F326524

General Info

Members Datasets Scaffolds Average Seq Length
215 167 213 281

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10099064|Ga0207661_100990643
Length 308
Sequence MSDRKLSSRPISWGSKRGSLRSTVLEMAKLATPTTLEQKLDHARDLFQQWGSVLVCFSGGIDSTLVLSLAQRALGEHAVGLTAVSPSLPASERADAERLATALGARHLFVDSHEIDRPGYVQNGPDRCFHCKSELYVIAQRKAEELGLAAIANGTNLDDLGDYRPGLEAARQAGVKSPLVEAGFGKQDVRDAARVLGIAAWDKPAAACLSSRIPYGTSVTPERLARIGGFEAELKALGFRQVRVRFHDEIARIEVALDELARLLEAGVRDRALEAGKRHGFRYVTLDLGGYRQGSHNEVLAGRSLRLV

Samples

Sample ID Description Type Environment
1 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
2 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 0.93
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10035728 3300003320 Bacteria 7297
2 rootL2_10080055 3300003322 Bacteria 2585
3 rootH1_10101855 3300003323 Bacteria 2852
4 Ga0070683_100021031 3300005329 Bacteria 5819
5 Ga0070670_100070569 3300005331 Bacteria 2999
6 Ga0070677_10019920 3300005333 Bacteria 2437
7 Ga0070682_100002382 3300005337 Bacteria 10414
8 Ga0068868_100004578 3300005338 Bacteria 9705
9 Ga0068868_100156451 3300005338 Bacteria 1880
10 Ga0070661_100264875 3300005344 Bacteria 1329
11 Ga0070675_100013936 3300005354 Bacteria 6328
12 Ga0070667_100386882 3300005367 Unclassified 1271
13 Ga0070709_10011093 3300005434 Bacteria 5011
14 Ga0070709_10056837 3300005434 Unclassified 2476
15 Ga0070714_100033453 3300005435 Bacteria 4297
16 Ga0070714_100060332 3300005435 Bacteria 3255
17 Ga0070713_100000487 3300005436 Bacteria 25295
18 Ga0070713_100289129 3300005436 Bacteria 1506
19 Ga0070710_10043206 3300005437 Bacteria 2495
20 Ga0070710_10072812 3300005437 Unclassified 1985
21 Ga0070711_100291091 3300005439 Bacteria 1295
22 Ga0070694_100158232 3300005444 Bacteria 1660
23 Ga0070663_100065681 3300005455 Bacteria 2627
24 Ga0070678_100067733 3300005456 Bacteria 2658
25 Ga0070706_100086144 3300005467 Bacteria 2911
26 Ga0070672_100000141 3300005543 Bacteria 38703
27 Ga0070665_100626293 3300005548 Bacteria 1089
28 Ga0068855_100024276 3300005563 Bacteria 7259
29 Ga0068856_100019098 3300005614 Bacteria 6652
30 Ga0068856_100284853 3300005614 Bacteria 1669
31 Ga0070717_10024308 3300006028 Unclassified 4809
32 Ga0070712_100005352 3300006175 Bacteria 7948
33 Ga0075366_10033178 3300006195 Bacteria 3041
34 Ga0075366_10141701 3300006195 Bacteria 1454
35 Ga0097621_100065157 3300006237 Bacteria 2997
36 Ga0097621_100230649 3300006237 Bacteria 1616
37 Ga0075428_100317156 3300006844 Bacteria 1675
38 Ga0075430_100099699 3300006846 Bacteria 2426
39 Ga0075433_10046510 3300006852 Bacteria 3775
40 Ga0075434_100182729 3300006871 Bacteria 2118
41 Ga0097620_100057141 3300006931 Bacteria 3930
42 Ga0075435_100014316 3300007076 Bacteria 5924
43 Ga0111539_10005338 3300009094 Bacteria 16624
44 Ga0114129_10002212 3300009147 Bacteria 26821
45 Ga0105242_10072608 3300009176 Bacteria 2858
46 Ga0157371_10457624 3300013102 Unclassified 939
47 Ga0157375_10479434 3300013308 Unclassified 1409
48 Ga0157380_10005134 3300014326 Bacteria 9149
49 Ga0157380_10335134 3300014326 Unclassified 1408
50 Ga0157376_10112053 3300014969 Bacteria 2403
51 Ga0157376_10278782 3300014969 Bacteria 1574
52 Ga0213874_10000060 3300021377 Bacteria 15959
