F326071

General Info

Members Datasets Scaffolds Average Seq Length
215 125 430 230

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10151851|Ga0070691_101518512
Length 246
Sequence MSRESPEPILRCAGVGKSFGPPSRRVEVLRGLDLAVARGEMVAVLGESGTGKTTLLHLVGAIDRPDSGVILFRGRDIGAAPPQERAVYRNRDLGFVFQLHHLLPEFSAVENAMMPLLIRGEDRGKARDRSLALLQELGLKDCADRRPSELSGGEQQRVAIARAIAGSPALLLADEPTGNLDERNAEVVFGLLSELHRRRGMTTLFVTHSARLAEKCSRILKMEHGSLTDPAGTRYNVEASTTQAPR

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 0
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10151851 3300005341 Bacteria 1188
2 MBSR1b_contig_1818550 2162886012 Bacteria 2437
3 Ga0055530_10009671 3300003791 Bacteria 3672
4 Ga0065715_10103349 3300005293 Bacteria 3040
5 Ga0070658_10357824 3300005327 Bacteria 1250
6 Ga0070683_100003160 3300005329 Bacteria 13282
7 Ga0070683_100245692 3300005329 Bacteria 1702
8 Ga0070670_100290969 3300005331 Bacteria 1427
9 Ga0070666_10383650 3300005335 Bacteria 1009
10 Ga0070680_100108300 3300005336 Bacteria 2311
11 Ga0070689_100104086 3300005340 Bacteria 2250
12 Ga0070661_100025689 3300005344 Bacteria 4234
13 Ga0070692_10000168 3300005345 Bacteria 16725
14 Ga0070668_100536694 3300005347 Unclassified 1016
15 Ga0070675_100569694 3300005354 Bacteria 1025
16 Ga0070671_100205333 3300005355 Bacteria 1671
17 Ga0070671_100280130 3300005355 Bacteria 1418
18 Ga0070659_100015027 3300005366 Bacteria 5791
19 Ga0070694_100000745 3300005444 Bacteria 18251
20 Ga0070694_100124340 3300005444 Bacteria 1855
21 Ga0070694_100596575 3300005444 Bacteria 889
22 Ga0070678_100331322 3300005456 Bacteria 1303
23 Ga0070681_10030653 3300005458 Bacteria 5397
24 Ga0070707_100001993 3300005468 Bacteria 19536
25 Ga0070707_100225152 3300005468 Bacteria 1826
26 Ga0070698_100032644 3300005471 Bacteria 5391
27 Ga0070698_100131410 3300005471 Bacteria 2459
28 Ga0070699_100001628 3300005518 Bacteria 20479
29 Ga0070679_100068491 3300005530 Bacteria 3540
30 Ga0070679_100077406 3300005530 Bacteria 3315
31 Ga0070684_100034464 3300005535 Bacteria 4329
32 Ga0070684_100048349 3300005535 Bacteria 3690
33 Ga0070697_100000254 3300005536 Bacteria 43120
34 Ga0070697_100016630 3300005536 Bacteria 5786
35 Ga0070697_100096632 3300005536 Bacteria 2451
36 Ga0068853_100000003 3300005539 Bacteria 434636
37 Ga0068853_100192893 3300005539 Bacteria 1852
38 Ga0070686_100149119 3300005544 Bacteria 1636
39 Ga0070665_100076743 3300005548 Bacteria 3348
40 Ga0070704_100018304 3300005549 Bacteria 4476
41 Ga0068855_100002890 3300005563 Bacteria 21019
42 Ga0068855_100356132 3300005563 Bacteria 1611
43 Ga0070664_100161157 3300005564 Bacteria 1985
44 Ga0068854_100695201 3300005578 Bacteria 877
45 Ga0068856_100011401 3300005614 Bacteria 8622
46 Ga0068858_100185632 3300005842 Bacteria 1964
47 Ga0081455_10100100 3300005937 Bacteria 2329
48 Ga0081540_1037338 3300005983 Unclassified 2577
