F326307

General Info

Members Datasets Scaffolds Average Seq Length
215 183 430 220

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100025129|Ga0075430_1000251295
Length 251
Sequence VDVTRFYNRPVPSDQAWQRLQRRIVTCTRCPRLREHCATVAAEKRAAFRDWDYWGKPLPNLGDSDARLLVVGLAPAAHGGNRTGRMFTGDRSGDFLFRAMYEARFASQPNSDHKDDGLRLIDAAVTGVAHCAPPANKPTPAEMDNCFGFLEETVSLMPNLRGVVALGRIALDGCTRLYRAQGWIAPRVRLAFGHAVVHRFDAAPFVICSFHPSQQNTFTGRLTPEMLRGVFETAGELLSTAPDIAAVHSRA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.47
Rhizoplane 1.86
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100025129 3300006846 Bacteria 5066
2 Ga0065707_10083355 3300005295 Bacteria 9449
3 Ga0070670_100260407 3300005331 Bacteria 1512
4 Ga0070668_100010090 3300005347 Bacteria 7001
5 Ga0070709_10025573 3300005434 Bacteria 3489
6 Ga0070714_100040988 3300005435 Bacteria 3905
7 Ga0070710_10012587 3300005437 Bacteria 4207
8 Ga0070711_100030968 3300005439 Bacteria 3547
9 Ga0070700_100020871 3300005441 Bacteria 3802
10 Ga0070662_100011932 3300005457 Bacteria 5745
11 Ga0070698_100455036 3300005471 Unclassified 1216
12 Ga0070679_100710555 3300005530 Bacteria 948
13 Ga0070684_100017541 3300005535 Bacteria 5879
14 Ga0068853_100356132 3300005539 Unclassified 1362
15 Ga0070665_100465885 3300005548 Bacteria 1274
16 Ga0070664_100028536 3300005564 Bacteria 4643
17 Ga0068861_100016913 3300005719 Bacteria 5170
18 Ga0081539_10017852 3300005985 Bacteria 4954
19 Ga0075365_10005123 3300006038 Bacteria 7035
20 Ga0075363_100055472 3300006048 Bacteria 2123
21 Ga0075364_10206927 3300006051 Bacteria 1330
22 Ga0070716_100012974 3300006173 Bacteria 4235
23 Ga0070712_100043335 3300006175 Bacteria 3097
24 Ga0070712_100328732 3300006175 Bacteria 1245
25 Ga0075362_10007015 3300006177 Bacteria 4233
26 Ga0075367_10003965 3300006178 Bacteria 7144
27 Ga0075428_100053272 3300006844 Bacteria 4433
28 Ga0075428_100188941 3300006844 Bacteria 2228
29 Ga0075428_100497635 3300006844 Bacteria 1304
30 Ga0075430_100001033 3300006846 Bacteria 21996
31 Ga0075430_100102410 3300006846 Bacteria 2390
32 Ga0075431_100272659 3300006847 Bacteria 1714
33 Ga0075431_100512099 3300006847 Bacteria 1190
34 Ga0075433_10237890 3300006852 Bacteria 1617
35 Ga0075429_100027643 3300006880 Bacteria 4925
36 Ga0111539_10044416 3300009094 Bacteria 5324
37 Ga0111539_10107340 3300009094 Bacteria 3276
38 Ga0111539_10121902 3300009094 Bacteria 3055
39 Ga0105245_10009764 3300009098 Bacteria 8364
40 Ga0114129_10148892 3300009147 Bacteria 3204
41 Ga0114129_10444686 3300009147 Bacteria 1701
42 Ga0105237_10185693 3300009545 Bacteria 2079
43 Ga0105249_10048571 3300009553 Bacteria 3869
44 Ga0099796_10001254 3300010159 Bacteria 4978
45 Ga0157317_1004840 3300012475 Bacteria 890
46 Ga0157370_10221029 3300013104 Bacteria 1754
47 Ga0157369_10006662 3300013105 Bacteria 13349
48 Ga0163162_10099982 3300013306 Bacteria 2991
