Bacteria 4917088
197 2857621391 2857618242 Bacteria 5635925
198 2881248856 2881247448 Bacteria 3717788
199 2881361437 2881359912 Bacteria 4935907
200 2903895212 2903895155 Bacteria 5258610
201 2904420391 2904419702 Bacteria 5166287
202 2904557763 2904555929 Bacteria 5218588
203 2919192403 2919191525 Bacteria 5765973
204 2919512679 2919509842 Bacteria 4104664
205 2919684190 2919683626 Bacteria 5534354
206 2929151286 2929150217 Bacteria 5462483
207 2958459559 2958458903 Bacteria 5301041
208 2958515582 2958512119 Bacteria 4528530
209 2965321238 2965320100 Bacteria 3975600
210 2977272664 2977268062 Bacteria 5243061
211 8036737050 8036736890 Bacteria 2944828
212 8054310868 8054307821 Bacteria 5212224
213 8055420122 8055419101 Bacteria 5289643
214 8055597009 8055592153 Bacteria 5961247
215 8056440900 8056440228 Bacteria 4946504
216 Ga0065714_10238108
217 SwRhRL2b_contig_1163591
218 rootL2_10119274
219 rootL2_10137277
220 Ga0006562J51391_1010105
221 Ga0065714_10004665
222 Ga0065714_10018601
223 Ga0065714_10069705
224 Ga0065714_10162730
225 Ga0065704_10073530
226 Ga0065704_10084039
227 Ga0065715_10011160
228 Ga0065715_10093480
229 Ga0065715_10173541
230 Ga0065715_10607783
231 Ga0070682_100012882
232 Ga0070685_10003296
233 Ga0070693_100086757
234 Ga0068855_100140219
235 Ga0070712_100000208
236 Ga0099824_1000500
237 Ga0079104_1000079
238 Ga0105251_10054114
239 Ga0105244_10000054
240 Ga0105244_10014980
241 Ga0105244_10260747
242 Ga0105245_10047981
243 Ga0105242_10154857
244 Ga0105242_10355042
245 Ga0105248_10359116
246 Ga0157373_10000035
247 Ga0157371_10002400
248 Ga0157371_10072279
249 Ga0157370_10007281
250 Ga0157370_10009318
251 Ga0157370_10009838
252 Ga0157370_10099986
253 Ga0157370_10970818
254 Ga0157369_10002049
255 Ga0157372_10005861
256 Ga0157375_10036641
257 Ga0182008_10384433
258 Ga0157377_10833276
259 Ga0157379_10015103
260 Ga0157376_10287664
261 Ga0182006_1001274
262 Ga0182006_1011355
263 Ga0163161_10000091
264 Ga0163161_10038158
265 Ga0207655_1000003
266 Ga0207655_1054766
267 Ga0207713_1047162
268 Ga0207680_10000138
269 Ga0207693_10003724
270 Ga0207663_10145988
271 Ga0207687_10300653
272 Ga0207700_10036326
273 Ga0207686_10143081
274 Ga0207686_10216584
275 Ga0207665_10250389
276 Ga0207711_10301926
277 Ga0207708_11359559
278 Ga0209281_1000045
279 Ga0209489_113286
280 Ga0209974_10081102
281 Ga0265318_10060130
282 Ga0307517_10223484
283 Ga0265338_10261001
284 Ga0265332_10150665
285 Ga0265325_10000524
286 Ga0265339_10033976
287 Ga0265331_10314293
288 Ga0265316_10000434
289 Ga0265316_10007300
290 Ga0307408_100000600
291 Ga0307408_100185756
292 Ga0265313_10006817
293 Ga0265342_10142618
294 Ga0316576_10121252
295 Ga0307405_10000001
296 Ga0307405_11257071
297 Ga0307413_10000001
298 Ga0307413_10462734
299 Ga0307410_10000024
300 Ga0307406_10000028
301 Ga0307406_10000979
302 Ga0307407_10052625
303 Ga0307412_10543146
304 Ga0307416_100000066
305 Ga0307414_10000022
306 Ga0307414_10001546
307 Ga0307414_10076863
308 Ga0307414_10127856
309 Ga0307414_10291352
310 Ga0307414_11641760
311 Ga0307411_10000003
312 Ga0316585_10013423
313 Ga0307510_10044109
314 Ga0373955_0201731
315 Ga0316574_0302145
316 Ga0316574_0340735
317 Ga0373937_0004654
318 Ga0373937_1132692
319 Ga0316582_0066537
320 Ga0316584_0178335
321 Ga0395905_0000001
322 Ga0439447_000106
323 Ga0439466_0008226
324 Ga0451787_192193
325 Ga0451802_0414641
326 Ga0451807_2457448
327 Ga0451807_2751782
328 Ga0451841_0365778
329 Ga0451843_0073584
330 Ga0451855_0965708