53 Ga0213875_10008252 3300021388 Bacteria 5342
54 Ga0213875_10008761 3300021388 Bacteria 5163
55 Ga0207682_10110375 3300025893 Bacteria 1210
56 Ga0207699_10128250 3300025906 Bacteria 1651
57 Ga0207684_10047324 3300025910 Bacteria 3647
58 Ga0207663_10197764 3300025916 Bacteria 1448
59 Ga0207659_10098116 3300025926 Bacteria 2202
60 Ga0207700_10004896 3300025928 Bacteria 7956
61 Ga0207664_10016803 3300025929 Bacteria 5347
62 Ga0207664_10061567 3300025929 Unclassified 2995
63 Ga0207644_10023669 3300025931 Bacteria 4210
64 Ga0207686_10096245 3300025934 Bacteria 1966
65 Ga0207691_10003213 3300025940 Bacteria 15941
66 Ga0207691_10030997 3300025940 Bacteria 4993
67 Ga0207661_10011073 3300025944 Bacteria 6520
68 Ga0207661_10099064 3300025944 Unclassified 2444
69 Ga0207679_10153369 3300025945 Bacteria 1878
70 Ga0207667_10000085 3300025949 Bacteria 151830
71 Ga0207667_10041599 3300025949 Bacteria 4886
72 Ga0207677_10001539 3300026023 Bacteria 12195
73 Ga0207678_10115033 3300026067 Bacteria 2295
74 Ga0207641_10710419 3300026088 Bacteria 990
75 Ga0207648_10358652 3300026089 Bacteria 1315
76 Ga0207683_10062894 3300026121 Bacteria 3269
77 Ga0207428_10077050 3300027907 Bacteria 2610
78 Ga0265337_1001353 3300028556 Bacteria 12090
79 Ga0265320_10000601 3300031240 Bacteria 27549
80 Ga0265339_10008148 3300031249 Bacteria 6689
81 Ga0265316_10003068 3300031344 Bacteria 17042
82 Ga0307513_10121091 3300031456 Unclassified 2584
83 Ga0307408_100013040 3300031548 Bacteria 5513
84 Ga0307408_100034504 3300031548 Bacteria 3544
85 Ga0265314_10000001 3300031711 Bacteria 3792860
86 Ga0265314_10028952 3300031711 Bacteria 4122
87 Ga0307516_10003246 3300031730 Bacteria 21096
88 Ga0307405_10001792 3300031731 Bacteria 9188
89 Ga0307405_10004501 3300031731 Bacteria 6596
90 Ga0307413_10002578 3300031824 Bacteria 7408
91 Ga0307413_10002798 3300031824 Bacteria 7183
92 Ga0307413_10230570 3300031824 Bacteria 1360
93 Ga0307410_10001397 3300031852 Bacteria 10869
94 Ga0307410_10002143 3300031852 Bacteria 9375
95 Ga0307410_10090464 3300031852 Bacteria 2171
96 Ga0307410_10152931 3300031852 Bacteria 1720
97 Ga0307406_10011265 3300031901 Bacteria 5072
98 Ga0307406_10015888 3300031901 Bacteria 4365
99 Ga0307406_10023633 3300031901 Bacteria 3660
100 Ga0307407_10002057 3300031903 Bacteria 7696
101 Ga0307407_10002122 3300031903 Bacteria 7621
102 Ga0307412_10016606 3300031911 Bacteria 4390
103 Ga0307412_10113145 3300031911 Bacteria 1941
104 Ga0307409_100000525 3300031995 Bacteria 16581
105 Ga0307409_100327279 3300031995 Bacteria 1436
106 Ga0307416_100012057 3300032002 Bacteria 5802
107 Ga0307416_100023454 3300032002 Bacteria 4478
108 Ga0307414_10076661 3300032004 Bacteria 2430
109 Ga0307411_10001088 3300032005 Bacteria 10561
110 Ga0307415_100004701 3300032126 Bacteria 7143
111 Ga0307415_100241778 3300032126 Bacteria 1461
112 Ga0307507_10045628 3300033179 Bacteria 4308
113 Ga0373934_0001394 3300035086 Bacteria 8817
114 Ga0373923_0005282 3300035111 Bacteria 4378
115 Ga0373953_0001725 3300035117 Bacteria 6445
116 Ga0373954_0007669 3300035118 Bacteria 4727
117 Ga0373956_0001473 3300035119 Bacteria 9725
118 Ga0373955_0000409 3300035172 Bacteria 18249
119 Ga0373931_0251516 3300035691 Bacteria 1075
