F326255

General Info

Members Datasets Scaffolds Average Seq Length
215 143 430 441

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100020781|Ga0068858_1000207815
Length 518
Sequence MDKSKTPVPATTPQPAKAAGVAAQSSAPPRVPLPVGAKVGTVHSLRGLMVEVDILGERPTEKELLTVEGYPEIFLEVSFFKAKRAVCINLTNSQMLRCGQNIFRTNLKVSVPVGPATMGRVFNALGEPLDDGPVINENRRTISEATGVKKYRAEQNLELLETGLKVIDFLTPFVKGRKIGIVGGAGVGKTVLTMEMIHNVTQGSKGALSIYCGVGERIREGNELYETLKESEVLKNTVMFFGQMDATPAIRSMVGPAAATAAEYFRDEEGRDILFFVDNIYRHIQALTELSTNLGLIPSEGGYSPTIYSELRRLEDRLSSTDKGSITSVQAVYIPADDLSDPAVQAIQQQLDSVLVLSRSVAESGIRPAVDLLKTTSSLLTPQIVGQRHYDLVGKVQAIMQKYDSLKNIIAIVGENELSPADRIDYQSAKKLIEFFSQDFSVAEHLTGKPGEYFTRDQTLDGIEAILSAAQAGEAGSEDAKPATTVPGAKPGETEVPVASQPLPTPKPAVAQSIPKEV