331 Ga0439445_0044788
332 Ga0439452_017039
333 Ga0451577_0048817
334 Ga0451577_0421289
335 Ga0453683_0000230
336 Ga0453683_0174746
337 Ga0466965_0094673
338 Ga0453684_0040034
339 Ga0453684_0062713
340 Ga0453684_0093048
341 Ga0453684_0158865
342 Ga0451576_0000180
343 Ga0451576_0015638
344 Ga0495627_010032
345 Ga0495607_0010034
346 Ga0495607_0279802
347 Ga0495606_0006217
348 Ga0495606_0135024
349 Ga0495610_0051290
350 Ga0495616_0005577
351 Ga0495643_0000308
352 Ga0495644_0040428
353 Ga0495654_0135881
354 Ga0495625_0037234
355 Ga0495625_0088970
356 Ga0495671_0019640
357 Ga0495672_0530995
358 Ga0495681_0147764
359 Ga0495686_0000551
360 Ga0496104_0957037
361 Ga0496111_0842982
362 Ga0496115_0008392
363 Ga0496115_0043191
364 Ga0496116_0000002
365 Ga0496117_0169448
366 Ga0496118_0441617
367 Ga0496121_0074261
368 Ga0496123_0094107
369 Ga0496124_0282911
370 Ga0496124_0501743
371 Ga0496125_0000108
372 Ga0496125_0000267
373 Ga0496126_0023757
374 Ga0496126_0100902
375 Ga0496126_0756810
376 Ga0501039_0121057
377 Ga0501048_0417392
378 Ga0501238_000123
379 Ga0501249_000002
380 Ga0501249_016219
381 Ga0501266_000003
382 Ga0501266_004622
383 Ga0501280_001933
384 Ga0501282_010394
385 Ga0500644_0309899
386 Ga0500646_0000932
387 Ga0500646_0022047
388 Ga0500646_0065216
389 Ga0500641_0000005
390 Ga0500641_0000106
391 Ga0500641_0000409
392 Ga0500594_0000805
393 Ga0500658_0000015
394 Ga0500559_0159891
395 Ga0500622_0254655
396 Ga0500584_005442
397 2513234706
398 2520880468
399 2644012131
400 2644374563
401 2644641404
402 2644682478
403 2738735816
404 2738768393
405 2739217398
406 2740000352
407 2740005168
408 2802651250
409 2817414132
410 2833641608
411 2857617793
412 2857621391
413 2881248856
414 2881361437
415 2903895212
416 2904420391
417 2904557763
418 2919192403
419 2919512679
420 2919684190
421 2929151286
422 2958459559
423 2958515582
424 2965321238
425 2977272664
426 8036737050
427 8054310868
428 8055420122
429 8055597009
430 8056440900

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

28

161

0.93

PF22769

DCD

dCTP deaminase-like

16

136

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.9311 5 114
5y5q-assembly1.cif.gz_C crystal structure of the wssv dutpase d88n/r158e mutant in complex with dutp 0.8786 3 117
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.8767 1 132
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.8739 3 132
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.8734 3 129
ID Description Score Start End Superfamily
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8962 13 114 2.70.40.10
5y5qC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8786 3 117 2.70.40.10
5y5qB00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8728 3 117 2.70.40.10
1xs4F00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8621 31 114 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8612 1 131 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A7X9CIF6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9991 1 113 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A656KD48-F1-model_v4 deleted 0.9964 25 115
AF-A0A355S0S3-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9876 1 109 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A7X9DHN2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9849 1 113 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A7X9CIF6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9817 1 113 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map