120 Ga0373935_0022761 3300035692 Bacteria 3847
121 Ga0373927_0015490 3300035695 Bacteria 5037
122 Ga0373933_0000834 3300035724 Bacteria 18838
123 Ga0373937_0000144 3300036401 Bacteria 68655
124 Ga0373937_0411406 3300036401 Bacteria 1283
125 Ga0373925_0035049 3300037068 Bacteria 3701
126 Ga0436364_1236958 3300037853 Bacteria 15906
127 Ga0436363_0037010 3300039450 Bacteria 21575
128 Ga0436363_0266319 3300039450 Archaea 986
129 Ga0436363_0807389 3300039450 Bacteria 2859
130 Ga0436363_1419936 3300039450 Bacteria 1607
131 Ga0436363_1657689 3300039450 Bacteria 2705
132 Ga0439465_0072312 3300041413 Bacteria 1157
133 Ga0451797_0301052 3300041453 Unclassified 2371
134 Ga0451807_1244616 3300041486 Bacteria 1142
135 Ga0439445_0002834 3300042004 Bacteria 3874
136 Ga0451577_0000134 3300042876 Bacteria 165856
137 Ga0451577_0000382 3300042876 Bacteria 82167
138 Ga0451577_0031357 3300042876 Bacteria 4796
139 Ga0453683_0006674 3300044673 Bacteria 7897
140 Ga0466963_0473412 3300044694 Bacteria 884
141 Ga0453684_0000426 3300044712 Bacteria 172005
142 Ga0453684_0000776 3300044712 Bacteria 110037
143 Ga0453684_0016923 3300044712 Bacteria 11339
144 Ga0453684_0203920 3300044712 Bacteria 2303
145 Ga0453684_0460880 3300044712 Bacteria 1413
146 Ga0466970_0226993 3300044765 Bacteria 1043
147 Ga0466960_0035549 3300044901 Bacteria 2329
148 Ga0466960_0098026 3300044901 Bacteria 1505
149 Ga0451576_0036021 3300045051 Bacteria 5249
150 Ga0451576_0042264 3300045051 Bacteria 4813
151 Ga0466958_0035251 3300045836 Bacteria 2989
152 Ga0466967_0077914 3300045976 Bacteria 2985
153 Ga0466967_0351203 3300045976 Bacteria 1427
154 Ga0466967_0897304 3300045976 Bacteria 881
155 Ga0495592_0002871 3300046454 Bacteria 12254
156 Ga0495629_0019648 3300046459 Bacteria 4823
157 Ga0495651_0000208 3300046462 Bacteria 44905
158 Ga0495653_0001088 3300046463 Bacteria 20973
159 Ga0495608_0002865 3300046511 Bacteria 12344
160 Ga0495628_0000414 3300046516 Bacteria 39218
161 Ga0495630_0036930 3300046517 Bacteria 3652
162 Ga0495652_0013108 3300046529 Bacteria 7466
163 Ga0495587_0000166 3300046536 Bacteria 47900
164 Ga0495645_0000326 3300046543 Bacteria 33842
165 Ga0495667_0008451 3300046559 Bacteria 6987
166 Ga0495635_0001508 3300046663 Bacteria 15602
167 Ga0495657_0000359 3300046675 Bacteria 41984
168 Ga0495599_0018952 3300046678 Bacteria 4289
169 Ga0495623_0000312 3300046679 Bacteria 31331
170 Ga0495646_0003377 3300046680 Bacteria 9920
171 Ga0495613_0024672 3300046689 Bacteria 4480
172 Ga0495600_0000131 3300046809 Bacteria 42268
173 Ga0495604_0000528 3300047317 Bacteria 33758
174 Ga0495674_0005840 3300047319 Bacteria 11806
175 Ga0495680_0066972 3300047322 Bacteria 2746
176 Ga0495684_0000476 3300047471 Bacteria 32788
177 Ga0495602_0000999 3300048088 Bacteria 27489
178 Ga0496122_0089584 3300048925 Bacteria 2103
179 Ga0501034_0139245 3300049571 Bacteria 2407
180 Ga0501034_0439382 3300049571 Bacteria 1224
181 Ga0501038_0023457 3300049574 Bacteria 5515
182 Ga0501043_0024231 3300049579 Bacteria 4762
183 Ga0501047_0002553 3300049581 Bacteria 17354
184 Ga0501067_0002787 3300049583 Bacteria 9612
185 Ga0501068_0000154 3300049584 Bacteria 31816
186 Ga0501069_0003470 3300049585 Bacteria 8119