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
138 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.86
Nodule 0
Rhizoplane 0
Rhizosphere 76.74
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100020781 3300005842 Bacteria 6135
2 rootH2_10000244 3300003320 Bacteria 697651
3 Ga0070658_10000076 3300005327 Bacteria 95016
4 Ga0070658_10024621 3300005327 Bacteria 4827
5 Ga0070658_10089874 3300005327 Bacteria 2529
6 Ga0070666_10000148 3300005335 Bacteria 47995
7 Ga0070660_100000121 3300005339 Bacteria 49401
8 Ga0070660_100004837 3300005339 Bacteria 9309
9 Ga0070668_100038474 3300005347 Bacteria 3656
10 Ga0070671_100031455 3300005355 Bacteria 4384
11 Ga0070674_100025817 3300005356 Unclassified 3829
12 Ga0070667_100090562 3300005367 Unclassified 2629
13 Ga0070708_100163005 3300005445 Bacteria 2078
14 Ga0070679_100001805 3300005530 Bacteria 19303
15 Ga0070679_100029586 3300005530 Bacteria 5404
16 Ga0070672_100026164 3300005543 Unclassified 4337
17 Ga0068855_100000625 3300005563 Bacteria 43457
18 Ga0068855_100001187 3300005563 Bacteria 32405
19 Ga0068855_100002859 3300005563 Bacteria 21213
20 Ga0070664_100090702 3300005564 Bacteria 2645
21 Ga0068857_100194823 3300005577 Unclassified 1846
22 Ga0068854_100080833 3300005578 Bacteria 2399
23 Ga0068856_100000037 3300005614 Bacteria 120033
24 Ga0068852_100000001 3300005616 Bacteria 716526
25 Ga0068859_100011254 3300005617 Bacteria 9002
26 Ga0068862_100021807 3300005844 Bacteria 5356
27 Ga0068862_100048376 3300005844 Unclassified 3630
28 Ga0081455_10000008 3300005937 Bacteria 256558
29 Ga0081539_10003983 3300005985 Bacteria 17058
30 Ga0075365_10000001 3300006038 Bacteria 371589
31 Ga0075365_10000027 3300006038 Bacteria 58640
32 Ga0075365_10000137 3300006038 Bacteria 22743
33 Ga0075365_10000645 3300006038 Bacteria 13843
34 Ga0075368_10000117 3300006042 Bacteria 20858
35 Ga0075363_100000063 3300006048 Bacteria 21867
36 Ga0075364_10000137 3300006051 Bacteria 31412
37 Ga0075364_10005728 3300006051 Bacteria 7243
38 Ga0075364_10006045 3300006051 Bacteria 7085
39 Ga0075364_10008244 3300006051 Bacteria 6224
40 Ga0075362_10000153 3300006177 Bacteria 18652
41 Ga0075362_10000570 3300006177 Bacteria 10770
42 Ga0075369_10000008 3300006186 Bacteria 97558
43 Ga0075366_10000012 3300006195 Bacteria 75739
44 Ga0075366_10000059 3300006195 Bacteria 40344
45 Ga0097621_100000001 3300006237 Bacteria 632268
46 Ga0097621_100000501 3300006237 Bacteria 27406
47 Ga0068871_100000008 3300006358 Bacteria 115827
48 Ga0068871_100000038 3300006358 Bacteria 69723
49 Ga0075428_100001331 3300006844 Bacteria 26188
50 Ga0075430_100020781 3300006846 Bacteria 5581
51 Ga0097620_100011253 3300006931 Bacteria 9002
52 Ga0105240_10000048 3300009093 Bacteria 237451
53 Ga0105240_10018131 3300009093 Bacteria 9464
54 Ga0105240_10149019 3300009093 Bacteria 2788
55 Ga0105245_10000044 3300009098 Bacteria 135878
56 Ga0105241_10000359 3300009174 Bacteria 34562
57 Ga0105241_10037652 3300009174 Unclassified 3644
58 Ga0105248_10174835 3300009177 Unclassified 2420
59 Ga0105248_10293823 3300009177 Bacteria 1830
60 Ga0105237_10000002 3300009545 Bacteria 702357
61 Ga0105238_10001005 3300009551 Bacteria 28770
62 Ga0105238_10002003 3300009551 Bacteria 20531
63 Ga0105028_100951 3300009993 Bacteria 3052
64 Ga0105239_10141159 3300010375 Unclassified 2684
65 Ga0157371_10000105 3300013102 Bacteria 126728
66 Ga0157371_10011877 3300013102 Bacteria 6685
67 Ga0157370_10043125 3300013104 Unclassified 4343
68 Ga0157369_10000003 3300013105 Bacteria 507337
69 Ga0157369_10000063 3300013105 Bacteria 147327
70 Ga0157369_10000199 3300013105 Bacteria 83451
71 Ga0157369_10017868 3300013105 Bacteria 7961
72 Ga0157374_10000058 3300013296 Bacteria 116810
73 Ga0157374_10011775 3300013296 Bacteria 7587
74 Ga0157374_10043896 3300013296 Bacteria 4130
75 Ga0157378_10075409 3300013297 Bacteria 3036
76 Ga0157372_10000027 3300013307 Bacteria 186906
77 Ga0157372_10008422 3300013307 Bacteria 10948
