F327178

General Info

Members Datasets Scaffolds Average Seq Length
216 132 432 527

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10008048|Ga0065712_100080481
Length 559
Sequence MILSMSKFFIRLSNYIYDHILKIRAMKNLYKFVLMVVMLSGTLITSAQITNLNSYPTATSVIFLDFDGHDVSGTMWNVNGPFTCNSSGLSDAAITEVFDRVAEDYRPFNINVTTNETKYNSAPYNKRMRVVITTSNEWYGTGAGGVAYVNSFTWGDNSPCFVFSALLGYSVKNVAEAASHEAGHTLGLRHQSSYNAACAKLSDYNWGQGTGEIGWAPIMGASYNQNMTLWNSGPNSLGCGVIQDDLSVITNATNGFGYRTDDNTNTYATATPVTFNSSGQGIISGVIEKTDDKDLFKITVPKFSRLQLNAIPYNVGTGXSGSDLDLQVDFLDGSYASIGTYNPGNLLSSVIDTFINAGTYYMRIDGKGNIFAPEYGSLGSYSLQVNYSDASVLDIRRLELRGRLNGDMHTLSWLIETDEQVKKQVIEVSNNGINFISLDQPNNTLRNYSYHPLDNRPLLYRLHITLDNLKEYYSNVIAIRQGKALKPQLVGNTISGNSITINCPANYHYQIIDQSGRLLSKGAVEKGYSSLGLGSINTGIYIIRFTDGEQQWSEKFIKR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
119 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
122 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
123 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 0
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 6.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10008048 3300005290 Bacteria 2874
2 rootL2_10200952 3300003322 Bacteria 4645
3 rootH1_10301502 3300003323 Bacteria 3728
4 Ga0065704_10106408 3300005289 Bacteria 2084
5 Ga0065712_10002222 3300005290 Bacteria 8378
6 Ga0065715_10005986 3300005293 Bacteria 5971
7 Ga0070683_100058506 3300005329 Bacteria 3580
8 Ga0070683_100068121 3300005329 Bacteria 3315
9 Ga0070670_100041225 3300005331 Bacteria 3968
10 Ga0070670_100054761 3300005331 Bacteria 3425
11 Ga0070670_100078050 3300005331 Bacteria 2845
12 Ga0068869_100006019 3300005334 Bacteria 7672
13 Ga0068869_100083240 3300005334 Bacteria 2392
14 Ga0070680_100032350 3300005336 Bacteria 4210
15 Ga0070682_100008811 3300005337 Bacteria 5695
16 Ga0068868_100120449 3300005338 Bacteria 2140
17 Ga0070660_100001959 3300005339 Bacteria 14198
18 Ga0070689_100018385 3300005340 Bacteria 5147
19 Ga0070687_100032547 3300005343 Bacteria 2566
20 Ga0070673_100020821 3300005364 Bacteria 4738
21 Ga0070688_100024251 3300005365 Bacteria 3576
22 Ga0070659_100029611 3300005366 Bacteria 4231
23 Ga0070678_100017833 3300005456 Bacteria 4582
24 Ga0068867_100007580 3300005459 Bacteria 7680
25 Ga0070685_10002080 3300005466 Bacteria 10351
26 Ga0070685_10004179 3300005466 Bacteria 7282
27 Ga0070698_100024064 3300005471 Bacteria 6357
28 Ga0070698_100055572 3300005471 Bacteria 4013
29 Ga0070679_100000113 3300005530 Bacteria 63640
30 Ga0070679_100001149 3300005530 Bacteria 23184
31 Ga0070679_100089428 3300005530 Bacteria 3066
32 Ga0070679_100154208 3300005530 Bacteria 2272
33 Ga0068853_100023090 3300005539 Bacteria 5205
34 Ga0070672_100030184 3300005543 Bacteria 4070
35 Ga0070672_100083068 3300005543 Bacteria 2570
36 Ga0070665_100012789 3300005548 Bacteria 8456
37 Ga0068855_100007383 3300005563 Bacteria 13306
38 Ga0068855_100050147 3300005563 Bacteria 4920
39 Ga0068855_100218554 3300005563 Bacteria 2138
40 Ga0068856_100011695 3300005614 Bacteria 8514
41 Ga0068856_100033139 3300005614 Bacteria 5059