187 Ga0501070_0016991 3300049586 Bacteria 6105
188 Ga0501072_0000002 3300049588 Bacteria 319523
189 Ga0501073_0008395 3300049589 Bacteria 7662
190 Ga0501074_0003998 3300049590 Bacteria 10512
191 Ga0501074_0267038 3300049590 Bacteria 1216
192 Ga0501076_0009420 3300049592 Bacteria 7210
193 Ga0501077_0001475 3300049593 Bacteria 14172
194 Ga0501207_023219 3300049654 Bacteria 1006
195 Ga0501235_014022 3300049669 Bacteria 1767
196 Ga0501259_009536 3300049688 Bacteria 1577
197 Ga0501080_0011599 3300049742 Bacteria 8070
198 Ga0501083_0039892 3300049744 Bacteria 3188
199 nmdc:mga0k408_34337_c1 3300050493 Bacteria 2903
200 nmdc:mga05p37_1281_c1 3300050507 Bacteria 29212
201 nmdc:mga0qj67_88097_c1 3300050509 Bacteria 2492
202 nmdc:mga08y16_15804_c1 3300050511 Bacteria 7936
203 nmdc:mga0n895_436232_c1 3300050512 Bacteria 1323
204 nmdc:mga0rr50_114456_c1 3300050513 Bacteria 2139
205 nmdc:mga0a205_34733_c1 3300050515 Bacteria 4838
206 Ga0495612_0005786 3300053078 Bacteria 5104
207 Ga0495595_0015102 3300053084 Bacteria 3289
208 Ga0495619_0027357 3300053085 Bacteria 3671
209 Ga0501084_0000054 3300054114 Bacteria 90236
210 Ga0501084_0036694 3300054114 Bacteria 4095
211 Ga0501082_0000035 3300060353 Bacteria 96746
212 Ga0466962_0251278 3300061719 Unclassified 869
213 Ga0530510_0028074 3300061734 Bacteria 4035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10358652 Ga0207648_103586522 239
2 3300044694 Ga0466963_0473412 Ga0466963_0473412_49_849 247
3 3300045976 Ga0466967_0897304 Ga0466967_0897304_37_837 247
4 3300049574 Ga0501038_0023457 Ga0501038_0023457_3511_4338 250
5 3300049579 Ga0501043_0024231 Ga0501043_0024231_1914_2741 250
6 3300049581 Ga0501047_0002553 Ga0501047_0002553_6610_7437 250
7 3300049583 Ga0501067_0002787 Ga0501067_0002787_4202_5029 250
8 3300049584 Ga0501068_0000154 Ga0501068_0000154_3620_4447 250
9 3300049585 Ga0501069_0003470 Ga0501069_0003470_3525_4352 250
10 3300049586 Ga0501070_0016991 Ga0501070_0016991_1412_2239 250
11 3300049588 Ga0501072_0000002 Ga0501072_0000002_161798_162625 250
12 3300049589 Ga0501073_0008395 Ga0501073_0008395_1789_2616 250
13 3300049590 Ga0501074_0003998 Ga0501074_0003998_1978_2805 250
14 3300049592 Ga0501076_0009420 Ga0501076_0009420_4914_5741 250
15 3300049593 Ga0501077_0001475 Ga0501077_0001475_3717_4544 250
16 3300049742 Ga0501080_0011599 Ga0501080_0011599_2682_3509 250
17 3300049744 Ga0501083_0039892 Ga0501083_0039892_2067_2894 250
18 3300054114 Ga0501084_0000054 Ga0501084_0000054_11876_12703 250
19 3300060353 Ga0501082_0000035 Ga0501082_0000035_44422_45249 250
20 3300061734 Ga0530510_0028074 Ga0530510_0028074_863_1690 250
21 3300031249 Ga0265339_10008148 Ga0265339_100081482 251
22 3300031344 Ga0265316_10003068 Ga0265316_100030682 251
23 3300031711 Ga0265314_10000001 Ga0265314_100000012530 251
24 3300049571 Ga0501034_0139245 Ga0501034_0139245_697_1566 253
25 3300061719 Ga0466962_0251278 Ga0466962_0251278_52_831 255
26 3300005331 Ga0070670_100070569 Ga0070670_1000705692 256
27 3300005435 Ga0070714_100060332 Ga0070714_1000603322 256
28 3300005436 Ga0070713_100289129 Ga0070713_1002891292 256
29 3300005437 Ga0070710_10043206 Ga0070710_100432063 256
30 3300025929 Ga0207664_10016803 Ga0207664_100168032 256
