F327148

General Info

Members Datasets Scaffolds Average Seq Length
216 135 205 156

Family's Representative Sequence

Representative Sequence 3300003214|JGI25165J46597_1002712|JGI25165J46597_10027122
Length 161
Sequence MGQMLKFRYLATAALSGLLFGAGLYVSQMVDPLKVLRFLDFGAIPSGGWDPSLAFVIAPAIVVMFIAVRIARPRPSPLFDTAFHGPTFTRIDAPLVAGAALFGLGWGMSGICPGPAIALVAFLPSNLWIFLVAVFVGSYLGGLTMARTNPEPAEIQAXPAE

Samples

Sample ID Description Type Environment
1 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
2 2643221580 Devosia sp. Root635 Isolate Unclassified
3 2643221591 Devosia sp. Root685 Isolate Unclassified
4 2643221629 Devosia sp. Root105 Isolate Unclassified
5 2643221662 Devosia sp. Root413D1 Isolate Unclassified
6 2643221674 Devosia sp. Root436 Isolate Unclassified
7 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
8 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
9 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
10 2932401849 Devosia sp. 2618 Isolate Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
135 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 1.39
Isolates 5.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 1.39
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1002712 3300003214 Bacteria 5252
2 Ga0070658_10013399 3300005327 Bacteria 6578
3 Ga0070658_10073850 3300005327 Bacteria 2797
4 Ga0070658_10484746 3300005327 Bacteria 1067
5 Ga0068868_100338712 3300005338 Bacteria 1285
6 Ga0070660_100006116 3300005339 Bacteria 8324
7 Ga0070660_100043471 3300005339 Bacteria 3433
8 Ga0070661_100024508 3300005344 Bacteria 4328
9 Ga0070661_100025444 3300005344 Bacteria 4253
10 Ga0070661_100047172 3300005344 Bacteria 3153
11 Ga0070661_100621204 3300005344 Bacteria 875
12 Ga0070659_100067883 3300005366 Bacteria 2828
13 Ga0070659_100083615 3300005366 Bacteria 2552
14 Ga0070659_100424167 3300005366 Bacteria 1125
15 Ga0070659_100828818 3300005366 Bacteria 806
16 Ga0070663_101324488 3300005455 Bacteria 636
17 Ga0070662_100328642 3300005457 Bacteria 1249
18 Ga0070681_11350162 3300005458 Bacteria 636
19 Ga0070679_100071081 3300005530 Bacteria 3471
20 Ga0068853_100013217 3300005539 Bacteria 6737
21 Ga0068853_100052062 3300005539 Bacteria 3526
22 Ga0068853_100062881 3300005539 Bacteria 3213
23 Ga0070672_100492053 3300005543 Bacteria 1060
24 Ga0070665_100103231 3300005548 Bacteria 2854
25 Ga0070665_100404037 3300005548 Bacteria 1374
26 Ga0068855_100058763 3300005563 Bacteria 4502
27 Ga0068855_100182254 3300005563 Bacteria 2374
28 Ga0068855_100843498 3300005563 Bacteria 971
29 Ga0068855_101367035 3300005563 Bacteria 731
30 Ga0068857_100013461 3300005577 Bacteria 7125
31 Ga0068857_101112724 3300005577 Bacteria 763
32 Ga0068854_100010975 3300005578 Bacteria 5879
33 Ga0068854_100854320 3300005578 Bacteria 797
34 Ga0068856_100204485 3300005614 Bacteria 1989
35 Ga0068856_100432919 3300005614 Bacteria 1335
36 Ga0068852_100006649 3300005616 Bacteria 8378
37 Ga0068852_100024276 3300005616 Bacteria 4897
38 Ga0068852_100041420 3300005616 Bacteria 3892
39 Ga0068852_101522360 3300005616 Bacteria 691
40 Ga0075368_10263404 3300006042 Bacteria 738
41 Ga0097621_100295351 3300006237 Bacteria 1430