49 Ga0163161_10154337 3300017792 Bacteria 1747
50 Ga0213876_10015938 3300021384 Bacteria 3976
51 Ga0207682_10072135 3300025893 Bacteria 1465
52 Ga0207692_10006884 3300025898 Bacteria 4632
53 Ga0207688_10075349 3300025901 Bacteria 1920
54 Ga0207685_10156261 3300025905 Bacteria 1037
55 Ga0207699_10009360 3300025906 Bacteria 4874
56 Ga0207699_10150773 3300025906 Bacteria 1538
57 Ga0207645_10050864 3300025907 Bacteria 2647
58 Ga0207693_10070536 3300025915 Bacteria 2735
59 Ga0207652_10460743 3300025921 Bacteria 1146
60 Ga0207650_10056445 3300025925 Bacteria 2918
61 Ga0207664_10028069 3300025929 Bacteria 4274
62 Ga0207644_10047636 3300025931 Bacteria 3060
63 Ga0207706_10007097 3300025933 Bacteria 10364
64 Ga0207704_10239680 3300025938 Bacteria 1354
65 Ga0207712_10039560 3300025961 Bacteria 3232
66 Ga0207668_10015965 3300025972 Bacteria 4677
67 Ga0207678_10086071 3300026067 Bacteria 2686
68 Ga0207708_10010426 3300026075 Bacteria 6899
69 Ga0207674_10192611 3300026116 Bacteria 1989
70 Ga0207675_100005131 3300026118 Bacteria 12609
71 Ga0209179_1005834 3300027512 Bacteria 1950
72 Ga0209813_10042910 3300027866 Bacteria 1384
73 Ga0207428_10024034 3300027907 Bacteria 5117
74 Ga0207428_10121661 3300027907 Bacteria 2001
75 Ga0207428_10192291 3300027907 Bacteria 1538
76 Ga0265338_10010212 3300028800 Bacteria 11061
77 Ga0265330_10120140 3300031235 Bacteria 1120
78 Ga0265332_10116091 3300031238 Bacteria 1126
79 Ga0265320_10128158 3300031240 Bacteria 1154
80 Ga0265325_10003808 3300031241 Bacteria 9728
81 Ga0265329_10059150 3300031242 Bacteria 1213
82 Ga0265340_10029533 3300031247 Bacteria 2753
83 Ga0265339_10001235 3300031249 Bacteria 19221
84 Ga0265331_10000299 3300031250 Bacteria 53996
85 Ga0265313_10002223 3300031595 Bacteria 17072
86 Ga0265314_10001250 3300031711 Bacteria 28930
87 Ga0265314_10133006 3300031711 Bacteria 1549
88 Ga0265342_10004008 3300031712 Bacteria 11772
89 Ga0316577_10007097 3300031733 Bacteria 5960
90 Ga0316577_10025489 3300031733 Bacteria 3289
91 Ga0307406_10336777 3300031901 Bacteria 1174
92 Ga0307412_10330864 3300031911 Bacteria 1216
93 Ga0307409_100423273 3300031995 Bacteria 1278
94 Ga0307416_100163868 3300032002 Bacteria 2059
95 Ga0307414_10480027 3300032004 Bacteria 1096
96 Ga0307415_100150353 3300032126 Bacteria 1791
97 Ga0316580_10035819 3300032139 Bacteria 1536
98 Ga0373926_0085567 3300035083 Bacteria 1169
99 Ga0373928_0034600 3300035084 Bacteria 1135
100 Ga0373934_0115800 3300035086 Bacteria 1089
101 Ga0373949_0011014 3300035090 Bacteria 1989
102 Ga0373951_0035267 3300035091 Bacteria 1191
103 Ga0373923_0148432 3300035111 Bacteria 1063
104 Ga0373936_0041331 3300035113 Bacteria 1849
105 Ga0373945_0030323 3300035116 Bacteria 1906
106 Ga0373953_0011437 3300035117 Bacteria 3115
107 Ga0373954_0089473 3300035118 Bacteria 1477
108 Ga0373956_0138158 3300035119 Bacteria 1143