31 3300005329 Ga0070683_100021031 Ga0070683_1000210315 257
32 3300033179 Ga0307507_10045628 Ga0307507_100456284 257
33 3300031824 Ga0307413_10230570 Ga0307413_102305702 259
34 3300031852 Ga0307410_10090464 Ga0307410_100904642 259
35 3300049688 Ga0501259_009536 Ga0501259_009536_511_1296 259
36 3300003322 rootL2_10080055 rootL2_100800553 262
37 3300006195 Ga0075366_10033178 Ga0075366_100331782 262
38 3300039450 Ga0436363_0807389 Ga0436363_0807389_2041_2835 262
39 3300005344 Ga0070661_100264875 Ga0070661_1002648752 263
40 3300025945 Ga0207679_10153369 Ga0207679_101533692 263
41 3300031548 Ga0307408_100013040 Ga0307408_1000130403 263
42 3300031731 Ga0307405_10004501 Ga0307405_100045013 263
43 3300031824 Ga0307413_10002578 Ga0307413_100025785 263
44 3300031852 Ga0307410_10002143 Ga0307410_100021432 263
45 3300031901 Ga0307406_10015888 Ga0307406_100158882 263
46 3300031903 Ga0307407_10002122 Ga0307407_100021222 263
47 3300031911 Ga0307412_10113145 Ga0307412_101131451 263
48 3300031995 Ga0307409_100327279 Ga0307409_1003272792 263
49 3300032002 Ga0307416_100012057 Ga0307416_1000120577 263
50 3300032004 Ga0307414_10076661 Ga0307414_100766612 263
51 3300032005 Ga0307411_10001088 Ga0307411_100010889 263
52 3300032126 Ga0307415_100004701 Ga0307415_1000047013 263
53 3300049654 Ga0501207_023219 Ga0501207_023219_143_949 263
54 3300049669 Ga0501235_014022 Ga0501235_014022_913_1719 263
55 3300039450 Ga0436363_1419936 Ga0436363_1419936_188_997 264
56 3300005333 Ga0070677_10019920 Ga0070677_100199202 265
57 3300005354 Ga0070675_100013936 Ga0070675_1000139363 265
58 3300005456 Ga0070678_100067733 Ga0070678_1000677332 265
59 3300013102 Ga0157371_10457624 Ga0157371_104576241 265
60 3300013308 Ga0157375_10479434 Ga0157375_104794341 265
61 3300014326 Ga0157380_10005134 Ga0157380_100051346 265
62 3300025893 Ga0207682_10110375 Ga0207682_101103752 265
63 3300025926 Ga0207659_10098116 Ga0207659_100981162 265
64 3300025940 Ga0207691_10030997 Ga0207691_100309973 265
65 3300026121 Ga0207683_10062894 Ga0207683_100628942 265
66 3300044901 Ga0466960_0098026 Ga0466960_0098026_613_1455 265
67 3300005367 Ga0070667_100386882 Ga0070667_1003868822 266
68 3300005444 Ga0070694_100158232 Ga0070694_1001582322 266
69 3300005455 Ga0070663_100065681 Ga0070663_1000656812 266
70 3300005467 Ga0070706_100086144 Ga0070706_1000861442 266
71 3300006852 Ga0075433_10046510 Ga0075433_100465102 266
72 3300006871 Ga0075434_100182729 Ga0075434_1001827292 266
73 3300009147 Ga0114129_10002212 Ga0114129_1000221212 266
74 3300021377 Ga0213874_10000060 Ga0213874_100000602 266
75 3300025910 Ga0207684_10047324 Ga0207684_100473242 266
76 3300025931 Ga0207644_10023669 Ga0207644_100236692 266
77 3300026067 Ga0207678_10115033 Ga0207678_101150332 266
78 3300039450 Ga0436363_0037010 Ga0436363_0037010_518_1333 266
79 3300044901 Ga0466960_0035549 Ga0466960_0035549_563_1366 266
80 3300045051 Ga0451576_0042264 Ga0451576_0042264_2165_2965 266
81 3300050507 nmdc:mga05p37_1281_c1 nmdc:mga05p37_1281_c1_20050_20868 266
82 3300050512 nmdc:mga0n895_436232_c1 nmdc:mga0n895_436232_c1_56_874 266
83 3300050515 nmdc:mga0a205_34733_c1 nmdc:mga0a205_34733_c1_2147_2965 266
84 3300021388 Ga0213875_10008252 Ga0213875_100082522 268