42 Ga0068852_100000848 3300005616 Bacteria 20294
43 Ga0068852_100020254 3300005616 Bacteria 5287
44 Ga0068859_100016832 3300005617 Bacteria 7339
45 Ga0068859_100061553 3300005617 Bacteria 3782
46 Ga0068859_100110483 3300005617 Bacteria 2811
47 Ga0068864_100061097 3300005618 Bacteria 3264
48 Ga0068866_10016978 3300005718 Bacteria 3266
49 Ga0068866_10021851 3300005718 Bacteria 2953
50 Ga0068861_100120787 3300005719 Bacteria 2113
51 Ga0068863_100007551 3300005841 Bacteria 10635
52 Ga0068858_100082283 3300005842 Bacteria 2992
53 Ga0068860_100014853 3300005843 Bacteria 7614
54 Ga0068860_100019177 3300005843 Bacteria 6639
55 Ga0068860_100131426 3300005843 Unclassified 2403
56 Ga0068860_100238697 3300005843 Bacteria 1768
57 Ga0068862_100041413 3300005844 Bacteria 3918
58 Ga0068862_100046545 3300005844 Bacteria 3701
59 Ga0075366_10011183 3300006195 Bacteria 5060
60 Ga0097621_100012447 3300006237 Bacteria 6308
61 Ga0068871_100010690 3300006358 Bacteria 6711
62 Ga0075428_100052960 3300006844 Bacteria 4446
63 Ga0075430_100016016 3300006846 Bacteria 6384
64 Ga0075429_100033899 3300006880 Bacteria 4436
65 Ga0068865_100001928 3300006881 Bacteria 12208
66 Ga0097620_100016833 3300006931 Bacteria 7339
67 Ga0097620_100061543 3300006931 Bacteria 3782
68 Ga0097620_100110487 3300006931 Bacteria 2811
69 Ga0105240_10051078 3300009093 Bacteria 5206
70 Ga0111539_10006668 3300009094 Bacteria 14871
71 Ga0105247_10068267 3300009101 Bacteria 2216
72 Ga0114129_10005331 3300009147 Bacteria 18156
73 Ga0105241_10008820 3300009174 Bacteria 7410
74 Ga0105242_10018508 3300009176 Bacteria 5447
75 Ga0105242_10044054 3300009176 Bacteria 3612
76 Ga0105248_10055826 3300009177 Bacteria 4431
77 Ga0105237_10081203 3300009545 Bacteria 3233
78 Ga0105249_10037534 3300009553 Bacteria 4397
79 Ga0105249_10255160 3300009553 Unclassified 1740
80 Ga0105239_10034503 3300010375 Bacteria 5556
81 Ga0157373_10000699 3300013100 Bacteria 26275
82 Ga0157373_10009099 3300013100 Bacteria 7347
83 Ga0157373_10037509 3300013100 Bacteria 3474
84 Ga0157373_10073447 3300013100 Bacteria 2413
85 Ga0157371_10000284 3300013102 Bacteria 68549
86 Ga0157371_10000725 3300013102 Bacteria 38633
87 Ga0157371_10002541 3300013102 Bacteria 17330
88 Ga0157371_10007132 3300013102 Bacteria 9077
89 Ga0157371_10013022 3300013102 Bacteria 6332
90 Ga0157371_10015704 3300013102 Bacteria 5669
91 Ga0157371_10015828 3300013102 Bacteria 5642
92 Ga0157371_10016428 3300013102 Bacteria 5525
93 Ga0157371_10018851 3300013102 Bacteria 5097
94 Ga0157371_10019293 3300013102 Bacteria 5030
95 Ga0157371_10024358 3300013102 Bacteria 4421
96 Ga0157370_10001924 3300013104 Bacteria 25541
97 Ga0157370_10003783 3300013104 Bacteria 17662
98 Ga0157370_10025275 3300013104 Bacteria 5879
99 Ga0157369_10020421 3300013105 Bacteria 7403
100 Ga0157369_10035353 3300013105 Bacteria 5479
101 Ga0157378_10060956 3300013297 Unclassified 3366
102 Ga0163162_10113206 3300013306 Unclassified 2812
103 Ga0157372_10004075 3300013307 Bacteria 15665
104 Ga0157372_10034921 3300013307 Bacteria 5533