78 Ga0157372_10019347 3300013307 Bacteria 7336
79 Ga0157372_10311852 3300013307 Unclassified 1831
80 Ga0163163_10002304 3300014325 Bacteria 16118
81 Ga0157379_10008111 3300014968 Bacteria 9119
82 Ga0207680_10000248 3300025903 Bacteria 25994
83 Ga0207647_10000004 3300025904 Bacteria 307217
84 Ga0207705_10000019 3300025909 Bacteria 317770
85 Ga0207705_10052545 3300025909 Bacteria 2934
86 Ga0207654_10007518 3300025911 Bacteria 5492
87 Ga0207654_10032938 3300025911 Unclassified 2868
88 Ga0207707_10012280 3300025912 Bacteria 7446
89 Ga0207707_10014326 3300025912 Bacteria 6905
90 Ga0207695_10001692 3300025913 Bacteria 35397
91 Ga0207695_10024026 3300025913 Bacteria 6871
92 Ga0207671_10000008 3300025914 Bacteria 798229
93 Ga0207671_10000014 3300025914 Bacteria 461481
94 Ga0207660_10029640 3300025917 Bacteria 3756
95 Ga0207657_10001245 3300025919 Bacteria 27204
96 Ga0207652_10001689 3300025921 Bacteria 19318
97 Ga0207652_10023705 3300025921 Bacteria 5086
98 Ga0207652_10027554 3300025921 Bacteria 4735
99 Ga0207694_10000681 3300025924 Bacteria 30544
100 Ga0207694_10002182 3300025924 Bacteria 16075
101 Ga0207687_10000033 3300025927 Bacteria 135886
102 Ga0207644_10056241 3300025931 Bacteria 2838
103 Ga0207709_10049687 3300025935 Bacteria 2561
104 Ga0207669_10051878 3300025937 Unclassified 2460
105 Ga0207711_10196478 3300025941 Bacteria 1840
106 Ga0207661_10084338 3300025944 Bacteria 2631
107 Ga0207679_10083975 3300025945 Bacteria 2443
108 Ga0207667_10005302 3300025949 Bacteria 15715
109 Ga0207667_10010278 3300025949 Bacteria 10954
110 Ga0207667_10067321 3300025949 Bacteria 3731
111 Ga0207658_10129250 3300025986 Unclassified 2027
112 Ga0207703_10018771 3300026035 Bacteria 5401
113 Ga0207639_10189540 3300026041 Bacteria 1755
114 Ga0207702_10000001 3300026078 Bacteria 895738
115 Ga0207641_10070826 3300026088 Bacteria 2997
116 Ga0207674_10001779 3300026116 Bacteria 27516
117 Ga0207698_10000001 3300026142 Bacteria 625389
118 Ga0209813_10000001 3300027866 Bacteria 280406
119 Ga0268265_10024820 3300028380 Bacteria 4247
120 Ga0268265_10038326 3300028380 Unclassified 3525
121 Ga0265337_1010028 3300028556 Bacteria 3341
122 Ga0265337_1025431 3300028556 Bacteria 1803
123 Ga0265326_10000495 3300028558 Bacteria 15206
124 Ga0265319_1001722 3300028563 Bacteria 12602
125 Ga0265319_1002321 3300028563 Bacteria 10499
126 Ga0265334_10000327 3300028573 Bacteria 25674
127 Ga0265334_10000652 3300028573 Bacteria 17431
128 Ga0265334_10001807 3300028573 Bacteria 10191
129 Ga0265318_10001926 3300028577 Bacteria 11608
130 Ga0265323_10000944 3300028653 Bacteria 15268
131 Ga0265322_10000720 3300028654 Bacteria 12095
132 Ga0265322_10001174 3300028654 Bacteria 8984
133 Ga0265336_10001434 3300028666 Bacteria 10889
134 Ga0265338_10000003 3300028800 Bacteria 733923
135 Ga0265338_10007453 3300028800 Bacteria 13578
136 Ga0265338_10009489 3300028800 Bacteria 11592
137 Ga0265338_10010423 3300028800 Bacteria 10904
138 Ga0265338_10011167 3300028800 Bacteria 10411
139 Ga0265338_10013137 3300028800 Bacteria 9379
140 Ga0265338_10014402 3300028800 Bacteria 8802
141 Ga0265338_10141201 3300028800 Bacteria 1886
142 Ga0265338_10200793 3300028800 Bacteria 1504
143 Ga0265324_10002275 3300029957 Bacteria 10005
144 Ga0265324_10003408 3300029957 Bacteria 7588
145 Ga0265324_10004162 3300029957 Bacteria 6615
146 Ga0316182_1020098 3300030745 Bacteria 19560
147 Ga0265330_10000889 3300031235 Bacteria 18598
148 Ga0265332_10001761 3300031238 Bacteria 11716
149 Ga0265332_10021667 3300031238 Bacteria 2838
150 Ga0265328_10001432 3300031239 Bacteria 10982
151 Ga0265320_10004140 3300031240 Bacteria 9529
152 Ga0265325_10002869 3300031241 Bacteria 11489
153 Ga0265329_10001409 3300031242 Bacteria 11639
154 Ga0265340_10002357 3300031247 Bacteria 10761
155 Ga0265339_10004518 3300031249 Bacteria 9475
156 Ga0265331_10001265 3300031250 Bacteria 18908
157 Ga0265327_10000833 3300031251 Bacteria 46172
158 Ga0265327_10008272 3300031251 Bacteria 7791