85 3300021388 Ga0213875_10008761 Ga0213875_100087614 268
86 3300037853 Ga0436364_1236958 Ga0436364_1236958_7297_8124 268
87 3300039450 Ga0436363_0266319 Ga0436363_0266319_26_850 268
88 3300039450 Ga0436363_1657689 Ga0436363_1657689_1224_2066 268
89 3300044712 Ga0453684_0460880 Ga0453684_0460880_468_1280 268
90 3300049590 Ga0501074_0267038 Ga0501074_0267038_359_1180 269
91 3300006844 Ga0075428_100317156 Ga0075428_1003171562 270
92 3300025944 Ga0207661_10011073 Ga0207661_100110732 270
93 3300032126 Ga0307415_100241778 Ga0307415_1002417782 270
94 3300044673 Ga0453683_0006674 Ga0453683_0006674_6643_7476 270
95 3300049571 Ga0501034_0439382 Ga0501034_0439382_317_1183 270
96 iso_pu_bacteria 2711768088 2712197934 270
97 iso_pu_bacteria 2881633906 2881634137 270
98 3300031995 Ga0307409_100000525 Ga0307409_10000052511 271
99 3300041453 Ga0451797_0301052 Ga0451797_0301052_131_964 271
100 3300042876 Ga0451577_0000134 Ga0451577_0000134_163628_164482 271
101 3300044712 Ga0453684_0000426 Ga0453684_0000426_7501_8355 271
102 3300044712 Ga0453684_0016923 Ga0453684_0016923_3008_3829 272
103 3300005338 Ga0068868_100004578 Ga0068868_1000045789 273
104 3300005439 Ga0070711_100291091 Ga0070711_1002910912 273
105 3300006237 Ga0097621_100065157 Ga0097621_1000651574 273
106 3300009176 Ga0105242_10072608 Ga0105242_100726083 273
107 3300014969 Ga0157376_10112053 Ga0157376_101120532 273
108 3300025906 Ga0207699_10128250 Ga0207699_101282503 273
109 3300025934 Ga0207686_10096245 Ga0207686_100962451 273
110 3300026023 Ga0207677_10001539 Ga0207677_1000153910 273
111 3300042876 Ga0451577_0000382 Ga0451577_0000382_19484_20308 273
112 3300044712 Ga0453684_0000776 Ga0453684_0000776_47326_48150 273
113 3300005434 Ga0070709_10056837 Ga0070709_100568372 274
114 3300005437 Ga0070710_10072812 Ga0070710_100728121 274
115 3300005614 Ga0068856_100284853 Ga0068856_1002848532 274
116 3300006846 Ga0075430_100099699 Ga0075430_1000996992 274
117 3300031456 Ga0307513_10121091 Ga0307513_101210912 274
118 3300042876 Ga0451577_0031357 Ga0451577_0031357_1392_2252 274
119 3300044712 Ga0453684_0203920 Ga0453684_0203920_1012_1872 274
120 3300048925 Ga0496122_0089584 Ga0496122_0089584_98_1009 274
121 3300050509 nmdc:mga0qj67_88097_c1 nmdc:mga0qj67_88097_c1_1150_1980 274
122 3300005434 Ga0070709_10011093 Ga0070709_100110934 275
123 3300005435 Ga0070714_100033453 Ga0070714_1000334534 275
124 3300005436 Ga0070713_100000487 Ga0070713_10000048713 275
125 3300006028 Ga0070717_10024308 Ga0070717_100243084 275
126 3300006175 Ga0070712_100005352 Ga0070712_1000053526 275
127 3300025916 Ga0207663_10197764 Ga0207663_101977643 275
128 3300025928 Ga0207700_10004896 Ga0207700_100048964 275
129 3300025929 Ga0207664_10061567 Ga0207664_100615672 275
130 3300025949 Ga0207667_10000085 Ga0207667_1000008520 275
131 3300031730 Ga0307516_10003246 Ga0307516_1000324611 275
132 3300035086 Ga0373934_0001394 Ga0373934_0001394_2119_3012 275
133 3300035117 Ga0373953_0001725 Ga0373953_0001725_2597_3490 275
134 3300035118 Ga0373954_0007669 Ga0373954_0007669_2958_3851 275
135 3300035119 Ga0373956_0001473 Ga0373956_0001473_7964_8857 275
136 3300035172 Ga0373955_0000409 Ga0373955_0000409_5870_6763 275