49 Ga0075366_10239965 3300006195 Bacteria 1105
50 Ga0075428_100000455 3300006844 Bacteria 41001
51 Ga0075428_100010681 3300006844 Bacteria 10206
52 Ga0075430_100337908 3300006846 Bacteria 1244
53 Ga0075431_100020527 3300006847 Bacteria 6750
54 Ga0075431_100041398 3300006847 Bacteria 4749
55 Ga0075431_100189447 3300006847 Bacteria 2108
56 Ga0075431_100287111 3300006847 Bacteria 1665
57 Ga0075431_100415934 3300006847 Bacteria 1344
58 Ga0075433_10598536 3300006852 Bacteria 968
59 Ga0075434_100515657 3300006871 Bacteria 1216
60 Ga0075429_100097197 3300006880 Bacteria 2569
61 Ga0105240_10000007 3300009093 Bacteria 619357
62 Ga0105240_10206140 3300009093 Bacteria 2301
63 Ga0105240_10677586 3300009093 Bacteria 1128
64 Ga0114129_10010305 3300009147 Bacteria 13336
65 Ga0114129_10035854 3300009147 Bacteria 7005
66 Ga0114129_10064863 3300009147 Bacteria 5098
67 Ga0114129_10330226 3300009147 Bacteria 2025
68 Ga0105238_10166087 3300009551 Bacteria 2183
69 Ga0105239_10055384 3300010375 Bacteria 4349
70 Ga0105239_10163574 3300010375 Bacteria 2488
71 Ga0157370_10031047 3300013104 Bacteria 5230
72 Ga0157369_10172531 3300013105 Bacteria 2278
73 Ga0157372_10047293 3300013307 Bacteria 4780
74 Ga0157375_10540551 3300013308 Bacteria 1327
75 Ga0182008_10363027 3300014497 Bacteria 771
76 Ga0206354_11397771 3300020081 Bacteria 901
77 Ga0206353_10929808 3300020082 Bacteria 11176
78 Ga0213876_10051808 3300021384 Bacteria 2169
79 Ga0209050_1000369 3300025298 Bacteria 86187
80 Ga0207684_10002161 3300025910 Bacteria 20150
81 Ga0207707_10289550 3300025912 Bacteria 1417
82 Ga0207707_10770424 3300025912 Bacteria 803
83 Ga0207695_10000099 3300025913 Bacteria 259595
84 Ga0207695_10255169 3300025913 Bacteria 1652
85 Ga0207660_10109463 3300025917 Bacteria 2076
86 Ga0207657_10045391 3300025919 Bacteria 3857
87 Ga0207652_10047309 3300025921 Bacteria 3674
88 Ga0207652_10150284 3300025921 Bacteria 2085
89 Ga0207646_10007793 3300025922 Bacteria 10831
90 Ga0207646_10195632 3300025922 Bacteria 1826
91 Ga0207650_10505473 3300025925 Bacteria 1010
92 Ga0207690_10193936 3300025932 Bacteria 1538
93 Ga0207670_10079610 3300025936 Bacteria 2288
94 Ga0207691_10557460 3300025940 Bacteria 971
95 Ga0207661_10039394 3300025944 Bacteria 3709
96 Ga0207661_10087576 3300025944 Bacteria 2586
97 Ga0207679_10782263 3300025945 Bacteria 869
98 Ga0207667_10009827 3300025949 Bacteria 11244
99 Ga0207703_10182020 3300026035 Bacteria 1855
100 Ga0207639_10000002 3300026041 Bacteria 903066
101 Ga0207639_10314592 3300026041 Bacteria 1388
102 Ga0207702_10003346 3300026078 Bacteria 14701
103 Ga0207702_10821724 3300026078 Bacteria 919
104 Ga0207683_10175501 3300026121 Bacteria 1942
105 Ga0207698_10106956 3300026142 Bacteria 2334
106 Ga0268266_10075540 3300028379 Bacteria 2927
107 Ga0268264_10086008 3300028381 Bacteria 2700
108 Ga0310981_1059735 3300029285 Bacteria 885