42 Ga0075370_10207381 3300006353 Bacteria 1157
43 Ga0075370_10953300 3300006353 Unclassified 525
44 Ga0068865_100189217 3300006881 Bacteria 1590
45 Ga0105240_10071843 3300009093 Bacteria 4279
46 Ga0105241_10193867 3300009174 Bacteria 1693
47 Ga0105237_10000449 3300009545 Bacteria 58586
48 Ga0105237_11910619 3300009545 Bacteria 602
49 Ga0105238_10099565 3300009551 Bacteria 2890
50 Ga0105238_10177639 3300009551 Bacteria 2106
51 Ga0105239_10009975 3300010375 Bacteria 10658
52 Ga0105239_10234949 3300010375 Bacteria 2057
53 Ga0105239_10276985 3300010375 Bacteria 1888
54 Ga0105239_11490158 3300010375 Bacteria 782
55 Ga0157373_10037282 3300013100 Bacteria 3486
56 Ga0157373_10173691 3300013100 Bacteria 1516
57 Ga0157371_10008162 3300013102 Bacteria 8371
58 Ga0157371_10199899 3300013102 Bacteria 1432
59 Ga0157370_10034029 3300013104 Bacteria 4965
60 Ga0157370_10080570 3300013104 Bacteria 3065
61 Ga0157370_10160762 3300013104 Bacteria 2090
62 Ga0157370_11198888 3300013104 Bacteria 685
63 Ga0157369_10066777 3300013105 Bacteria 3869
64 Ga0157369_10122701 3300013105 Bacteria 2756
65 Ga0157369_10226797 3300013105 Bacteria 1954
66 Ga0157369_10517663 3300013105 Bacteria 1234
67 Ga0157374_10015333 3300013296 Bacteria 6722
68 Ga0157378_10397146 3300013297 Bacteria 1358
69 Ga0157372_10110687 3300013307 Bacteria 3146
70 Ga0157372_11132281 3300013307 Bacteria 905
71 Ga0163163_12096180 3300014325 Bacteria 625
72 Ga0197907_10579377 3300020069 Bacteria 1244
73 Ga0206356_10051688 3300020070 Bacteria 715
74 Ga0206353_11133977 3300020082 Bacteria 1752
75 Ga0209233_1004974 3300025261 Bacteria 4467
76 Ga0207647_10106596 3300025904 Bacteria 1659
77 Ga0207645_10385846 3300025907 Bacteria 941
78 Ga0207705_10037978 3300025909 Bacteria 3447
79 Ga0207705_10159067 3300025909 Bacteria 1696
80 Ga0207654_10077951 3300025911 Bacteria 1988
81 Ga0207707_11035933 3300025912 Bacteria 672
82 Ga0207695_10066670 3300025913 Bacteria 3696
83 Ga0207671_10000439 3300025914 Bacteria 57260
84 Ga0207671_10832326 3300025914 Bacteria 731
85 Ga0207657_10015968 3300025919 Bacteria 7252
86 Ga0207657_10018131 3300025919 Bacteria 6734
87 Ga0207649_10030843 3300025920 Bacteria 3180
88 Ga0207649_10054321 3300025920 Bacteria 2492
89 Ga0207649_10328457 3300025920 Bacteria 1126
90 Ga0207652_10823807 3300025921 Bacteria 823
91 Ga0207652_10994157 3300025921 Bacteria 738
92 Ga0207694_11350283 3300025924 Bacteria 603
93 Ga0207659_10177059 3300025926 Bacteria 1687
94 Ga0207690_10041697 3300025932 Bacteria 3010
95 Ga0207690_10119285 3300025932 Bacteria 1913
96 Ga0207690_10491664 3300025932 Bacteria 991
97 Ga0207690_10667524 3300025932 Bacteria 853
98 Ga0207690_10683798 3300025932 Bacteria 843
99 Ga0207706_10053421 3300025933 Bacteria 3566
100 Ga0207704_10542933 3300025938 Bacteria 943
101 Ga0207691_10706073 3300025940 Bacteria 850
102 Ga0207661_10475731 3300025944 Bacteria 1140
103 Ga0207667_10067980 3300025949 Bacteria 3711
104 Ga0207667_10089702 3300025949 Bacteria 3177
105 Ga0207667_11370126 3300025949 Bacteria 682
106 Ga0207640_10911697 3300025981 Bacteria 768
107 Ga0207640_11051680 3300025981 Bacteria 718