105 Ga0157372_10093088 3300013307 Bacteria 3429
106 Ga0157372_10209345 3300013307 Bacteria 2260
107 Ga0157372_10366686 3300013307 Unclassified 1678
108 Ga0157375_10055440 3300013308 Bacteria 3908
109 Ga0163163_10057583 3300014325 Bacteria 3843
110 Ga0157380_10011115 3300014326 Bacteria 6494
111 Ga0157380_10013625 3300014326 Bacteria 5934
112 Ga0157380_10096871 3300014326 Bacteria 2447
113 Ga0157377_10021465 3300014745 Unclassified 3397
114 Ga0157377_10086448 3300014745 Bacteria 1843
115 Ga0157379_10083477 3300014968 Bacteria 2863
116 Ga0207710_10001574 3300025900 Bacteria 11207
117 Ga0207647_10028356 3300025904 Bacteria 3637
118 Ga0207643_10004498 3300025908 Bacteria 7493
119 Ga0207705_10032484 3300025909 Bacteria 3730
120 Ga0207705_10070137 3300025909 Bacteria 2539
121 Ga0207707_10076088 3300025912 Bacteria 2929
122 Ga0207707_10207583 3300025912 Bacteria 1707
123 Ga0207695_10004070 3300025913 Bacteria 20110
124 Ga0207660_10075997 3300025917 Bacteria 2455
125 Ga0207657_10010738 3300025919 Bacteria 9119
126 Ga0207657_10022186 3300025919 Bacteria 5954
127 Ga0207657_10046054 3300025919 Bacteria 3822
128 Ga0207652_10000045 3300025921 Bacteria 125343
129 Ga0207652_10000819 3300025921 Bacteria 29643
130 Ga0207652_10012877 3300025921 Bacteria 6765
131 Ga0207652_10016143 3300025921 Bacteria 6090
132 Ga0207652_10017767 3300025921 Bacteria 5826
133 Ga0207681_10021867 3300025923 Bacteria 4072
134 Ga0207650_10030925 3300025925 Bacteria 3862
135 Ga0207644_10060086 3300025931 Bacteria 2750
136 Ga0207686_10038087 3300025934 Bacteria 2907
137 Ga0207670_10002352 3300025936 Bacteria 9907
138 Ga0207691_10001776 3300025940 Bacteria 21223
139 Ga0207689_10008992 3300025942 Bacteria 8653
140 Ga0207689_10030722 3300025942 Bacteria 4476
141 Ga0207689_10068489 3300025942 Bacteria 2917
142 Ga0207689_10111180 3300025942 Bacteria 2252
143 Ga0207667_10016855 3300025949 Bacteria 8241
144 Ga0207667_10025119 3300025949 Bacteria 6528
145 Ga0207667_10222021 3300025949 Unclassified 1936
146 Ga0207712_10006134 3300025961 Bacteria 7578
147 Ga0207712_10012082 3300025961 Bacteria 5513
148 Ga0207712_10032248 3300025961 Bacteria 3535
149 Ga0207640_10073722 3300025981 Bacteria 2307
150 Ga0207658_10088349 3300025986 Bacteria 2396
151 Ga0207703_10043718 3300026035 Bacteria 3597
152 Ga0207639_10031531 3300026041 Bacteria 3896
153 Ga0207708_10113994 3300026075 Unclassified 2101
154 Ga0207702_10176056 3300026078 Bacteria 1966
155 Ga0207641_10000549 3300026088 Bacteria 42051
156 Ga0207648_10004829 3300026089 Bacteria 13743
157 Ga0207648_10069482 3300026089 Bacteria 3069
158 Ga0207648_10141405 3300026089 Unclassified 2121
159 Ga0207676_10133383 3300026095 Bacteria 2115
160 Ga0207675_100005430 3300026118 Bacteria 12213
161 Ga0207683_10000943 3300026121 Bacteria 26669
162 Ga0207683_10038720 3300026121 Bacteria 4158
163 Ga0207683_10047913 3300026121 Bacteria 3742
164 Ga0207698_10003055 3300026142 Bacteria 10033
165 Ga0207698_10063330 3300026142 Bacteria 2893
166 Ga0268265_10009351 3300028380 Bacteria 6624
167 Ga0268265_10022623 3300028380 Bacteria 4419