109 Ga0265339_10148591 3300031249 Bacteria 1187
110 Ga0265327_10000729 3300031251 Bacteria 51312
111 Ga0265327_10011681 3300031251 Bacteria 6019
112 Ga0265327_10081056 3300031251 Bacteria 1603
113 Ga0265316_10320023 3300031344 Bacteria 1127
114 Ga0316579_10181612 3300031691 Bacteria 1017
115 Ga0316576_10071564 3300031727 Bacteria 2558
116 Ga0316576_10112319 3300031727 Unclassified 2043
117 Ga0316576_10123177 3300031727 Unclassified 1948
118 Ga0316576_10167344 3300031727 Bacteria 1659
119 Ga0316576_10209301 3300031727 Bacteria 1468
120 Ga0316576_10263908 3300031727 Bacteria 1292
121 Ga0316577_10002938 3300031733 Bacteria 8527
122 Ga0316577_10235738 3300031733 Bacteria 1035
123 Ga0373946_0073124 3300035171 Bacteria 1485
124 Ga0373961_0021018 3300035241 Bacteria 1732
125 Ga0316574_0234873 3300035398 Bacteria 1173
126 Ga0373931_0278035 3300035691 Bacteria 1027
127 Ga0373927_0151758 3300035695 Bacteria 1517
128 Ga0316582_0069819 3300036647 Bacteria 2272
129 Ga0316582_0139511 3300036647 Bacteria 1634
130 Ga0316582_0349023 3300036647 Bacteria 1018
131 Ga0316584_0045828 3300036712 Bacteria 3265
132 Ga0316584_0084042 3300036712 Bacteria 2384
133 Ga0316584_0154207 3300036712 Bacteria 1709
134 Ga0316584_0285147 3300036712 Unclassified 1199
135 Ga0395905_0221155 3300037471 Bacteria 1772
136 Ga0400489_24770 3300039093 Bacteria 3840
137 Ga0436365_0496829 3300039437 Bacteria 2324
138 Ga0451577_0000379 3300042876 Bacteria 82741
139 Ga0451577_0007816 3300042876 Bacteria 10463
140 Ga0451577_0016627 3300042876 Bacteria 6806
141 Ga0451577_0022557 3300042876 Bacteria 5748
142 Ga0451577_0029177 3300042876 Bacteria 4986
143 Ga0451577_0146026 3300042876 Bacteria 2127
144 Ga0451577_0196907 3300042876 Unclassified 1819
145 Ga0451577_0346063 3300042876 Bacteria 1349
146 Ga0453683_0000005 3300044673 Bacteria 741657
147 Ga0453683_0000195 3300044673 Bacteria 82741
148 Ga0453683_0002345 3300044673 Bacteria 14846
149 Ga0453683_0003763 3300044673 Bacteria 11067
150 Ga0453683_0008318 3300044673 Bacteria 6973
151 Ga0453683_0011300 3300044673 Bacteria 5890
152 Ga0453683_0038376 3300044673 Bacteria 3011
153 Ga0453683_0081922 3300044673 Bacteria 2022
154 Ga0453683_0283644 3300044673 Bacteria 1058
155 Ga0453683_0314102 3300044673 Bacteria 1003
156 Ga0453683_0555871 3300044673 Bacteria 747
157 Ga0466963_0067435 3300044694 Bacteria 2401
158 Ga0453684_0000603 3300044712 Bacteria 132340
159 Ga0453684_0001143 3300044712 Bacteria 82832
160 Ga0453684_0001147 3300044712 Bacteria 82741
161 Ga0453684_0001234 3300044712 Bacteria 77976
162 Ga0453684_0016697 3300044712 Bacteria 11448
163 Ga0453684_0017624 3300044712 Bacteria 11042
164 Ga0453684_0110514 3300044712 Bacteria 3341
165 Ga0453684_0129141 3300044712 Bacteria 3035
166 Ga0453684_0201726 3300044712 Bacteria 2318
167 Ga0453684_0206438 3300044712 Bacteria 2286
168 Ga0453684_0254692 3300044712 Bacteria 2014