109 Ga0373957_0027207 3300035120 Bacteria 2076
110 Ga0373960_0166781 3300035121 Bacteria 761
111 Ga0373943_0004215 3300035170 Bacteria 6522
112 Ga0373946_0050044 3300035171 Bacteria 1744
113 Ga0373955_0017106 3300035172 Bacteria 3581
114 Ga0373942_0048043 3300035207 Bacteria 1188
115 Ga0373962_0036805 3300035242 Bacteria 1364
116 Ga0316574_0010563 3300035398 Bacteria 5224
117 Ga0373924_0010574 3300035410 Bacteria 3409
118 Ga0373931_0240419 3300035691 Bacteria 1097
119 Ga0373935_0026708 3300035692 Bacteria 3566
120 Ga0373927_0048951 3300035695 Bacteria 2733
121 Ga0373947_0020953 3300035725 Bacteria 3781
122 Ga0316582_0157707 3300036647 Bacteria 1536
123 Ga0316584_0010402 3300036712 Bacteria 6499
124 Ga0373925_0090861 3300037068 Bacteria 2334
125 Ga0395900_0194081 3300037418 Bacteria 2058
126 Ga0395898_0151151 3300037466 Bacteria 2221
127 Ga0395905_0062992 3300037471 Bacteria 3469
128 Ga0395901_0044153 3300038443 Bacteria 4623
129 Ga0395901_0263366 3300038443 Bacteria 1794
130 Ga0395901_0398741 3300038443 Bacteria 1414
131 Ga0436365_0053441 3300039437 Bacteria 13599
132 Ga0439447_027422 3300041407 Archaea 1453
133 Ga0451853_3198524 3300041512 Bacteria 1063
134 Ga0466972_0007438 3300044658 Bacteria 5506
135 Ga0466961_0124784 3300044693 Bacteria 1616
136 Ga0466963_0064553 3300044694 Bacteria 2453
137 Ga0466960_0020888 3300044901 Bacteria 2908
138 Ga0466958_0435071 3300045836 Bacteria 849
139 Ga0466967_0300602 3300045976 Bacteria 1544
140 Ga0466967_0955390 3300045976 Bacteria 853
141 Ga0495603_0356940 3300046455 Bacteria 838
142 Ga0495629_0283971 3300046459 Bacteria 1135
143 Ga0495580_0057880 3300046472 Bacteria 2727
144 Ga0495582_0203066 3300046473 Bacteria 1132
145 Ga0495639_0003713 3300046475 Bacteria 6570
146 Ga0495662_0031613 3300046476 Bacteria 2557
147 Ga0495584_0114155 3300046491 Bacteria 1367
148 Ga0495585_0197112 3300046492 Bacteria 1027
149 Ga0495594_0256772 3300046499 Bacteria 995
150 Ga0495618_0208409 3300046514 Bacteria 1236
151 Ga0495630_0075872 3300046517 Bacteria 2532
152 Ga0495637_0135972 3300046520 Bacteria 936
153 Ga0495666_0052102 3300046526 Bacteria 1965
154 Ga0495640_0114958 3300046533 Bacteria 1754
155 Ga0495645_0041319 3300046543 Bacteria 3363
156 Ga0495635_0212319 3300046663 Bacteria 1310
157 Ga0495588_0246442 3300046674 Bacteria 942
158 Ga0495646_0116141 3300046680 Bacteria 1519
159 Ga0495658_0299780 3300046683 Bacteria 1016
160 Ga0495613_0405538 3300046689 Bacteria 929
161 Ga0495581_0048199 3300047315 Bacteria 2461
162 Ga0495676_0408593 3300047321 Bacteria 900
163 Ga0495684_0098459 3300047471 Bacteria 2211
164 Ga0495593_0040840 3300047673 Bacteria 2496
165 Ga0496103_0253804 3300048906 Bacteria 1132
166 Ga0496110_0494617 3300048913 Bacteria 1114
167 Ga0496114_0112703 3300048917 Bacteria 2332
168 Ga0496115_0422293 3300048918 Bacteria 1080