168 Ga0268265_10175703 3300028380 Bacteria 1835
169 Ga0268264_10008474 3300028381 Bacteria 8550
170 Ga0268264_10014651 3300028381 Bacteria 6443
171 Ga0268264_10052751 3300028381 Bacteria 3391
172 Ga0395899_0031279 3300037312 Bacteria 4000
173 Ga0395900_0004195 3300037418 Bacteria 15298
174 Ga0395900_0034040 3300037418 Bacteria 5244
175 Ga0395900_0062544 3300037418 Bacteria 3826
176 Ga0395900_0070024 3300037418 Bacteria 3606
177 Ga0395898_0003718 3300037466 Bacteria 16922
178 Ga0395898_0024286 3300037466 Bacteria 6113
179 Ga0395898_0078390 3300037466 Bacteria 3187
180 Ga0395905_0037498 3300037471 Bacteria 4550
181 Ga0395905_0228250 3300037471 Bacteria 1741
182 Ga0395901_0012431 3300038443 Bacteria 8638
183 Ga0439441_002348 3300042001 Bacteria 2657
184 Ga0439449_0043762 3300042007 Unclassified 1662
185 Ga0495668_0000242 3300046616 Bacteria 78022
186 Ga0495686_0107284 3300047472 Bacteria 1678
187 Ga0501031_0005353 3300049568 Bacteria 8357
188 Ga0501032_0067862 3300049569 Bacteria 2382
189 Ga0501032_0129291 3300049569 Bacteria 1667
190 Ga0501034_0050032 3300049571 Bacteria 4216
191 Ga0501034_0099303 3300049571 Bacteria 2906
192 Ga0501036_0030139 3300049572 Bacteria 4583
193 Ga0501037_0024253 3300049573 Bacteria 4486
194 Ga0501038_0049346 3300049574 Bacteria 3639
195 Ga0501039_0137950 3300049575 Unclassified 1915
196 Ga0501043_0024351 3300049579 Bacteria 4750
197 Ga0501046_0054413 3300049580 Bacteria 3148
198 Ga0501070_0031992 3300049586 Bacteria 4405
199 Ga0501198_001890 3300049649 Bacteria 2768
200 Ga0501207_005932 3300049654 Unclassified 1703
201 Ga0501223_001821 3300049663 Bacteria 4814
202 Ga0501252_001037 3300049682 Unclassified 2443
203 Ga0501261_000732 3300049690 Bacteria 4112
204 Ga0501221_000086 3300049704 Bacteria 10739
205 Ga0501080_0116348 3300049742 Bacteria 2478
206 Ga0501035_0011438 3300049822 Bacteria 8229
207 Ga0501035_0051089 3300049822 Unclassified 3703
208 Ga0501044_0019756 3300049823 Bacteria 7198
209 Ga0501044_0134680 3300049823 Bacteria 2463
210 Ga0501044_0181869 3300049823 Bacteria 2069
211 Ga0501212_000717 3300049851 Bacteria 3381
212 nmdc:mga0k408_24124_c1 3300050493 Bacteria 3436
213 nmdc:mga05p37_102184_c1 3300050507 Bacteria 3530
214 nmdc:mga09592_24712_c1 3300050508 Bacteria 4969
215 nmdc:mga08y16_20692_c1 3300050511 Bacteria 6944
216 Ga0500611_000021 3300053727 Bacteria 102395
217 Ga0065712_10008048
218 rootL2_10200952
219 rootH1_10301502
220 Ga0065704_10106408
221 Ga0065712_10002222
222 Ga0065715_10005986
223 Ga0070683_100058506
224 Ga0070683_100068121
225 Ga0070670_100041225
226 Ga0070670_100054761
227 Ga0070670_100078050
228 Ga0068869_100006019
229 Ga0068869_100083240
230 Ga0070680_100032350
231 Ga0070682_100008811
232 Ga0068868_100120449
233 Ga0070660_100001959
234 Ga0070689_100018385
235 Ga0070687_100032547
236 Ga0070673_100020821
237 Ga0070688_100024251
238 Ga0070659_100029611
239 Ga0070678_100017833
240 Ga0068867_100007580
241 Ga0070685_10002080
242 Ga0070685_10004179
243 Ga0070698_100024064
244 Ga0070698_100055572