169 Ga0453684_0895954 3300044712 Bacteria 950
170 Ga0466959_0022143 3300045049 Bacteria 4695
171 Ga0451576_0000397 3300045051 Bacteria 101182
172 Ga0451576_0000528 3300045051 Bacteria 82741
173 Ga0451576_0009998 3300045051 Bacteria 10934
174 Ga0451576_0019228 3300045051 Bacteria 7458
175 Ga0451576_0025215 3300045051 Bacteria 6408
176 Ga0451576_0025393 3300045051 Bacteria 6382
177 Ga0451576_0079068 3300045051 Bacteria 3422
178 Ga0451576_0197728 3300045051 Bacteria 2100
179 Ga0451576_0531775 3300045051 Bacteria 1235
180 Ga0451576_1110767 3300045051 Bacteria 827
181 Ga0466958_0178935 3300045836 Bacteria 1345
182 Ga0466967_0004542 3300045976 Bacteria 9392
183 Ga0466967_0052168 3300045976 Bacteria 3588
184 Ga0495639_0079619 3300046475 Bacteria 1524
185 Ga0495662_0024011 3300046476 Bacteria 2942
186 Ga0495664_0099299 3300046477 Bacteria 1753
187 Ga0495618_0165935 3300046514 Bacteria 1406
188 Ga0495628_0044038 3300046516 Bacteria 3552
189 Ga0495630_0030697 3300046517 Bacteria 3999
190 Ga0495643_0000169 3300046522 Bacteria 103635
191 Ga0495634_0142721 3300046642 Bacteria 1519
192 Ga0495646_0238760 3300046680 Bacteria 977
193 Ga0495674_0502995 3300047319 Bacteria 969
194 Ga0496121_0173806 3300048924 Bacteria 1562
195 Ga0501034_0106033 3300049571 Bacteria 2803
196 Ga0501047_0243839 3300049581 Bacteria 1647
197 Ga0501047_0668972 3300049581 Unclassified 857
198 Ga0501080_0079647 3300049742 Bacteria 3045
199 Ga0501080_0129948 3300049742 Bacteria 2331
200 Ga0501080_0186488 3300049742 Bacteria 1907
201 Ga0501080_0215542 3300049742 Bacteria 1758
202 Ga0501044_0612634 3300049823 Bacteria 981
203 nmdc:mga0k408_222951_c1 3300050493 Bacteria 1125
204 nmdc:mga05p37_1040719_c1 3300050507 Bacteria 865
205 nmdc:mga05p37_646443_c1 3300050507 Bacteria 1185
206 nmdc:mga05p37_96672_c1 3300050507 Bacteria 3639
207 nmdc:mga0qj67_18757_c1 3300050509 Bacteria 5274
208 nmdc:mga06r32_125180_c1 3300050510 Bacteria 2538
209 nmdc:mga06r32_188972_c1 3300050510 Bacteria 2047
210 nmdc:mga06r32_268537_c1 3300050510 Bacteria 1693
211 nmdc:mga06r32_516051_c1 3300050510 Bacteria 1171
212 nmdc:mga08y16_50238_c1 3300050511 Bacteria 4364
213 Ga0495619_0000155 3300053085 Bacteria 50682
214 Ga0500568_0004096 3300053139 Bacteria 7892
215 Ga0500616_0013065 3300053153 Bacteria 4835
216 Ga0070691_10151851
217 MBSR1b_contig_1818550
218 Ga0055530_10009671
219 Ga0065715_10103349
220 Ga0070658_10357824
221 Ga0070683_100003160
222 Ga0070683_100245692
223 Ga0070670_100290969
224 Ga0070666_10383650
225 Ga0070680_100108300
226 Ga0070689_100104086
227 Ga0070661_100025689
228 Ga0070692_10000168
229 Ga0070668_100536694
230 Ga0070675_100569694
231 Ga0070671_100205333
232 Ga0070671_100280130
233 Ga0070659_100015027
234 Ga0070694_100000745
235 Ga0070694_100124340
236 Ga0070694_100596575
237 Ga0070678_100331322
238 Ga0070681_10030653
239 Ga0070707_100001993