169 Ga0496126_0034428 3300048929 Bacteria 4757
170 Ga0501034_0606340 3300049571 Bacteria 1000
171 Ga0501036_0247673 3300049572 Bacteria 1494
172 Ga0501037_0279704 3300049573 Archaea 1163
173 Ga0501039_0499380 3300049575 Bacteria 955
174 Ga0501040_0090831 3300049576 Bacteria 2123
175 Ga0501040_0539158 3300049576 Bacteria 842
176 Ga0501041_0034201 3300049577 Archaea 3077
177 Ga0501041_0205067 3300049577 Bacteria 1236
178 Ga0501042_0142839 3300049578 Archaea 1726
179 Ga0501043_0025048 3300049579 Bacteria 4681
180 Ga0501043_0511894 3300049579 Bacteria 896
181 Ga0501047_0192880 3300049581 Bacteria 1900
182 Ga0501048_0367938 3300049582 Bacteria 1026
183 Ga0501048_0494996 3300049582 Bacteria 876
184 Ga0501070_0004416 3300049586 Bacteria 12072
185 Ga0501071_0056260 3300049587 Archaea 2841
186 Ga0501071_0149696 3300049587 Bacteria 1741
187 Ga0501071_0491451 3300049587 Bacteria 941
188 Ga0501074_0483317 3300049590 Bacteria 878
189 Ga0501075_0017634 3300049591 Bacteria 5156
190 Ga0501075_0166417 3300049591 Archaea 1682
191 Ga0501076_0024376 3300049592 Archaea 4677
192 Ga0501076_0597776 3300049592 Bacteria 910
193 Ga0501077_0450982 3300049593 Bacteria 824
194 Ga0501044_0151115 3300049823 Bacteria 2304
195 Ga0501044_0550479 3300049823 Bacteria 1051
196 Ga0501045_0369069 3300049824 Bacteria 1068
197 nmdc:mga03683_23180_c1 3300050489 Bacteria 2415
198 nmdc:mga03n38_17785_c1 3300050490 Bacteria 2791
199 nmdc:mga06z11_10173_c1 3300050494 Bacteria 3994
200 nmdc:mga05p37_10355_c1 3300050507 Bacteria 11069
201 nmdc:mga05p37_126643_c1 3300050507 Bacteria 3136
202 nmdc:mga05p37_482457_c1 3300050507 Bacteria 1427
203 nmdc:mga09592_327210_c1 3300050508 Bacteria 1327
204 nmdc:mga0qj67_264_c1 3300050509 Bacteria 36047
205 nmdc:mga08y16_18179_c1 3300050511 Bacteria 7407
206 nmdc:mga08y16_264280_c1 3300050511 Bacteria 1777
207 nmdc:mga08y16_336440_c1 3300050511 Bacteria 1552
208 Ga0495601_0048312 3300053077 Bacteria 2680
209 Ga0495612_0025093 3300053078 Bacteria 2394
210 Ga0495655_0184871 3300053083 Bacteria 674
211 Ga0495595_0306121 3300053084 Bacteria 800
212 Ga0530510_0001570 3300061734 Bacteria 15396
213 Ga0530510_0076492 3300061734 Bacteria 2432
214 Ga0530510_0407435 3300061734 Bacteria 1025
215 2524469861 2524023210 Bacteria 9029266
216 Ga0075430_100025129
217 Ga0065707_10083355
218 Ga0070670_100260407
219 Ga0070668_100010090
220 Ga0070709_10025573
221 Ga0070714_100040988
222 Ga0070710_10012587
223 Ga0070711_100030968
224 Ga0070700_100020871
225 Ga0070662_100011932
226 Ga0070698_100455036
227 Ga0070679_100710555
228 Ga0070684_100017541
229 Ga0068853_100356132
230 Ga0070665_100465885
231 Ga0070664_100028536
232 Ga0068861_100016913
233 Ga0081539_10017852
234 Ga0075365_10005123
235 Ga0075363_100055472
236 Ga0075364_10206927
237 Ga0070716_100012974
238 Ga0070712_100043335
239 Ga0070712_100328732