245 Ga0070679_100000113
246 Ga0070679_100001149
247 Ga0070679_100089428
248 Ga0070679_100154208
249 Ga0068853_100023090
250 Ga0070672_100030184
251 Ga0070672_100083068
252 Ga0070665_100012789
253 Ga0068855_100007383
254 Ga0068855_100050147
255 Ga0068855_100218554
256 Ga0068856_100011695
257 Ga0068856_100033139
258 Ga0068852_100000848
259 Ga0068852_100020254
260 Ga0068859_100016832
261 Ga0068859_100061553
262 Ga0068859_100110483
263 Ga0068864_100061097
264 Ga0068866_10016978
265 Ga0068866_10021851
266 Ga0068861_100120787
267 Ga0068863_100007551
268 Ga0068858_100082283
269 Ga0068860_100014853
270 Ga0068860_100019177
271 Ga0068860_100131426
272 Ga0068860_100238697
273 Ga0068862_100041413
274 Ga0068862_100046545
275 Ga0075366_10011183
276 Ga0097621_100012447
277 Ga0068871_100010690
278 Ga0075428_100052960
279 Ga0075430_100016016
280 Ga0075429_100033899
281 Ga0068865_100001928
282 Ga0097620_100016833
283 Ga0097620_100061543
284 Ga0097620_100110487
285 Ga0105240_10051078
286 Ga0111539_10006668
287 Ga0105247_10068267
288 Ga0114129_10005331
289 Ga0105241_10008820
290 Ga0105242_10018508
291 Ga0105242_10044054
292 Ga0105248_10055826
293 Ga0105237_10081203
294 Ga0105249_10037534
295 Ga0105249_10255160
296 Ga0105239_10034503
297 Ga0157373_10000699
298 Ga0157373_10009099
299 Ga0157373_10037509
300 Ga0157373_10073447
301 Ga0157371_10000284
302 Ga0157371_10000725
303 Ga0157371_10002541
304 Ga0157371_10007132
305 Ga0157371_10013022
306 Ga0157371_10015704
307 Ga0157371_10015828
308 Ga0157371_10016428
309 Ga0157371_10018851
310 Ga0157371_10019293
311 Ga0157371_10024358
312 Ga0157370_10001924
313 Ga0157370_10003783
314 Ga0157370_10025275
315 Ga0157369_10020421
316 Ga0157369_10035353
317 Ga0157378_10060956
318 Ga0163162_10113206
319 Ga0157372_10004075
320 Ga0157372_10034921
321 Ga0157372_10093088
322 Ga0157372_10209345
323 Ga0157372_10366686
324 Ga0157375_10055440
325 Ga0163163_10057583
326 Ga0157380_10011115
327 Ga0157380_10013625
328 Ga0157380_10096871
329 Ga0157377_10021465
330 Ga0157377_10086448
331 Ga0157379_10083477
332 Ga0207710_10001574
333 Ga0207647_10028356
334 Ga0207643_10004498
335 Ga0207705_10032484
336 Ga0207705_10070137
337 Ga0207707_10076088
338 Ga0207707_10207583
339 Ga0207695_10004070
340 Ga0207660_10075997
341 Ga0207657_10010738
342 Ga0207657_10022186
343 Ga0207657_10046054
344 Ga0207652_10000045
345 Ga0207652_10000819
346 Ga0207652_10012877
347 Ga0207652_10016143
348 Ga0207652_10017767
349 Ga0207681_10021867
350 Ga0207650_10030925
351 Ga0207644_10060086
352 Ga0207686_10038087
353 Ga0207670_10002352
354 Ga0207691_10001776
355 Ga0207689_10008992
356 Ga0207689_10030722
357 Ga0207689_10068489
358 Ga0207689_10111180
359 Ga0207667_10016855
360 Ga0207667_10025119
361 Ga0207667_10222021
362 Ga0207712_10006134
363 Ga0207712_10012082
364 Ga0207712_10032248
365 Ga0207640_10073722
366 Ga0207658_10088349
367 Ga0207703_10043718
368 Ga0207639_10031531
369 Ga0207708_10113994
370 Ga0207702_10176056
371 Ga0207641_10000549
372 Ga0207648_10004829
373 Ga0207648_10069482
374 Ga0207648_10141405