240 Ga0070707_100225152
241 Ga0070698_100032644
242 Ga0070698_100131410
243 Ga0070699_100001628
244 Ga0070679_100068491
245 Ga0070679_100077406
246 Ga0070684_100034464
247 Ga0070684_100048349
248 Ga0070697_100000254
249 Ga0070697_100016630
250 Ga0070697_100096632
251 Ga0068853_100000003
252 Ga0068853_100192893
253 Ga0070686_100149119
254 Ga0070665_100076743
255 Ga0070704_100018304
256 Ga0068855_100002890
257 Ga0068855_100356132
258 Ga0070664_100161157
259 Ga0068854_100695201
260 Ga0068856_100011401
261 Ga0068858_100185632
262 Ga0081455_10100100
263 Ga0081540_1037338
264 Ga0075366_10239965
265 Ga0075428_100000455
266 Ga0075428_100010681
267 Ga0075430_100337908
268 Ga0075431_100020527
269 Ga0075431_100041398
270 Ga0075431_100189447
271 Ga0075431_100287111
272 Ga0075431_100415934
273 Ga0075433_10598536
274 Ga0075434_100515657
275 Ga0075429_100097197
276 Ga0105240_10000007
277 Ga0105240_10206140
278 Ga0105240_10677586
279 Ga0114129_10010305
280 Ga0114129_10035854
281 Ga0114129_10064863
282 Ga0114129_10330226
283 Ga0105238_10166087
284 Ga0105239_10055384
285 Ga0105239_10163574
286 Ga0157370_10031047
287 Ga0157369_10172531
288 Ga0157372_10047293
289 Ga0157375_10540551
290 Ga0182008_10363027
291 Ga0206354_11397771
292 Ga0206353_10929808
293 Ga0213876_10051808
294 Ga0209050_1000369
295 Ga0207684_10002161
296 Ga0207707_10289550
297 Ga0207707_10770424
298 Ga0207695_10000099
299 Ga0207695_10255169
300 Ga0207660_10109463
301 Ga0207657_10045391
302 Ga0207652_10047309
303 Ga0207652_10150284
304 Ga0207646_10007793
305 Ga0207646_10195632
306 Ga0207650_10505473
307 Ga0207690_10193936
308 Ga0207670_10079610
309 Ga0207691_10557460
310 Ga0207661_10039394
311 Ga0207661_10087576
312 Ga0207679_10782263
313 Ga0207667_10009827
314 Ga0207703_10182020
315 Ga0207639_10000002
316 Ga0207639_10314592
317 Ga0207702_10003346
318 Ga0207702_10821724
319 Ga0207683_10175501
320 Ga0207698_10106956
321 Ga0268266_10075540
322 Ga0268264_10086008
323 Ga0310981_1059735
324 Ga0265339_10148591
325 Ga0265327_10000729
326 Ga0265327_10011681
327 Ga0265327_10081056
328 Ga0265316_10320023
329 Ga0316579_10181612
330 Ga0316576_10071564
331 Ga0316576_10112319
332 Ga0316576_10123177
333 Ga0316576_10167344
334 Ga0316576_10209301
335 Ga0316576_10263908
336 Ga0316577_10002938
337 Ga0316577_10235738
338 Ga0373946_0073124
339 Ga0373961_0021018
340 Ga0316574_0234873
341 Ga0373931_0278035
342 Ga0373927_0151758
343 Ga0316582_0069819
344 Ga0316582_0139511
345 Ga0316582_0349023
346 Ga0316584_0045828
347 Ga0316584_0084042
348 Ga0316584_0154207
349 Ga0316584_0285147
350 Ga0395905_0221155
351 Ga0400489_24770
352 Ga0436365_0496829
353 Ga0451577_0000379
354 Ga0451577_0007816
355 Ga0451577_0016627
356 Ga0451577_0022557
357 Ga0451577_0029177
358 Ga0451577_0146026
359 Ga0451577_0196907
360 Ga0451577_0346063
361 Ga0453683_0000005
362 Ga0453683_0000195
363 Ga0453683_0002345