159 Ga0265316_10003315 3300031344 Bacteria 16319
160 Ga0265316_10008954 3300031344 Bacteria 9233
161 Ga0265313_10004570 3300031595 Bacteria 10539
162 Ga0265314_10007752 3300031711 Bacteria 9283
163 Ga0265314_10061081 3300031711 Unclassified 2569
164 Ga0265342_10004616 3300031712 Bacteria 10747
165 Ga0307516_10003489 3300031730 Bacteria 20125
166 Ga0373959_0000137 3300034820 Bacteria 16280
167 Ga0395900_0028059 3300037418 Bacteria 5763
168 Ga0395898_0006423 3300037466 Bacteria 12556
169 Ga0395905_0144427 3300037471 Bacteria 2239
170 Ga0395901_0021768 3300038443 Bacteria 6570
171 Ga0395901_0142686 3300038443 Bacteria 2517
172 Ga0439434_0003044 3300042435 Bacteria 4917
173 Ga0466963_0072849 3300044694 Bacteria 2315
174 Ga0451576_0032511 3300045051 Bacteria 5554
175 Ga0495629_0024349 3300046459 Bacteria 4310
176 Ga0495638_0000132 3300046460 Bacteria 120039
177 Ga0495583_0044648 3300046506 Bacteria 2054
178 Ga0495622_0000049 3300046557 Bacteria 108606
179 Ga0495658_0004764 3300046683 Bacteria 6656
180 Ga0495660_0011224 3300046810 Bacteria 5202
181 Ga0495672_0020113 3300047320 Unclassified 4383
182 Ga0496118_0055109 3300048921 Bacteria 3004
183 Ga0501044_0037464 3300049823 Bacteria 5069
184 nmdc:mga03683_49_c4 3300050489 Bacteria 19085
185 nmdc:mga03n38_57_c1 3300050490 Bacteria 23529
186 nmdc:mga00v17_10743_c1 3300050491 Bacteria 5014
187 nmdc:mga00v17_1796_c1 3300050491 Bacteria 11111
188 nmdc:mga00v17_30033_c1 3300050491 Bacteria 3194
189 nmdc:mga00v17_3662_c1 3300050491 Bacteria 7939
190 nmdc:mga00v17_4216_c1 3300050491 Bacteria 7109
191 nmdc:mga0yw44_166_c1 3300050492 Bacteria 22874
192 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
193 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
194 nmdc:mga0yw44_9434_c1 3300050492 Bacteria 4934
195 nmdc:mga0yw44_9_c1 3300050492 Bacteria 178503
196 nmdc:mga0k408_107_c1 3300050493 Bacteria 40466
197 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
198 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
199 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
200 nmdc:mga0qj67_4136_c2 3300050509 Bacteria 6236
201 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
202 Ga0500643_000009 3300053087 Bacteria 444150
203 Ga0500643_000022 3300053087 Bacteria 277519
204 Ga0500646_0005873 3300053090 Bacteria 3113
205 Ga0500566_0000001 3300053094 Bacteria 1101031
206 Ga0500556_0000475 3300053104 Bacteria 28131
207 Ga0500562_000001 3300053108 Bacteria 1178987
208 Ga0500614_004772 3300053123 Bacteria 2852
209 Ga0500628_000504 3300053129 Bacteria 7276
210 Ga0500655_000649 3300053133 Bacteria 6943
211 Ga0500559_0024195 3300053136 Bacteria 2582
212 Ga0500577_0000167 3300053142 Bacteria 16593
213 Ga0500604_0058308 3300053151 Unclassified 1207
214 Ga0500616_0000005 3300053153 Bacteria 961725
215 Ga0500627_0014415 3300053158 Bacteria 3029
216 Ga0068858_100020781
217 rootH2_10000244
218 Ga0070658_10000076
219 Ga0070658_10024621
220 Ga0070658_10089874
221 Ga0070666_10000148
222 Ga0070660_100000121
223 Ga0070660_100004837
224 Ga0070668_100038474
225 Ga0070671_100031455
226 Ga0070674_100025817
227 Ga0070667_100090562
228 Ga0070708_100163005
229 Ga0070679_100001805
230 Ga0070679_100029586
231 Ga0070672_100026164
232 Ga0068855_100000625
233 Ga0068855_100001187
234 Ga0068855_100002859
235 Ga0070664_100090702
236 Ga0068857_100194823
237 Ga0068854_100080833
238 Ga0068856_100000037
239 Ga0068852_100000001
240 Ga0068859_100011254
241 Ga0068862_100021807
242 Ga0068862_100048376
243 Ga0081455_10000008
244 Ga0081539_10003983
245 Ga0075365_10000001
246 Ga0075365_10000027
247 Ga0075365_10000137
248 Ga0075365_10000645
249 Ga0075368_10000117
250 Ga0075363_100000063
251 Ga0075364_10000137
252 Ga0075364_10005728
253 Ga0075364_10006045
254 Ga0075364_10008244
255 Ga0075362_10000153
256 Ga0075362_10000570
257 Ga0075369_10000008
258 Ga0075366_10000012
259 Ga0075366_10000059
260 Ga0097621_100000001
261 Ga0097621_100000501