375 Ga0207676_10133383
376 Ga0207675_100005430
377 Ga0207683_10000943
378 Ga0207683_10038720
379 Ga0207683_10047913
380 Ga0207698_10003055
381 Ga0207698_10063330
382 Ga0268265_10009351
383 Ga0268265_10022623
384 Ga0268265_10175703
385 Ga0268264_10008474
386 Ga0268264_10014651
387 Ga0268264_10052751
388 Ga0395899_0031279
389 Ga0395900_0004195
390 Ga0395900_0034040
391 Ga0395900_0062544
392 Ga0395900_0070024
393 Ga0395898_0003718
394 Ga0395898_0024286
395 Ga0395898_0078390
396 Ga0395905_0037498
397 Ga0395905_0228250
398 Ga0395901_0012431
399 Ga0439441_002348
400 Ga0439449_0043762
401 Ga0495668_0000242
402 Ga0495686_0107284
403 Ga0501031_0005353
404 Ga0501032_0067862
405 Ga0501032_0129291
406 Ga0501034_0050032
407 Ga0501034_0099303
408 Ga0501036_0030139
409 Ga0501037_0024253
410 Ga0501038_0049346
411 Ga0501039_0137950
412 Ga0501043_0024351
413 Ga0501046_0054413
414 Ga0501070_0031992
415 Ga0501198_001890
416 Ga0501207_005932
417 Ga0501223_001821
418 Ga0501252_001037
419 Ga0501261_000732
420 Ga0501221_000086
421 Ga0501080_0116348
422 Ga0501035_0011438
423 Ga0501035_0051089
424 Ga0501044_0019756
425 Ga0501044_0134680
426 Ga0501044_0181869
427 Ga0501212_000717
428 nmdc:mga0k408_24124_c1
429 nmdc:mga05p37_102184_c1
430 nmdc:mga09592_24712_c1
431 nmdc:mga08y16_20692_c1
432 Ga0500611_000021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13582

Reprolysin_3

Metallo-peptidase family M12B Reprolysin-like

91

191

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g5a-assembly1.cif.gz_B crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution 0.8571 472 531
3afg-assembly1.cif.gz_A crystal structure of pron-tk-sp from thermococcus kodakaraensis 0.8201 254 361
1v5j-assembly1.cif.gz_A solution structure of rsgi ruh-008, fn3 domain in human cdna 0.7961 372 456
3afg-assembly2.cif.gz_B crystal structure of pron-tk-sp from thermococcus kodakaraensis 0.7937 249 361
3d33-assembly1.cif.gz_A crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution 0.7807 468 533
ID Description Score Start End Superfamily
af_H2KZQ5_581_676_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8582 374 454 2.60.40.10
4u49A01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8562 372 452 2.60.40.10
af_F1QXA6_608_709_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8439 372 455 2.60.40.10
af_F1QWV3_515_612_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8403 372 455 2.60.40.10
af_F1Q4W9_1381_1472_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8264 372 453 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y2J796-F1-model_v4 T9SS type A sorting domain-containing protein 0.9403 460 533 GO:0004518
AF-A0A1I3KQ54-F1-model_v4 Por secretion system C-terminal sorting domain-containing protein 0.9263 460 533 GO:0004222
GO:0006508
AF-A0A3D6BS95-F1-model_v4 Secretion system C-terminal sorting domain-containing protein 0.9257 461 533
AF-F4AZT0-F1-model_v4 Secreted protein 0.9237 461 533
AF-A0A2D9Q6B9-F1-model_v4 Secretion system C-terminal sorting domain-containing protein 0.9203 461 533

Map