364 Ga0453683_0003763
365 Ga0453683_0008318
366 Ga0453683_0011300
367 Ga0453683_0038376
368 Ga0453683_0081922
369 Ga0453683_0283644
370 Ga0453683_0314102
371 Ga0453683_0555871
372 Ga0466963_0067435
373 Ga0453684_0000603
374 Ga0453684_0001143
375 Ga0453684_0001147
376 Ga0453684_0001234
377 Ga0453684_0016697
378 Ga0453684_0017624
379 Ga0453684_0110514
380 Ga0453684_0129141
381 Ga0453684_0201726
382 Ga0453684_0206438
383 Ga0453684_0254692
384 Ga0453684_0895954
385 Ga0466959_0022143
386 Ga0451576_0000397
387 Ga0451576_0000528
388 Ga0451576_0009998
389 Ga0451576_0019228
390 Ga0451576_0025215
391 Ga0451576_0025393
392 Ga0451576_0079068
393 Ga0451576_0197728
394 Ga0451576_0531775
395 Ga0451576_1110767
396 Ga0466958_0178935
397 Ga0466967_0004542
398 Ga0466967_0052168
399 Ga0495639_0079619
400 Ga0495662_0024011
401 Ga0495664_0099299
402 Ga0495618_0165935
403 Ga0495628_0044038
404 Ga0495630_0030697
405 Ga0495643_0000169
406 Ga0495634_0142721
407 Ga0495646_0238760
408 Ga0495674_0502995
409 Ga0496121_0173806
410 Ga0501034_0106033
411 Ga0501047_0243839
412 Ga0501047_0668972
413 Ga0501080_0079647
414 Ga0501080_0129948
415 Ga0501080_0186488
416 Ga0501080_0215542
417 Ga0501044_0612634
418 nmdc:mga0k408_222951_c1
419 nmdc:mga05p37_1040719_c1
420 nmdc:mga05p37_646443_c1
421 nmdc:mga05p37_96672_c1
422 nmdc:mga0qj67_18757_c1
423 nmdc:mga06r32_125180_c1
424 nmdc:mga06r32_188972_c1
425 nmdc:mga06r32_268537_c1
426 nmdc:mga06r32_516051_c1
427 nmdc:mga08y16_50238_c1
428 Ga0495619_0000155
429 Ga0500568_0004096
430 Ga0500616_0013065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9677 12 233
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9627 10 234
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9619 13 234
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9564 13 232
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9563 13 232
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9797 10 231 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9737 32 233 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9733 13 226 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9692 12 234 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9671 39 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538RLX8-F1-model_v4 ABC transporter ATP-binding protein 0.9793 13 233 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A6I5GX10-F1-model_v4 Betaine/proline/choline family ABC transporter ATP-binding protein 0.9793 46 232 GO:0005524
GO:0016020
GO:0016887
GO:0031460
AF-A0A3B8L505-F1-model_v4 ABC transporter ATP-binding protein 0.9787 11 231 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C3WP49-F1-model_v4 ABC transporter ATP-binding protein 0.9783 10 233 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A522W8K2-F1-model_v4 ABC transporter ATP-binding protein 0.9777 10 234 GO:0005524
GO:0016887

Map