240 Ga0075362_10007015
241 Ga0075367_10003965
242 Ga0075428_100053272
243 Ga0075428_100188941
244 Ga0075428_100497635
245 Ga0075430_100001033
246 Ga0075430_100102410
247 Ga0075431_100272659
248 Ga0075431_100512099
249 Ga0075433_10237890
250 Ga0075429_100027643
251 Ga0111539_10044416
252 Ga0111539_10107340
253 Ga0111539_10121902
254 Ga0105245_10009764
255 Ga0114129_10148892
256 Ga0114129_10444686
257 Ga0105237_10185693
258 Ga0105249_10048571
259 Ga0099796_10001254
260 Ga0157317_1004840
261 Ga0157370_10221029
262 Ga0157369_10006662
263 Ga0163162_10099982
264 Ga0163161_10154337
265 Ga0213876_10015938
266 Ga0207682_10072135
267 Ga0207692_10006884
268 Ga0207688_10075349
269 Ga0207685_10156261
270 Ga0207699_10009360
271 Ga0207699_10150773
272 Ga0207645_10050864
273 Ga0207693_10070536
274 Ga0207652_10460743
275 Ga0207650_10056445
276 Ga0207664_10028069
277 Ga0207644_10047636
278 Ga0207706_10007097
279 Ga0207704_10239680
280 Ga0207712_10039560
281 Ga0207668_10015965
282 Ga0207678_10086071
283 Ga0207708_10010426
284 Ga0207674_10192611
285 Ga0207675_100005131
286 Ga0209179_1005834
287 Ga0209813_10042910
288 Ga0207428_10024034
289 Ga0207428_10121661
290 Ga0207428_10192291
291 Ga0265338_10010212
292 Ga0265330_10120140
293 Ga0265332_10116091
294 Ga0265320_10128158
295 Ga0265325_10003808
296 Ga0265329_10059150
297 Ga0265340_10029533
298 Ga0265339_10001235
299 Ga0265331_10000299
300 Ga0265313_10002223
301 Ga0265314_10001250
302 Ga0265314_10133006
303 Ga0265342_10004008
304 Ga0316577_10007097
305 Ga0316577_10025489
306 Ga0307406_10336777
307 Ga0307412_10330864
308 Ga0307409_100423273
309 Ga0307416_100163868
310 Ga0307414_10480027
311 Ga0307415_100150353
312 Ga0316580_10035819
313 Ga0373926_0085567
314 Ga0373928_0034600
315 Ga0373934_0115800
316 Ga0373949_0011014
317 Ga0373951_0035267
318 Ga0373923_0148432
319 Ga0373936_0041331
320 Ga0373945_0030323
321 Ga0373953_0011437
322 Ga0373954_0089473
323 Ga0373956_0138158
324 Ga0373957_0027207
325 Ga0373960_0166781
326 Ga0373943_0004215
327 Ga0373946_0050044
328 Ga0373955_0017106
329 Ga0373942_0048043
330 Ga0373962_0036805
331 Ga0316574_0010563
332 Ga0373924_0010574
333 Ga0373931_0240419
334 Ga0373935_0026708
335 Ga0373927_0048951
336 Ga0373947_0020953
337 Ga0316582_0157707
338 Ga0316584_0010402
339 Ga0373925_0090861
340 Ga0395900_0194081
341 Ga0395898_0151151
342 Ga0395905_0062992
343 Ga0395901_0044153
344 Ga0395901_0263366
345 Ga0395901_0398741
346 Ga0436365_0053441
347 Ga0439447_027422
348 Ga0451853_3198524
349 Ga0466972_0007438
350 Ga0466961_0124784
351 Ga0466963_0064553
352 Ga0466960_0020888
353 Ga0466958_0435071
354 Ga0466967_0300602
355 Ga0466967_0955390
356 Ga0495603_0356940
357 Ga0495629_0283971
358 Ga0495580_0057880
359 Ga0495582_0203066
360 Ga0495639_0003713
361 Ga0495662_0031613
362 Ga0495584_0114155
363 Ga0495585_0197112
364 Ga0495594_0256772