108 Ga0207658_10150951 3300025986 Bacteria 1893
109 Ga0207639_10004587 3300026041 Bacteria 9298
110 Ga0207639_10141089 3300026041 Bacteria 2007
111 Ga0207639_10388663 3300026041 Bacteria 1254
112 Ga0207678_11209257 3300026067 Bacteria 669
113 Ga0207702_10062913 3300026078 Bacteria 3171
114 Ga0207702_10605404 3300026078 Bacteria 1075
115 Ga0207702_10835289 3300026078 Bacteria 911
116 Ga0207674_10012591 3300026116 Bacteria 9454
117 Ga0207683_10861033 3300026121 Bacteria 841
118 Ga0207698_10041277 3300026142 Bacteria 3436
119 Ga0207698_10405401 3300026142 Bacteria 1304
120 Ga0268266_10000474 3300028379 Bacteria 57849
121 Ga0265318_10008026 3300028577 Bacteria 4726
122 Ga0265332_10144536 3300031238 Bacteria 996
123 Ga0265320_10028777 3300031240 Bacteria 2882
124 Ga0265340_10098326 3300031247 Bacteria 1362
125 Ga0265331_10099912 3300031250 Bacteria 1336
126 Ga0265327_10064840 3300031251 Bacteria 1850
127 Ga0265314_10036366 3300031711 Bacteria 3579
128 Ga0265342_10069704 3300031712 Bacteria 2053
129 Ga0307516_10427359 3300031730 Bacteria 982
130 Ga0307412_11616474 3300031911 Bacteria 592
131 Ga0307414_10071544 3300032004 Bacteria 2502
132 Ga0307414_10083384 3300032004 Bacteria 2347
133 Ga0373932_0134457 3300035112 Bacteria 836
134 Ga0373960_0128783 3300035121 Bacteria 847
135 Ga0373962_0300448 3300035242 Bacteria 569
136 Ga0316582_0714381 3300036647 Unclassified 688
137 Ga0395899_0035154 3300037312 Bacteria 3762
138 Ga0395899_0177782 3300037312 Bacteria 1495
139 Ga0395900_0196929 3300037418 Bacteria 2040
140 Ga0395900_0330046 3300037418 Bacteria 1504
141 Ga0395900_0368530 3300037418 Bacteria 1406
142 Ga0395898_0114778 3300037466 Bacteria 2580
143 Ga0395898_1811291 3300037466 Bacteria 531
144 Ga0395901_0316484 3300038443 Bacteria 1615
145 Ga0395901_0890643 3300038443 Bacteria 872
146 Ga0439465_0027030 3300041413 Bacteria 1816
147 Ga0451837_0548234 3300041494 Bacteria 753
148 Ga0451853_2753112 3300041512 Bacteria 789
149 Ga0439445_0106226 3300042004 Bacteria 799
150 Ga0495628_0843858 3300046516 Bacteria 639
151 Ga0496108_0863465 3300048911 Bacteria 778
152 Ga0496110_0023750 3300048913 Bacteria 5218
153 Ga0496116_0083464 3300048919 Bacteria 1972
154 Ga0496122_0000505 3300048925 Bacteria 80571
155 Ga0496122_0245416 3300048925 Bacteria 1006
156 Ga0496123_0000400 3300048926 Bacteria 80571
157 Ga0496124_0089231 3300048927 Bacteria 2518
158 Ga0496124_0169601 3300048927 Bacteria 1692
159 Ga0496124_0171150 3300048927 Bacteria 1682
160 Ga0496124_0311418 3300048927 Bacteria 1132
161 Ga0496125_0000217 3300048928 Bacteria 117498
162 Ga0496126_0125573 3300048929 Bacteria 2221
163 Ga0496126_0149856 3300048929 Bacteria 2000
164 Ga0501031_0025780 3300049568 Bacteria 3836
165 Ga0501031_0432153 3300049568 Bacteria 851
166 Ga0501032_0017227 3300049569 Bacteria 5074
167 Ga0501032_0066765 3300049569 Bacteria 2404
168 Ga0501033_0264242 3300049570 Bacteria 1217
169 Ga0501034_0004211 3300049571 Bacteria 16059
170 Ga0501034_0151764 3300049571 Bacteria 2292
171 Ga0501034_0155814 3300049571 Bacteria 2258
172 Ga0501034_0553868 3300049571 Bacteria 1059
173 Ga0501034_0759572 3300049571 Bacteria 864