137 3300035724 Ga0373933_0000834 Ga0373933_0000834_7783_8676 275
138 3300036401 Ga0373937_0000144 Ga0373937_0000144_33391_34284 275
139 3300045836 Ga0466958_0035251 Ga0466958_0035251_1395_2303 275
140 3300045976 Ga0466967_0077914 Ga0466967_0077914_344_1255 275
141 3300045976 Ga0466967_0351203 Ga0466967_0351203_240_1148 275
142 3300046454 Ga0495592_0002871 Ga0495592_0002871_3819_4712 275
143 3300046459 Ga0495629_0019648 Ga0495629_0019648_791_1684 275
144 3300046462 Ga0495651_0000208 Ga0495651_0000208_43733_44626 275
145 3300046463 Ga0495653_0001088 Ga0495653_0001088_6909_7802 275
146 3300046511 Ga0495608_0002865 Ga0495608_0002865_8105_8998 275
147 3300046516 Ga0495628_0000414 Ga0495628_0000414_31444_32337 275
148 3300046517 Ga0495630_0036930 Ga0495630_0036930_434_1327 275
149 3300046529 Ga0495652_0013108 Ga0495652_0013108_510_1403 275
150 3300046536 Ga0495587_0000166 Ga0495587_0000166_26740_27633 275
151 3300046543 Ga0495645_0000326 Ga0495645_0000326_15451_16344 275
152 3300046559 Ga0495667_0008451 Ga0495667_0008451_161_1054 275
153 3300046663 Ga0495635_0001508 Ga0495635_0001508_6913_7806 275
154 3300046675 Ga0495657_0000359 Ga0495657_0000359_34120_35013 275
155 3300046678 Ga0495599_0018952 Ga0495599_0018952_2498_3391 275
156 3300046679 Ga0495623_0000312 Ga0495623_0000312_434_1327 275
157 3300046680 Ga0495646_0003377 Ga0495646_0003377_8341_9234 275
158 3300046689 Ga0495613_0024672 Ga0495613_0024672_2209_3102 275
159 3300046809 Ga0495600_0000131 Ga0495600_0000131_38636_39529 275
160 3300047317 Ga0495604_0000528 Ga0495604_0000528_24895_25788 275
161 3300047319 Ga0495674_0005840 Ga0495674_0005840_7365_8258 275
162 3300047322 Ga0495680_0066972 Ga0495680_0066972_388_1281 275
163 3300047471 Ga0495684_0000476 Ga0495684_0000476_26823_27716 275
164 3300048088 Ga0495602_0000999 Ga0495602_0000999_6130_7023 275
165 3300050493 nmdc:mga0k408_34337_c1 nmdc:mga0k408_34337_c1_1686_2519 275
166 3300053078 Ga0495612_0005786 Ga0495612_0005786_3168_4061 275
167 3300053084 Ga0495595_0015102 Ga0495595_0015102_65_958 275
168 3300053085 Ga0495619_0027357 Ga0495619_0027357_279_1172 275
169 3300054114 Ga0501084_0036694 Ga0501084_0036694_1198_2028 275
170 3300005337 Ga0070682_100002382 Ga0070682_1000023825 276
171 3300005338 Ga0068868_100156451 Ga0068868_1001564513 276
172 3300005548 Ga0070665_100626293 Ga0070665_1006262931 276
173 3300005614 Ga0068856_100019098 Ga0068856_1000190984 276
174 3300006195 Ga0075366_10141701 Ga0075366_101417012 276
175 3300006931 Ga0097620_100057141 Ga0097620_1000571412 276
176 3300007076 Ga0075435_100014316 Ga0075435_1000143162 276
177 3300009094 Ga0111539_10005338 Ga0111539_100053385 276
178 3300014969 Ga0157376_10278782 Ga0157376_102787821 276
179 3300026088 Ga0207641_10710419 Ga0207641_107104191 276
180 3300027907 Ga0207428_10077050 Ga0207428_100770502 276
181 3300028556 Ga0265337_1001353 Ga0265337_10013533 276
182 3300031240 Ga0265320_10000601 Ga0265320_1000060116 276
183 3300031548 Ga0307408_100034504 Ga0307408_1000345042 276
184 3300031711 Ga0265314_10028952 Ga0265314_100289522 276
185 3300031731 Ga0307405_10001792 Ga0307405_100017927 276
186 3300031824 Ga0307413_10002798 Ga0307413_100027985 276
187 3300031852 Ga0307410_10001397 Ga0307410_100013972 276