365 Ga0495618_0208409
366 Ga0495630_0075872
367 Ga0495637_0135972
368 Ga0495666_0052102
369 Ga0495640_0114958
370 Ga0495645_0041319
371 Ga0495635_0212319
372 Ga0495588_0246442
373 Ga0495646_0116141
374 Ga0495658_0299780
375 Ga0495613_0405538
376 Ga0495581_0048199
377 Ga0495676_0408593
378 Ga0495684_0098459
379 Ga0495593_0040840
380 Ga0496103_0253804
381 Ga0496110_0494617
382 Ga0496114_0112703
383 Ga0496115_0422293
384 Ga0496126_0034428
385 Ga0501034_0606340
386 Ga0501036_0247673
387 Ga0501037_0279704
388 Ga0501039_0499380
389 Ga0501040_0090831
390 Ga0501040_0539158
391 Ga0501041_0034201
392 Ga0501041_0205067
393 Ga0501042_0142839
394 Ga0501043_0025048
395 Ga0501043_0511894
396 Ga0501047_0192880
397 Ga0501048_0367938
398 Ga0501048_0494996
399 Ga0501070_0004416
400 Ga0501071_0056260
401 Ga0501071_0149696
402 Ga0501071_0491451
403 Ga0501074_0483317
404 Ga0501075_0017634
405 Ga0501075_0166417
406 Ga0501076_0024376
407 Ga0501076_0597776
408 Ga0501077_0450982
409 Ga0501044_0151115
410 Ga0501044_0550479
411 Ga0501045_0369069
412 nmdc:mga03683_23180_c1
413 nmdc:mga03n38_17785_c1
414 nmdc:mga06z11_10173_c1
415 nmdc:mga05p37_10355_c1
416 nmdc:mga05p37_126643_c1
417 nmdc:mga05p37_482457_c1
418 nmdc:mga09592_327210_c1
419 nmdc:mga0qj67_264_c1
420 nmdc:mga08y16_18179_c1
421 nmdc:mga08y16_264280_c1
422 nmdc:mga08y16_336440_c1
423 Ga0495601_0048312
424 Ga0495612_0025093
425 Ga0495655_0184871
426 Ga0495595_0306121
427 Ga0530510_0001570
428 Ga0530510_0076492
429 Ga0530510_0407435
430 2524469861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

59

235

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.894 9 229
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8784 9 229
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8129 8 229
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7939 9 229
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7932 8 229
ID Description Score Start End Superfamily
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9306 10 229 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9184 10 229 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.912 9 229 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8961 9 229 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8129 8 229 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A524NBY1-F1-model_v4 Uracil-DNA glycosylase 0.9727 79 226 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A350KEA8-F1-model_v4 deleted 0.9696 135 225
AF-A0A4Q3WJ85-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9694 44 228 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A2V7ZPD8-F1-model_v4 Uracil-DNA glycosylase 0.9669 45 143 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A257AV33-F1-model_v4 Uracil-DNA glycosylase 0.9661 62 145 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map