174 Ga0501034_1055830 3300049571 Bacteria 694
175 Ga0501036_0034608 3300049572 Bacteria 4273
176 Ga0501037_0119831 3300049573 Bacteria 1892
177 Ga0501037_0123419 3300049573 Bacteria 1860
178 Ga0501037_0328531 3300049573 Bacteria 1058
179 Ga0501038_0008126 3300049574 Bacteria 9659
180 Ga0501038_0113607 3300049574 Bacteria 2241
181 Ga0501039_0026711 3300049575 Bacteria 4437
182 Ga0501039_0176959 3300049575 Unclassified 1678
183 Ga0501043_0374561 3300049579 Bacteria 1079
184 Ga0501043_0961802 3300049579 Bacteria 609
185 Ga0501046_0024428 3300049580 Bacteria 4958
186 Ga0501047_0091027 3300049581 Bacteria 2928
187 Ga0501047_0797823 3300049581 Bacteria 759
188 Ga0501048_0505897 3300049582 Bacteria 866
189 Ga0501068_0175799 3300049584 Bacteria 1353
190 Ga0501069_0437396 3300049585 Bacteria 777
191 Ga0501070_0053374 3300049586 Bacteria 3353
192 Ga0501070_0113691 3300049586 Bacteria 2237
193 Ga0501071_0442410 3300049587 Bacteria 995
194 Ga0501073_0264964 3300049589 Bacteria 1186
195 Ga0501073_0760225 3300049589 Bacteria 668
196 Ga0501080_0843588 3300049742 Bacteria 801
197 Ga0501035_0650629 3300049822 Bacteria 854
198 Ga0501044_0199360 3300049823 Bacteria 1960
199 nmdc:mga07m45_144289_c1 3300050496 Bacteria 1379
200 Ga0500562_020268 3300053108 Bacteria 1726
201 Ga0500595_063071 3300053119 Bacteria 1115
202 Ga0500604_0000191 3300053151 Bacteria 17521
203 Ga0500627_0042409 3300053158 Bacteria 1959
204 Ga0500634_0006404 3300053161 Bacteria 5694
205 Ga0500634_0072909 3300053161 Bacteria 1791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0027030 Ga0439465_0027030_575_1048 131
2 iso_pu_bacteria 2600254933 2600375994 140
3 iso_pu_bacteria 2852387548 2852395343 140
4 iso_pu_bacteria 2920822456 2920827255 140
5 iso_pu_bacteria 2887630918 2887633710 143
6 3300048925 Ga0496122_0000505 Ga0496122_0000505_72948_73382 144
7 3300048926 Ga0496123_0000400 Ga0496123_0000400_7190_7624 144
8 3300013100 Ga0157373_10037282 Ga0157373_100372823 145
9 3300013104 Ga0157370_10160762 Ga0157370_101607623 145
10 3300013105 Ga0157369_10226797 Ga0157369_102267973 145
11 iso_pu_bacteria 8054002106 8054003708 146
12 3300036647 Ga0316582_0714381 Ga0316582_0714381_181_639 148
13 3300042004 Ga0439445_0106226 Ga0439445_0106226_258_725 148
14 3300006353 Ga0075370_10953300 Ga0075370_109533001 150
15 3300041494 Ga0451837_0548234 Ga0451837_0548234_79_537 152
16 iso_pu_bacteria 2643221580 2643912380 152
17 iso_pu_bacteria 2643221591 2643963269 152
18 iso_pu_bacteria 2643221674 2644410697 152
19 iso_pu_bacteria 2932401849 2932403429 152
20 3300049589 Ga0501073_0264964 Ga0501073_0264964_498_959 153
21 3300049742 Ga0501080_0843588 Ga0501080_0843588_97_558 153
22 iso_pu_bacteria 2643221629 2644167845 153
23 iso_pu_bacteria 2643221662 2644349304 153
24 3300048927 Ga0496124_0171150 Ga0496124_0171150_592_1056 154
25 3300049579 Ga0501043_0374561 Ga0501043_0374561_556_1020 154
26 3300053161 Ga0500634_0006404 Ga0500634_0006404_3086_3550 154
27 3300053161 Ga0500634_0072909 Ga0500634_0072909_102_566 154
28 3300013307 Ga0157372_11132281 Ga0157372_111322812 155
29 3300032004 Ga0307414_10083384 Ga0307414_100833843 155