188 3300031852 Ga0307410_10152931 Ga0307410_101529312 276
189 3300031901 Ga0307406_10011265 Ga0307406_100112654 276
190 3300031901 Ga0307406_10023633 Ga0307406_100236332 276
191 3300031903 Ga0307407_10002057 Ga0307407_100020572 276
192 3300031911 Ga0307412_10016606 Ga0307412_100166066 276
193 3300032002 Ga0307416_100023454 Ga0307416_1000234546 276
194 3300035111 Ga0373923_0005282 Ga0373923_0005282_3289_4209 276
195 3300035691 Ga0373931_0251516 Ga0373931_0251516_39_875 276
196 3300035692 Ga0373935_0022761 Ga0373935_0022761_1865_2701 276
197 3300035695 Ga0373927_0015490 Ga0373927_0015490_227_1063 276
198 3300036401 Ga0373937_0411406 Ga0373937_0411406_371_1201 276
199 3300037068 Ga0373925_0035049 Ga0373925_0035049_633_1469 276
200 3300041413 Ga0439465_0072312 Ga0439465_0072312_214_1062 276
201 3300041486 Ga0451807_1244616 Ga0451807_1244616_50_910 276
202 3300042004 Ga0439445_0002834 Ga0439445_0002834_951_1799 276
203 3300044765 Ga0466970_0226993 Ga0466970_0226993_40_882 276
204 3300045051 Ga0451576_0036021 Ga0451576_0036021_1541_2404 276
205 3300050511 nmdc:mga08y16_15804_c1 nmdc:mga08y16_15804_c1_2681_3511 276
206 3300050513 nmdc:mga0rr50_114456_c1 nmdc:mga0rr50_114456_c1_508_1338 276
207 3300014326 Ga0157380_10335134 Ga0157380_103351341 277
208 3300005563 Ga0068855_100024276 Ga0068855_1000242764 279
209 3300025949 Ga0207667_10041599 Ga0207667_100415994 279
210 3300003320 rootH2_10035728 rootH2_100357284 280
211 3300003323 rootH1_10101855 rootH1_101018554 280
212 3300005543 Ga0070672_100000141 Ga0070672_1000001414 280
213 3300006237 Ga0097621_100230649 Ga0097621_1002306492 280
214 3300025940 Ga0207691_10003213 Ga0207691_100032133 280
215 3300025944 Ga0207661_10099064 Ga0207661_100990643 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

35

126

0.84

PF00733

Asn_synthase

Asparagine synthase

35

119

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9381 6 264
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9356 7 263
5udv-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with iron 0.9355 6 264
6utq-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9345 6 264
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9345 6 264
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9213 11 172 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9104 11 172 3.40.50.620
af_O96136_47_161_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7905 38 82 3.40.50.10130
af_P77718_175_396_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7634 24 178 3.40.50.620
af_Q58366_8_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7457 19 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6P0T2Z9-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9921 7 220 GO:0016783
AF-A0A354BF41-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9904 8 208 GO:0004066
GO:0006529
GO:0016783
AF-A0A2V7ASI4-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9862 7 228 GO:0016783
AF-A0A0F9CUY8-F1-model_v4 NAD/GMP synthase domain-containing protein 0.9855 3 220 GO:0016783
AF-A0A349K7C3-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9853 1 191 GO:0016783

Feature Viewer

pLDDT pTM Quality
90.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map