262 Ga0068871_100000008
263 Ga0068871_100000038
264 Ga0075428_100001331
265 Ga0075430_100020781
266 Ga0097620_100011253
267 Ga0105240_10000048
268 Ga0105240_10018131
269 Ga0105240_10149019
270 Ga0105245_10000044
271 Ga0105241_10000359
272 Ga0105241_10037652
273 Ga0105248_10174835
274 Ga0105248_10293823
275 Ga0105237_10000002
276 Ga0105238_10001005
277 Ga0105238_10002003
278 Ga0105028_100951
279 Ga0105239_10141159
280 Ga0157371_10000105
281 Ga0157371_10011877
282 Ga0157370_10043125
283 Ga0157369_10000003
284 Ga0157369_10000063
285 Ga0157369_10000199
286 Ga0157369_10017868
287 Ga0157374_10000058
288 Ga0157374_10011775
289 Ga0157374_10043896
290 Ga0157378_10075409
291 Ga0157372_10000027
292 Ga0157372_10008422
293 Ga0157372_10019347
294 Ga0157372_10311852
295 Ga0163163_10002304
296 Ga0157379_10008111
297 Ga0207680_10000248
298 Ga0207647_10000004
299 Ga0207705_10000019
300 Ga0207705_10052545
301 Ga0207654_10007518
302 Ga0207654_10032938
303 Ga0207707_10012280
304 Ga0207707_10014326
305 Ga0207695_10001692
306 Ga0207695_10024026
307 Ga0207671_10000008
308 Ga0207671_10000014
309 Ga0207660_10029640
310 Ga0207657_10001245
311 Ga0207652_10001689
312 Ga0207652_10023705
313 Ga0207652_10027554
314 Ga0207694_10000681
315 Ga0207694_10002182
316 Ga0207687_10000033
317 Ga0207644_10056241
318 Ga0207709_10049687
319 Ga0207669_10051878
320 Ga0207711_10196478
321 Ga0207661_10084338
322 Ga0207679_10083975
323 Ga0207667_10005302
324 Ga0207667_10010278
325 Ga0207667_10067321
326 Ga0207658_10129250
327 Ga0207703_10018771
328 Ga0207639_10189540
329 Ga0207702_10000001
330 Ga0207641_10070826
331 Ga0207674_10001779
332 Ga0207698_10000001
333 Ga0209813_10000001
334 Ga0268265_10024820
335 Ga0268265_10038326
336 Ga0265337_1010028
337 Ga0265337_1025431
338 Ga0265326_10000495
339 Ga0265319_1001722
340 Ga0265319_1002321
341 Ga0265334_10000327
342 Ga0265334_10000652
343 Ga0265334_10001807
344 Ga0265318_10001926
345 Ga0265323_10000944
346 Ga0265322_10000720
347 Ga0265322_10001174
348 Ga0265336_10001434
349 Ga0265338_10000003
350 Ga0265338_10007453
351 Ga0265338_10009489
352 Ga0265338_10010423
353 Ga0265338_10011167
354 Ga0265338_10013137
355 Ga0265338_10014402
356 Ga0265338_10141201
357 Ga0265338_10200793
358 Ga0265324_10002275
359 Ga0265324_10003408
360 Ga0265324_10004162
361 Ga0316182_1020098
362 Ga0265330_10000889
363 Ga0265332_10001761
364 Ga0265332_10021667
365 Ga0265328_10001432
366 Ga0265320_10004140
367 Ga0265325_10002869
368 Ga0265329_10001409
369 Ga0265340_10002357
370 Ga0265339_10004518
371 Ga0265331_10001265
372 Ga0265327_10000833
373 Ga0265327_10008272
374 Ga0265316_10003315
375 Ga0265316_10008954
376 Ga0265313_10004570
377 Ga0265314_10007752
378 Ga0265314_10061081
379 Ga0265342_10004616
380 Ga0307516_10003489
381 Ga0373959_0000137
382 Ga0395900_0028059
383 Ga0395898_0006423
384 Ga0395905_0144427
385 Ga0395901_0021768
386 Ga0395901_0142686
387 Ga0439434_0003044
388 Ga0466963_0072849
389 Ga0451576_0032511
390 Ga0495629_0024349
391 Ga0495638_0000132
392 Ga0495583_0044648
393 Ga0495622_0000049
394 Ga0495658_0004764
395 Ga0495660_0011224
396 Ga0495672_0020113
397 Ga0496118_0055109
398 Ga0501044_0037464
399 nmdc:mga03683_49_c4
400 nmdc:mga03n38_57_c1
401 nmdc:mga00v17_10743_c1
402 nmdc:mga00v17_1796_c1
403 nmdc:mga00v17_30033_c1
404 nmdc:mga00v17_3662_c1
405 nmdc:mga00v17_4216_c1
406 nmdc:mga0yw44_166_c1
407 nmdc:mga0yw44_1_c1
408 nmdc:mga0yw44_8_c1
409 nmdc:mga0yw44_9434_c1
410 nmdc:mga0yw44_9_c1
411 nmdc:mga0k408_107_c1
412 nmdc:mga0k408_1_c1
413 nmdc:mga06z11_12_c1
414 nmdc:mga04h51_1_c1
415 nmdc:mga0qj67_4136_c2
416 nmdc:mga0sz30_3_c8
417 Ga0500643_000009
418 Ga0500643_000022
419 Ga0500646_0005873
420 Ga0500566_0000001
421 Ga0500556_0000475
422 Ga0500562_000001
423 Ga0500614_004772
424 Ga0500628_000504
425 Ga0500655_000649
426 Ga0500559_0024195
427 Ga0500577_0000167
428 Ga0500604_0058308
429 Ga0500616_0000005
430 Ga0500627_0014415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00006