30 3300049571 Ga0501034_0151764 Ga0501034_0151764_1666_2133 155
31 3300025986 Ga0207658_10150951 Ga0207658_101509512 156
32 3300031251 Ga0265327_10064840 Ga0265327_100648403 156
33 3300031730 Ga0307516_10427359 Ga0307516_104273592 156
34 3300031911 Ga0307412_11616474 Ga0307412_116164741 156
35 3300032004 Ga0307414_10071544 Ga0307414_100715442 156
36 3300048913 Ga0496110_0023750 Ga0496110_0023750_24_494 156
37 3300048919 Ga0496116_0083464 Ga0496116_0083464_16_486 156
38 3300048925 Ga0496122_0245416 Ga0496122_0245416_502_972 156
39 3300048927 Ga0496124_0089231 Ga0496124_0089231_643_1113 156
40 3300048927 Ga0496124_0169601 Ga0496124_0169601_67_537 156
41 3300048927 Ga0496124_0311418 Ga0496124_0311418_42_512 156
42 3300048928 Ga0496125_0000217 Ga0496125_0000217_107866_108336 156
43 3300048929 Ga0496126_0149856 Ga0496126_0149856_1417_1887 156
44 3300049568 Ga0501031_0025780 Ga0501031_0025780_2238_2711 156
45 3300049571 Ga0501034_0004211 Ga0501034_0004211_12241_12711 156
46 3300049571 Ga0501034_0553868 Ga0501034_0553868_561_1031 156
47 3300049573 Ga0501037_0123419 Ga0501037_0123419_1231_1704 156
48 3300049575 Ga0501039_0176959 Ga0501039_0176959_1096_1569 156
49 3300053119 Ga0500595_063071 Ga0500595_063071_198_668 156
50 3300053151 Ga0500604_0000191 Ga0500604_0000191_1011_1481 156
51 3300005327 Ga0070658_10013399 Ga0070658_100133994 157
52 3300005327 Ga0070658_10073850 Ga0070658_100738502 157
53 3300005338 Ga0068868_100338712 Ga0068868_1003387122 157
54 3300005339 Ga0070660_100043471 Ga0070660_1000434714 157
55 3300005344 Ga0070661_100024508 Ga0070661_1000245086 157
56 3300005344 Ga0070661_100025444 Ga0070661_1000254443 157
57 3300005344 Ga0070661_100047172 Ga0070661_1000471723 157
58 3300005366 Ga0070659_100083615 Ga0070659_1000836152 157
59 3300005366 Ga0070659_100828818 Ga0070659_1008288182 157
60 3300005457 Ga0070662_100328642 Ga0070662_1003286422 157
61 3300005539 Ga0068853_100052062 Ga0068853_1000520622 157
62 3300005539 Ga0068853_100062881 Ga0068853_1000628812 157
63 3300005543 Ga0070672_100492053 Ga0070672_1004920532 157
64 3300005548 Ga0070665_100103231 Ga0070665_1001032312 157
65 3300005548 Ga0070665_100404037 Ga0070665_1004040372 157
66 3300005563 Ga0068855_100058763 Ga0068855_1000587634 157
67 3300005563 Ga0068855_100182254 Ga0068855_1001822542 157
68 3300005563 Ga0068855_101367035 Ga0068855_1013670352 157
69 3300005577 Ga0068857_100013461 Ga0068857_1000134614 157
70 3300005577 Ga0068857_101112724 Ga0068857_1011127242 157
71 3300005578 Ga0068854_100010975 Ga0068854_1000109754 157
72 3300005578 Ga0068854_100854320 Ga0068854_1008543202 157
73 3300005614 Ga0068856_100204485 Ga0068856_1002044852 157
74 3300005614 Ga0068856_100432919 Ga0068856_1004329192 157
75 3300005616 Ga0068852_100006649 Ga0068852_1000066494 157
76 3300005616 Ga0068852_100024276 Ga0068852_1000242763 157
77 3300005616 Ga0068852_100041420 Ga0068852_1000414204 157
78 3300006042 Ga0075368_10263404 Ga0075368_102634042 157
79 3300006237 Ga0097621_100295351 Ga0097621_1002953512 157
80 3300006353 Ga0075370_10207381 Ga0075370_102073812 157
81 3300006881 Ga0068865_100189217 Ga0068865_1001892172 157