ATP-synt_ab

ATP synthase alpha/beta family, nucleotide-binding domain

163

377

0.96

PF22919

ATP-synt_VA_C

C-terminal domain of V and A type ATP synthase

379

449

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yny-assembly1.cif.gz_D1 cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1fo composite dimer model 0.9433 1 433
6tmh-assembly1.cif.gz_B cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.9428 1 433
6yny-assembly1.cif.gz_D1 cryo-em structure of tetrahymena thermophila mitochondrial atp synthase - f1fo composite dimer model 0.9391 1 433
6tmh-assembly1.cif.gz_B cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.9386 1 433
6oqr-assembly1.cif.gz_D e. coli atp synthase adp state 1a 0.9356 1 433
ID Description Score Start End Superfamily
af_E8NHD0_1_154_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 208 343 3.40.50.300
1h8eE03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9618 347 433 1.10.1140.10
3oaaE03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9609 350 433 1.10.1140.10
3ofnM03 Mainly Alpha;Orthogonal Bundle;Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3;Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 0.9602 347 433 1.10.1140.10
af_Q8T4C4_93_175_2.40.10.170 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.95 2 70 2.40.10.170
ID Description Score Start End GO Terms
AF-A0A4Q0ISS5-F1-model_v4 F0F1 ATP synthase subunit beta 0.9885 295 433 GO:0005524
GO:0045261
GO:0046933
AF-A0A3D3AY10-F1-model_v4 F0F1 ATP synthase subunit beta 0.9873 274 432 GO:0005524
GO:0045261
GO:0046933
AF-A0A0G1L8S6-F1-model_v4 ATP synthase subunit beta 0.9873 323 433 GO:0005524
GO:0045261
GO:0046933
AF-A0A816HDU7-F1-model_v4 ATP synthase subunit beta, mitochondrial (EC 7.1.2.2) 0.9863 278 429 GO:0005524
GO:0005739
GO:0042776
GO:0045261
GO:0046933
AF-A0A7S1H5B1-F1-model_v4 ATP synthase A/B type C-terminal domain-containing protein 0.9863 334 431 GO:0005524
GO:0045261
GO:0046933

Map