82 3300009093 Ga0105240_10071843 Ga0105240_100718432 157
83 3300009174 Ga0105241_10193867 Ga0105241_101938672 157
84 3300009545 Ga0105237_10000449 Ga0105237_1000044932 157
85 3300009545 Ga0105237_11910619 Ga0105237_119106191 157
86 3300009551 Ga0105238_10099565 Ga0105238_100995652 157
87 3300009551 Ga0105238_10177639 Ga0105238_101776394 157
88 3300010375 Ga0105239_10009975 Ga0105239_100099756 157
89 3300010375 Ga0105239_10234949 Ga0105239_102349492 157
90 3300010375 Ga0105239_10276985 Ga0105239_102769852 157
91 3300010375 Ga0105239_11490158 Ga0105239_114901581 157
92 3300013100 Ga0157373_10173691 Ga0157373_101736911 157
93 3300013102 Ga0157371_10008162 Ga0157371_100081622 157
94 3300013102 Ga0157371_10199899 Ga0157371_101998992 157
95 3300013104 Ga0157370_10034029 Ga0157370_100340292 157
96 3300013104 Ga0157370_10080570 Ga0157370_100805703 157
97 3300013104 Ga0157370_11198888 Ga0157370_111988881 157
98 3300013105 Ga0157369_10066777 Ga0157369_100667774 157
99 3300013105 Ga0157369_10517663 Ga0157369_105176632 157
100 3300013296 Ga0157374_10015333 Ga0157374_100153337 157
101 3300013297 Ga0157378_10397146 Ga0157378_103971462 157
102 3300013307 Ga0157372_10110687 Ga0157372_101106873 157
103 3300014325 Ga0163163_12096180 Ga0163163_120961802 157
104 3300020069 Ga0197907_10579377 Ga0197907_105793772 157
105 3300020070 Ga0206356_10051688 Ga0206356_100516881 157
106 3300020082 Ga0206353_11133977 Ga0206353_111339772 157
107 3300025907 Ga0207645_10385846 Ga0207645_103858461 157
108 3300025909 Ga0207705_10037978 Ga0207705_100379784 157
109 3300025911 Ga0207654_10077951 Ga0207654_100779513 157
110 3300025913 Ga0207695_10066670 Ga0207695_100666705 157
111 3300025914 Ga0207671_10000439 Ga0207671_100004394 157
112 3300025914 Ga0207671_10832326 Ga0207671_108323262 157
113 3300025919 Ga0207657_10018131 Ga0207657_100181315 157
114 3300025920 Ga0207649_10030843 Ga0207649_100308433 157
115 3300025920 Ga0207649_10054321 Ga0207649_100543213 157
116 3300025920 Ga0207649_10328457 Ga0207649_103284572 157
117 3300025921 Ga0207652_10994157 Ga0207652_109941571 157
118 3300025924 Ga0207694_11350283 Ga0207694_113502831 157
119 3300025926 Ga0207659_10177059 Ga0207659_101770592 157
120 3300025932 Ga0207690_10041697 Ga0207690_100416974 157
121 3300025932 Ga0207690_10119285 Ga0207690_101192853 157
122 3300025932 Ga0207690_10683798 Ga0207690_106837981 157
123 3300025933 Ga0207706_10053421 Ga0207706_100534214 157
124 3300025938 Ga0207704_10542933 Ga0207704_105429332 157
125 3300025940 Ga0207691_10706073 Ga0207691_107060731 157
126 3300025944 Ga0207661_10475731 Ga0207661_104757312 157
127 3300025949 Ga0207667_10067980 Ga0207667_100679805 157
128 3300025949 Ga0207667_11370126 Ga0207667_113701261 157
129 3300025981 Ga0207640_10911697 Ga0207640_109116971 157
130 3300025981 Ga0207640_11051680 Ga0207640_110516802 157
131 3300026041 Ga0207639_10141089 Ga0207639_101410893 157
132 3300026041 Ga0207639_10388663 Ga0207639_103886632 157
133 3300026078 Ga0207702_10062913 Ga0207702_100629134 157
134 3300026078 Ga0207702_10605404 Ga0207702_106054042 157
135 3300026078 Ga0207702_10835289 Ga0207702_108352892 157
136 3300026116 Ga0207674_10012591 Ga0207674_100125915 157
137 3300026121 Ga0207683_10861033 Ga0207683_108610332 157
138 3300026142 Ga0207698_10041277 Ga0207698_100412774 157
139 3300026142 Ga0207698_10405401 Ga0207698_104054012 157
140 3300028379 Ga0268266_10000474 Ga0268266_1000047443 157
141 3300028577 Ga0265318_10008026 Ga0265318_100080264 157
142 3300031238 Ga0265332_10144536 Ga0265332_101445362 157
143 3300031240 Ga0265320_10028777 Ga0265320_100287773 157
144 3300031247 Ga0265340_10098326 Ga0265340_100983262 157
145 3300031250 Ga0265331_10099912 Ga0265331_100999122 157
146 3300031711 Ga0265314_10036366 Ga0265314_100363664 157
147 3300031712 Ga0265342_10069704 Ga0265342_100697042 157
148 3300035112 Ga0373932_0134457 Ga0373932_0134457_196_669 157
149 3300035121 Ga0373960_0128783 Ga0373960_0128783_119_592 157
150 3300035242 Ga0373962_0300448 Ga0373962_0300448_48_521 157
151 3300037312 Ga0395899_0177782 Ga0395899_0177782_718_1191 157
152 3300037418 Ga0395900_0196929 Ga0395900_0196929_1135_1608 157
153 3300037466 Ga0395898_1811291 Ga0395898_1811291_27_500 157
154 3300038443 Ga0395901_0890643 Ga0395901_0890643_122_595 157
155 3300041512 Ga0451853_2753112 Ga0451853_2753112_270_743 157
156 3300046516 Ga0495628_0843858 Ga0495628_0843858_46_525 157
157 3300048911 Ga0496108_0863465 Ga0496108_0863465_67_540 157
158 3300048929 Ga0496126_0125573 Ga0496126_0125573_1258_1731 157
159 3300049569 Ga0501032_0017227 Ga0501032_0017227_1553_2026 157
160 3300049570 Ga0501033_0264242 Ga0501033_0264242_416_889 157
161 3300049571 Ga0501034_0155814 Ga0501034_0155814_288_761 157
162 3300049571 Ga0501034_0759572 Ga0501034_0759572_63_536 157
163 3300049571 Ga0501034_1055830 Ga0501034_1055830_63_536 157
164 3300049572 Ga0501036_0034608 Ga0501036_0034608_72_545 157
165 3300049573 Ga0501037_0119831 Ga0501037_0119831_987_1460 157
166 3300049574 Ga0501038_0008126 Ga0501038_0008126_1279_1752 157
167 3300049575 Ga0501039_0026711 Ga0501039_0026711_303_776 157
168 3300049579 Ga0501043_0961802 Ga0501043_0961802_68_541 157
169 3300049581 Ga0501047_0797823 Ga0501047_0797823_95_574 157
170 3300049582 Ga0501048_0505897 Ga0501048_0505897_59_532 157
171 3300049584 Ga0501068_0175799 Ga0501068_0175799_712_1185 157
172 3300049586 Ga0501070_0053374 Ga0501070_0053374_1559_2032 157
173 3300049587 Ga0501071_0442410 Ga0501071_0442410_36_509 157
174 3300049823 Ga0501044_0199360 Ga0501044_0199360_685_1158 157
175 3300050496 nmdc:mga07m45_144289_c1 nmdc:mga07m45_144289_c1_565_1038 157
176 3300053108 Ga0500562_020268 Ga0500562_020268_270_743 157
177 3300053158 Ga0500627_0042409 Ga0500627_0042409_604_1077 157
178 3300005327 Ga0070658_10484746 Ga0070658_104847462 158
179 3300005366 Ga0070659_100424167 Ga0070659_1004241672 158
180 3300005539 Ga0068853_100013217 Ga0068853_1000132173 158
181 3300025932 Ga0207690_10667524 Ga0207690_106675242 158
182 3300026041 Ga0207639_10004587 Ga0207639_1000458712 158
183 3300049589 Ga0501073_0760225 Ga0501073_0760225_17_493 158
184 3300005339 Ga0070660_100006116 Ga0070660_1000061168 159
185 3300005344 Ga0070661_100621204 Ga0070661_1006212041 159
186 3300005366 Ga0070659_100067883 Ga0070659_1000678834 159
187 3300005455 Ga0070663_101324488 Ga0070663_1013244881 159
188 3300005458 Ga0070681_11350162 Ga0070681_113501621 159
189 3300005530 Ga0070679_100071081 Ga0070679_1000710814 159
190 3300005563 Ga0068855_100843498 Ga0068855_1008434982 159
191 3300025909 Ga0207705_10159067 Ga0207705_101590671 159
192 3300025912 Ga0207707_11035933 Ga0207707_110359331 159
193 3300025919 Ga0207657_10015968 Ga0207657_100159682 159
194 3300025921 Ga0207652_10823807 Ga0207652_108238071 159
195 3300025932 Ga0207690_10491664 Ga0207690_104916642 159
196 3300025949 Ga0207667_10089702 Ga0207667_100897023 159
197 3300026067 Ga0207678_11209257 Ga0207678_112092571 159
198 3300049568 Ga0501031_0432153 Ga0501031_0432153_139_618 159
199 3300049569 Ga0501032_0066765 Ga0501032_0066765_1576_2055 159
200 3300049573 Ga0501037_0328531 Ga0501037_0328531_285_764 159
201 3300049574 Ga0501038_0113607 Ga0501038_0113607_440_919 159
202 3300049580 Ga0501046_0024428 Ga0501046_0024428_4175_4654 159
203 3300049581 Ga0501047_0091027 Ga0501047_0091027_2071_2556 159
204 3300049585 Ga0501069_0437396 Ga0501069_0437396_280_759 159
205 3300049586 Ga0501070_0113691 Ga0501070_0113691_1153_1632 159
206 3300049822 Ga0501035_0650629 Ga0501035_0650629_331_810 159
207 3300005616 Ga0068852_101522360 Ga0068852_1015223602 160
208 3300013105 Ga0157369_10122701 Ga0157369_101227014 160
209 3300025904 Ga0207647_10106596 Ga0207647_101065962 160
210 3300037312 Ga0395899_0035154 Ga0395899_0035154_1815_2297 160
211 3300037418 Ga0395900_0330046 Ga0395900_0330046_969_1451 160
212 3300037418 Ga0395900_0368530 Ga0395900_0368530_181_663 160
213 3300037466 Ga0395898_0114778 Ga0395898_0114778_357_839 160
214 3300038443 Ga0395901_0316484 Ga0395901_0316484_181_663 160
215 3300003214 JGI25165J46597_1002712 JGI25165J46597_10027122 161
216 3300025261 Ga0209233_1004974 Ga0209233_10049742 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

8

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2839 21 151
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2667 21 151
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.2308 8 146
6k01-assembly1.cif.gz_D crystal structure of xh2a-h2b 0.2147 60 140
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.2097 8 146
ID Description Score Start End Superfamily
af_Q566D0_1_116_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2933 54 151 1.20.140.150
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2608 21 148 1.20.1260.10
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.26 21 148 1.20.1260.10
af_Q566D0_1_116_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2596 54 151 1.20.140.150
ID Description Score Start End GO Terms
AF-T0SLZ2-F1-model_v4 Sulfur transport 0.8881 9 148 GO:0016020
AF-A0A2H0Q5T5-F1-model_v4 YeeE/YedE family protein 0.8816 9 144 GO:0016020
AF-A0A0F3IX02-F1-model_v4 Uncharacterized protein 0.8813 8 143 GO:0016020
AF-A0A2D9F325-F1-model_v4 YeeE/YedE family protein 0.8762 9 144 GO:0016020
AF-A0A0H4XEQ6-F1-model_v4 GENE II AND X protein 0.8754 9 151 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.29 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map